eIF4E1-like protein

Overview
NameeIF4E1-like protein (ACT98275.1)
Smed IDSMED30021622
Length (bp)858
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of eIF4E1-like protein (SMED30021622) t-SNE clustered cells

Violin plots show distribution of expression levels for eIF4E1-like protein (SMED30021622) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of eIF4E1-like protein (SMED30021622) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for eIF4E1-like protein (SMED30021622) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of eIF4E1-like protein vs. Ensembl Human
Match: EIF4E1B (eukaryotic translation initiation factor 4E family member 1B [Source:HGNC Symbol;Acc:HGNC:33179])

HSP 1 Score: 209.92 bits (533), Expect = 8.031e-67
Identity = 99/183 (54.10%), Postives = 124/183 (67.76%), Query Frame = 3
Query:  114 ELHYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLT--CAIEYTAHTDAQNKSSSRAKCTFRI 656
            ELH LQN+W  +FFKNDRS+ W DN+  V   DTVEDFW L +HI   SKL SGCDY +FKD IQPMWED RNK GG WL++  K QR   LD  WLE L+ L+GE+FE+ S E+CGAVVNIR KGD+++VWT +  +   +  +G+  K+ LGL+    I Y AH D   KS+S AK  F +
Sbjct:   60 ELHPLQNRWALWFFKNDRSRAWQDNLHLVTKVDTVEDFWALYSHIQLASKLSSGCDYALFKDGIQPMWEDSRNKRGGRWLVSLAKQQRHIELDRLWLETLLCLIGESFEEHSREVCGAVVNIRTKGDKIAVWTREAENQAGVLHVGRVYKERLGLSPKTIIGYQAHADTATKSNSLAKNKFVV 242          
BLAST of eIF4E1-like protein vs. Ensembl Human
Match: EIF4E1B (eukaryotic translation initiation factor 4E family member 1B [Source:HGNC Symbol;Acc:HGNC:33179])

HSP 1 Score: 209.92 bits (533), Expect = 8.031e-67
Identity = 99/183 (54.10%), Postives = 124/183 (67.76%), Query Frame = 3
Query:  114 ELHYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLT--CAIEYTAHTDAQNKSSSRAKCTFRI 656
            ELH LQN+W  +FFKNDRS+ W DN+  V   DTVEDFW L +HI   SKL SGCDY +FKD IQPMWED RNK GG WL++  K QR   LD  WLE L+ L+GE+FE+ S E+CGAVVNIR KGD+++VWT +  +   +  +G+  K+ LGL+    I Y AH D   KS+S AK  F +
Sbjct:   60 ELHPLQNRWALWFFKNDRSRAWQDNLHLVTKVDTVEDFWALYSHIQLASKLSSGCDYALFKDGIQPMWEDSRNKRGGRWLVSLAKQQRHIELDRLWLETLLCLIGESFEEHSREVCGAVVNIRTKGDKIAVWTREAENQAGVLHVGRVYKERLGLSPKTIIGYQAHADTATKSNSLAKNKFVV 242          
BLAST of eIF4E1-like protein vs. Ensembl Human
Match: EIF4E1B (eukaryotic translation initiation factor 4E family member 1B [Source:HGNC Symbol;Acc:HGNC:33179])

HSP 1 Score: 209.92 bits (533), Expect = 8.031e-67
Identity = 99/183 (54.10%), Postives = 124/183 (67.76%), Query Frame = 3
Query:  114 ELHYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLT--CAIEYTAHTDAQNKSSSRAKCTFRI 656
            ELH LQN+W  +FFKNDRS+ W DN+  V   DTVEDFW L +HI   SKL SGCDY +FKD IQPMWED RNK GG WL++  K QR   LD  WLE L+ L+GE+FE+ S E+CGAVVNIR KGD+++VWT +  +   +  +G+  K+ LGL+    I Y AH D   KS+S AK  F +
Sbjct:   60 ELHPLQNRWALWFFKNDRSRAWQDNLHLVTKVDTVEDFWALYSHIQLASKLSSGCDYALFKDGIQPMWEDSRNKRGGRWLVSLAKQQRHIELDRLWLETLLCLIGESFEEHSREVCGAVVNIRTKGDKIAVWTREAENQAGVLHVGRVYKERLGLSPKTIIGYQAHADTATKSNSLAKNKFVV 242          
BLAST of eIF4E1-like protein vs. Ensembl Human
Match: EIF4E (eukaryotic translation initiation factor 4E [Source:HGNC Symbol;Acc:HGNC:3287])

HSP 1 Score: 207.608 bits (527), Expect = 2.548e-66
Identity = 96/181 (53.04%), Postives = 125/181 (69.06%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLT--CAIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W  +FFKND+SK W  N++ +  FDTVEDFW L NHI   S L  GCDY +FKD I+PMWED++NK GG WL+T  K QR S LD  WLE L+ L+GE+F+D SD++CGAVVN+R KGD++++WTT+C + EA+  IG+  K+ LGL     I Y +H D   KS S  K  F +
Sbjct:   37 HPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV 217          
BLAST of eIF4E1-like protein vs. Ensembl Human
Match: EIF4E (eukaryotic translation initiation factor 4E [Source:HGNC Symbol;Acc:HGNC:3287])

HSP 1 Score: 207.994 bits (528), Expect = 3.693e-66
Identity = 96/181 (53.04%), Postives = 125/181 (69.06%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLT--CAIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W  +FFKND+SK W  N++ +  FDTVEDFW L NHI   S L  GCDY +FKD I+PMWED++NK GG WL+T  K QR S LD  WLE L+ L+GE+F+D SD++CGAVVN+R KGD++++WTT+C + EA+  IG+  K+ LGL     I Y +H D   KS S  K  F +
Sbjct:   57 HPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV 237          
BLAST of eIF4E1-like protein vs. Ensembl Celegans
Match: ife-3 (Eukaryotic translation initiation factor 4E-3 [Source:UniProtKB/Swiss-Prot;Acc:O61955])

HSP 1 Score: 174.481 bits (441), Expect = 2.082e-53
Identity = 86/176 (48.86%), Postives = 113/176 (64.20%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGL--TCAIEYTAHTDAQNKSSSRAK 641
            H LQN+W  ++ K DR+K+W D +K V  FDTVEDFW L NHI     L  G DYY+FK+ I+PMWED  N  GG WL+  +K +R   LD  WLE+LM +VGE F++  D ICGAVVN+R KGD+VS+WT D +  +   RIGQ +K  L +  T  + Y  H D+  ++SS  K
Sbjct:   32 HPLQNRWALWYLKADRNKEWEDCLKMVSLFDTVEDFWSLYNHIQSAGGLNWGSDYYLFKEGIKPMWEDVNNVQGGRWLVVVDKQRRTQLLDHYWLELLMAIVGEQFDEYGDYICGAVVNVRQKGDKVSLWTRDATRDDVNLRIGQVLKQKLSIPDTEILRYEVHKDSSARTSSTVK 207          
BLAST of eIF4E1-like protein vs. Ensembl Celegans
Match: ife-3 (Eukaryotic translation initiation factor 4E-3 [Source:UniProtKB/Swiss-Prot;Acc:O61955])

HSP 1 Score: 174.481 bits (441), Expect = 2.082e-53
Identity = 86/176 (48.86%), Postives = 113/176 (64.20%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGL--TCAIEYTAHTDAQNKSSSRAK 641
            H LQN+W  ++ K DR+K+W D +K V  FDTVEDFW L NHI     L  G DYY+FK+ I+PMWED  N  GG WL+  +K +R   LD  WLE+LM +VGE F++  D ICGAVVN+R KGD+VS+WT D +  +   RIGQ +K  L +  T  + Y  H D+  ++SS  K
Sbjct:   32 HPLQNRWALWYLKADRNKEWEDCLKMVSLFDTVEDFWSLYNHIQSAGGLNWGSDYYLFKEGIKPMWEDVNNVQGGRWLVVVDKQRRTQLLDHYWLELLMAIVGEQFDEYGDYICGAVVNVRQKGDKVSLWTRDATRDDVNLRIGQVLKQKLSIPDTEILRYEVHKDSSARTSSTVK 207          
BLAST of eIF4E1-like protein vs. Ensembl Celegans
Match: ife-3 (Eukaryotic translation initiation factor 4E-3 [Source:UniProtKB/Swiss-Prot;Acc:O61955])

HSP 1 Score: 169.474 bits (428), Expect = 1.831e-51
Identity = 86/178 (48.31%), Postives = 113/178 (63.48%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEK--NQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGL--TCAIEYTAHTDAQNKSSSRAK 641
            H LQN+W  ++ K DR+K+W D +K V  FDTVEDFW L NHI     L  G DYY+FK+ I+PMWED  N  GG WL+  +K   +R   LD  WLE+LM +VGE F++  D ICGAVVN+R KGD+VS+WT D +  +   RIGQ +K  L +  T  + Y  H D+  ++SS  K
Sbjct:   32 HPLQNRWALWYLKADRNKEWEDCLKMVSLFDTVEDFWSLYNHIQSAGGLNWGSDYYLFKEGIKPMWEDVNNVQGGRWLVVVDKQLQRRTQLLDHYWLELLMAIVGEQFDEYGDYICGAVVNVRQKGDKVSLWTRDATRDDVNLRIGQVLKQKLSIPDTEILRYEVHKDSSARTSSTVK 209          
BLAST of eIF4E1-like protein vs. Ensembl Celegans
Match: ife-3 (Eukaryotic translation initiation factor 4E-3 [Source:UniProtKB/Swiss-Prot;Acc:O61955])

HSP 1 Score: 169.474 bits (428), Expect = 1.831e-51
Identity = 86/178 (48.31%), Postives = 113/178 (63.48%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEK--NQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGL--TCAIEYTAHTDAQNKSSSRAK 641
            H LQN+W  ++ K DR+K+W D +K V  FDTVEDFW L NHI     L  G DYY+FK+ I+PMWED  N  GG WL+  +K   +R   LD  WLE+LM +VGE F++  D ICGAVVN+R KGD+VS+WT D +  +   RIGQ +K  L +  T  + Y  H D+  ++SS  K
Sbjct:   32 HPLQNRWALWYLKADRNKEWEDCLKMVSLFDTVEDFWSLYNHIQSAGGLNWGSDYYLFKEGIKPMWEDVNNVQGGRWLVVVDKQLQRRTQLLDHYWLELLMAIVGEQFDEYGDYICGAVVNVRQKGDKVSLWTRDATRDDVNLRIGQVLKQKLSIPDTEILRYEVHKDSSARTSSTVK 209          
BLAST of eIF4E1-like protein vs. Ensembl Celegans
Match: ife-3 (Eukaryotic translation initiation factor 4E-3 [Source:UniProtKB/Swiss-Prot;Acc:O61955])

HSP 1 Score: 169.474 bits (428), Expect = 2.415e-51
Identity = 86/179 (48.04%), Postives = 113/179 (63.13%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEK---NQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGL--TCAIEYTAHTDAQNKSSSRAK 641
            H LQN+W  ++ K DR+K+W D +K V  FDTVEDFW L NHI     L  G DYY+FK+ I+PMWED  N  GG WL+  +K    +R   LD  WLE+LM +VGE F++  D ICGAVVN+R KGD+VS+WT D +  +   RIGQ +K  L +  T  + Y  H D+  ++SS  K
Sbjct:   32 HPLQNRWALWYLKADRNKEWEDCLKMVSLFDTVEDFWSLYNHIQSAGGLNWGSDYYLFKEGIKPMWEDVNNVQGGRWLVVVDKQKLQRRTQLLDHYWLELLMAIVGEQFDEYGDYICGAVVNVRQKGDKVSLWTRDATRDDVNLRIGQVLKQKLSIPDTEILRYEVHKDSSARTSSTVK 210          
BLAST of eIF4E1-like protein vs. Ensembl Fly
Match: eIF4E1 (gene:FBgn0015218 transcript:FBtr0076488)

HSP 1 Score: 183.341 bits (464), Expect = 9.876e-57
Identity = 86/181 (47.51%), Postives = 119/181 (65.75%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDA--LGLTCAIEYTAHTDAQNKSSSRAKCTFRI 656
            H L N WT ++ +NDRSK W D   ++  FDTVEDFW L NHI PPS++  G DY +FK  I+PMWED  NK GG W++T  K+ + + LD  WL++L+ L+GE F D SD+ICGAV+NIRGK +++S+WT D ++ EA   IG K++DA  LG   +++Y  H D   K  S  K  + +
Sbjct:   70 HPLMNVWTLWYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSSK-TDLDNLWLDVLLCLIGEAF-DHSDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDALRLGRNNSLQYQLHKDTMVKQGSNVKSIYTL 248          
BLAST of eIF4E1-like protein vs. Ensembl Fly
Match: eIF4E1 (gene:FBgn0015218 transcript:FBtr0076493)

HSP 1 Score: 182.956 bits (463), Expect = 1.642e-56
Identity = 86/181 (47.51%), Postives = 119/181 (65.75%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDA--LGLTCAIEYTAHTDAQNKSSSRAKCTFRI 656
            H L N WT ++ +NDRSK W D   ++  FDTVEDFW L NHI PPS++  G DY +FK  I+PMWED  NK GG W++T  K+ + + LD  WL++L+ L+GE F D SD+ICGAV+NIRGK +++S+WT D ++ EA   IG K++DA  LG   +++Y  H D   K  S  K  + +
Sbjct:   81 HPLMNVWTLWYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSSK-TDLDNLWLDVLLCLIGEAF-DHSDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDALRLGRNNSLQYQLHKDTMVKQGSNVKSIYTL 259          
BLAST of eIF4E1-like protein vs. Ensembl Fly
Match: eIF4E1 (gene:FBgn0015218 transcript:FBtr0076489)

HSP 1 Score: 182.956 bits (463), Expect = 1.642e-56
Identity = 86/181 (47.51%), Postives = 119/181 (65.75%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDA--LGLTCAIEYTAHTDAQNKSSSRAKCTFRI 656
            H L N WT ++ +NDRSK W D   ++  FDTVEDFW L NHI PPS++  G DY +FK  I+PMWED  NK GG W++T  K+ + + LD  WL++L+ L+GE F D SD+ICGAV+NIRGK +++S+WT D ++ EA   IG K++DA  LG   +++Y  H D   K  S  K  + +
Sbjct:   81 HPLMNVWTLWYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSSK-TDLDNLWLDVLLCLIGEAF-DHSDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDALRLGRNNSLQYQLHKDTMVKQGSNVKSIYTL 259          
BLAST of eIF4E1-like protein vs. Ensembl Fly
Match: eIF4E1 (gene:FBgn0015218 transcript:FBtr0076490)

HSP 1 Score: 182.956 bits (463), Expect = 1.642e-56
Identity = 86/181 (47.51%), Postives = 119/181 (65.75%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDA--LGLTCAIEYTAHTDAQNKSSSRAKCTFRI 656
            H L N WT ++ +NDRSK W D   ++  FDTVEDFW L NHI PPS++  G DY +FK  I+PMWED  NK GG W++T  K+ + + LD  WL++L+ L+GE F D SD+ICGAV+NIRGK +++S+WT D ++ EA   IG K++DA  LG   +++Y  H D   K  S  K  + +
Sbjct:   81 HPLMNVWTLWYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSSK-TDLDNLWLDVLLCLIGEAF-DHSDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDALRLGRNNSLQYQLHKDTMVKQGSNVKSIYTL 259          
BLAST of eIF4E1-like protein vs. Ensembl Fly
Match: eIF4E1 (gene:FBgn0015218 transcript:FBtr0076487)

HSP 1 Score: 182.956 bits (463), Expect = 1.642e-56
Identity = 86/181 (47.51%), Postives = 119/181 (65.75%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDA--LGLTCAIEYTAHTDAQNKSSSRAKCTFRI 656
            H L N WT ++ +NDRSK W D   ++  FDTVEDFW L NHI PPS++  G DY +FK  I+PMWED  NK GG W++T  K+ + + LD  WL++L+ L+GE F D SD+ICGAV+NIRGK +++S+WT D ++ EA   IG K++DA  LG   +++Y  H D   K  S  K  + +
Sbjct:   81 HPLMNVWTLWYLENDRSKSWEDMQNEITSFDTVEDFWSLYNHIKPPSEIKLGSDYSLFKKNIRPMWEDAANKQGGRWVITLNKSSK-TDLDNLWLDVLLCLIGEAF-DHSDQICGAVINIRGKSNKISIWTADGNNEEAALEIGHKLRDALRLGRNNSLQYQLHKDTMVKQGSNVKSIYTL 259          
BLAST of eIF4E1-like protein vs. Ensembl Zebrafish
Match: eif4e1c (eukaryotic translation initiation factor 4E family member 1c [Source:ZFIN;Acc:ZDB-GENE-050417-398])

HSP 1 Score: 206.068 bits (523), Expect = 6.603e-66
Identity = 93/181 (51.38%), Postives = 128/181 (70.72%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCA--IEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W  ++FKND+SK W +N++ +  FDTVEDFW L NHI  PSKL  GCDY +FKD I+PMWEDDRNK GG WL+T  K QR + LD  W+E L+ L+GE+F++ S+++CGAVVN+R KGD++++WT +C + +AI  IGQ+ K+ L L     I Y +H D  +KS S  K  + +
Sbjct:   33 HPLQNRWALWYFKNDKSKSWTENLRLISKFDTVEDFWALYNHIQQPSKLGFGCDYCLFKDGIKPMWEDDRNKLGGRWLMTLSKQQRHNDLDRYWMETLLCLIGESFDEASEDVCGAVVNVRPKGDKIAIWTGNCQNRDAIMTIGQQYKERLSLPSKTLIGYQSHDDTSSKSGSTTKNMYSV 213          
BLAST of eIF4E1-like protein vs. Ensembl Zebrafish
Match: eif4e1c (eukaryotic translation initiation factor 4E family member 1c [Source:ZFIN;Acc:ZDB-GENE-050417-398])

HSP 1 Score: 206.068 bits (523), Expect = 8.527e-66
Identity = 93/181 (51.38%), Postives = 128/181 (70.72%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCA--IEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W  ++FKND+SK W +N++ +  FDTVEDFW L NHI  PSKL  GCDY +FKD I+PMWEDDRNK GG WL+T  K QR + LD  W+E L+ L+GE+F++ S+++CGAVVN+R KGD++++WT +C + +AI  IGQ+ K+ L L     I Y +H D  +KS S  K  + +
Sbjct:   50 HPLQNRWALWYFKNDKSKSWTENLRLISKFDTVEDFWALYNHIQQPSKLGFGCDYCLFKDGIKPMWEDDRNKLGGRWLMTLSKQQRHNDLDRYWMETLLCLIGESFDEASEDVCGAVVNVRPKGDKIAIWTGNCQNRDAIMTIGQQYKERLSLPSKTLIGYQSHDDTSSKSGSTTKNMYSV 230          
BLAST of eIF4E1-like protein vs. Ensembl Zebrafish
Match: eif4e1c (eukaryotic translation initiation factor 4E family member 1c [Source:ZFIN;Acc:ZDB-GENE-050417-398])

HSP 1 Score: 206.068 bits (523), Expect = 8.527e-66
Identity = 93/181 (51.38%), Postives = 128/181 (70.72%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCA--IEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W  ++FKND+SK W +N++ +  FDTVEDFW L NHI  PSKL  GCDY +FKD I+PMWEDDRNK GG WL+T  K QR + LD  W+E L+ L+GE+F++ S+++CGAVVN+R KGD++++WT +C + +AI  IGQ+ K+ L L     I Y +H D  +KS S  K  + +
Sbjct:   50 HPLQNRWALWYFKNDKSKSWTENLRLISKFDTVEDFWALYNHIQQPSKLGFGCDYCLFKDGIKPMWEDDRNKLGGRWLMTLSKQQRHNDLDRYWMETLLCLIGESFDEASEDVCGAVVNVRPKGDKIAIWTGNCQNRDAIMTIGQQYKERLSLPSKTLIGYQSHDDTSSKSGSTTKNMYSV 230          
BLAST of eIF4E1-like protein vs. Ensembl Zebrafish
Match: eif4ea (eukaryotic translation initiation factor 4ea [Source:NCBI gene;Acc:79380])

HSP 1 Score: 205.297 bits (521), Expect = 1.185e-65
Identity = 98/181 (54.14%), Postives = 124/181 (68.51%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLT--CAIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W  +FFKND+SK W  N++ +  FDTVEDFW L NHI   S L SGCDY +FKD I+PMWED+RNK GG WL+T  K QR + LD  WLE L+ LVGE F+D SD++CGAVVNIR KGD++++WTTD  + +AI  IG+  K+ LG+     I Y +H D   KS S  K  F +
Sbjct:   35 HPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDERNKRGGRWLITLSKQQRRADLDRFWLETLLCLVGEAFDDHSDDVCGAVVNIRTKGDKIAIWTTDYENKDAIVHIGRVYKERLGVPPKVIIGYQSHADTATKSGSTTKNKFVV 215          
BLAST of eIF4E1-like protein vs. Ensembl Zebrafish
Match: eif4ea (eukaryotic translation initiation factor 4ea [Source:NCBI gene;Acc:79380])

HSP 1 Score: 205.297 bits (521), Expect = 1.279e-65
Identity = 98/181 (54.14%), Postives = 124/181 (68.51%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLT--CAIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W  +FFKND+SK W  N++ +  FDTVEDFW L NHI   S L SGCDY +FKD I+PMWED+RNK GG WL+T  K QR + LD  WLE L+ LVGE F+D SD++CGAVVNIR KGD++++WTTD  + +AI  IG+  K+ LG+     I Y +H D   KS S  K  F +
Sbjct:   35 HPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDERNKRGGRWLITLSKQQRRADLDRFWLETLLCLVGEAFDDHSDDVCGAVVNIRTKGDKIAIWTTDYENKDAIVHIGRVYKERLGVPPKVIIGYQSHADTATKSGSTTKNKFVV 215          
BLAST of eIF4E1-like protein vs. Ensembl Xenopus
Match: ENSXETT00000049404.1 (eukaryotic translation initiation factor 4E family member 1B [Source:NCBI gene;Acc:100127761])

HSP 1 Score: 203.371 bits (516), Expect = 9.077e-65
Identity = 94/181 (51.93%), Postives = 124/181 (68.51%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLT--CAIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQ++W  +FFKN +S+ W  N++ V  F+TVEDFW L  HI   SKL SGCDY +FKD I+PMWED RNK GG WL+T  K QR S LD  WLE L+ L+GE F++ S+E+CGAV+NIR KGD++++WT +  + EA+  IG+  K+ LGL+    I Y AH D   KSSS +K  F +
Sbjct:   37 HSLQSRWALWFFKNVKSQPWQCNLRLVTTFNTVEDFWSLYTHIQLASKLSSGCDYSLFKDGIEPMWEDSRNKRGGRWLITLSKQQRHSDLDALWLETLLCLIGEAFDEYSEEVCGAVINIRAKGDKIAIWTRETENREAVTHIGKVYKERLGLSSKVVIGYQAHADTATKSSSLSKNKFVV 217          
BLAST of eIF4E1-like protein vs. Ensembl Xenopus
Match: snx1 (sorting nexin 1 [Source:Xenbase;Acc:XB-GENE-992259])

HSP 1 Score: 203.371 bits (516), Expect = 1.024e-64
Identity = 94/181 (51.93%), Postives = 125/181 (69.06%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTC--AIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W  +FFKND+SK W  N++ +  FDTVEDFW L NHI   S L SGCDY +FKD I+PMWED++NK GG WL+T  K QR + LD  WLE LM L+GE+F++ SD++CGAVVN+R KGD++++WTT+  + +A+  IG+  K+ LGL     I Y +H D   KS S  K  F +
Sbjct:   36 HPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRNDLDRFWLETLMCLIGESFDEYSDDVCGAVVNVRAKGDKIAIWTTEFENRDAVTHIGKVYKERLGLPAKVVIGYQSHADTATKSGSTTKNRFVV 216          
BLAST of eIF4E1-like protein vs. Ensembl Xenopus
Match: ENSXETT00000049401.1 (eukaryotic translation initiation factor 4E family member 1B [Source:NCBI gene;Acc:100127761])

HSP 1 Score: 202.986 bits (515), Expect = 2.120e-64
Identity = 94/181 (51.93%), Postives = 124/181 (68.51%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLT--CAIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQ++W  +FFKN +S+ W  N++ V  F+TVEDFW L  HI   SKL SGCDY +FKD I+PMWED RNK GG WL+T  K QR S LD  WLE L+ L+GE F++ S+E+CGAV+NIR KGD++++WT +  + EA+  IG+  K+ LGL+    I Y AH D   KSSS +K  F +
Sbjct:   46 HSLQSRWALWFFKNVKSQPWQCNLRLVTTFNTVEDFWSLYTHIQLASKLSSGCDYSLFKDGIEPMWEDSRNKRGGRWLITLSKQQRHSDLDALWLETLLCLIGEAFDEYSEEVCGAVINIRAKGDKIAIWTRETENREAVTHIGKVYKERLGLSSKVVIGYQAHADTATKSSSLSKNKFVV 226          
BLAST of eIF4E1-like protein vs. Ensembl Xenopus
Match: snx1 (sorting nexin 1 [Source:Xenbase;Acc:XB-GENE-992259])

HSP 1 Score: 204.142 bits (518), Expect = 6.522e-64
Identity = 94/181 (51.93%), Postives = 125/181 (69.06%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTC--AIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W  +FFKND+SK W  N++ +  FDTVEDFW L NHI   S L SGCDY +FKD I+PMWED++NK GG WL+T  K QR + LD  WLE LM L+GE+F++ SD++CGAVVN+R KGD++++WTT+  + +A+  IG+  K+ LGL     I Y +H D   KS S  K  F +
Sbjct:  125 HPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRNDLDRFWLETLMCLIGESFDEYSDDVCGAVVNVRAKGDKIAIWTTEFENRDAVTHIGKVYKERLGLPAKVVIGYQSHADTATKSGSTTKNRFVV 305          
BLAST of eIF4E1-like protein vs. Ensembl Xenopus
Match: txnrd1 (thioredoxin reductase 1 [Source:Xenbase;Acc:XB-GENE-956002])

HSP 1 Score: 113.62 bits (283), Expect = 3.009e-30
Identity = 59/172 (34.30%), Postives = 93/172 (54.07%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKND-----RSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGL--TCAIEYTAHTDA 614
            H LQ  +TF++ +        S+ +  N+K++  F +VE FW   +H+  P  L    D+++FK+ I+PMWEDD NKNGG W++   K         CW  +++ ++GE F    +EICGAVV++R + D +S+W    S      RI   ++  L L     +EY  HTD+
Sbjct:   18 HPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGL----ASRCWENLILAMLGEQFM-VGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTVMEYKTHTDS 184          
BLAST of eIF4E1-like protein vs. Ensembl Mouse
Match: Eif4e (eukaryotic translation initiation factor 4E [Source:MGI Symbol;Acc:MGI:95305])

HSP 1 Score: 206.068 bits (523), Expect = 7.919e-66
Identity = 95/181 (52.49%), Postives = 125/181 (69.06%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLT--CAIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W  +FFKND+SK W  N++ +  FDTVEDFW L NHI   S L  GCDY +FKD I+PMWED++NK GG WL+T  K QR S LD  WLE L+ L+GE+F+D SD++CGAVVN+R KGD++++WTT+C + +A+  IG+  K+ LGL     I Y +H D   KS S  K  F +
Sbjct:   37 HPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV 217          
BLAST of eIF4E1-like protein vs. Ensembl Mouse
Match: Eif4e1b (eukaryotic translation initiation factor 4E family member 1B [Source:MGI Symbol;Acc:MGI:2685119])

HSP 1 Score: 190.274 bits (482), Expect = 2.060e-59
Identity = 91/178 (51.12%), Postives = 121/178 (67.98%), Query Frame = 3
Query:  111 SELHYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCA--IEYTAHTDAQNKSSSRA 638
            S+LH LQ +W  +FFKNDRS+ W DN++ V  F+TVEDFW + +HI   SKL SGCDY +FK+ I PMWED+RNK GG WLL+ +K  R   LD  WLE L+ LVG  FE+ S E+CGAVVNIR K D++++WT++      + +IGQ  K+ LG++    I Y AH D   KS++ A
Sbjct:   62 SKLHPLQYRWVLWFFKNDRSRAWQDNLQLVTKFNTVEDFWAVYSHIKLASKLSSGCDYALFKEGILPMWEDNRNKQGGRWLLSIDKQLRHFELDRLWLETLLCLVGNCFEEYSREVCGAVVNIRTKRDKIALWTSEAEDKAGVMQIGQIYKERLGISTKTIIGYQAHADTAAKSNNLA 239          
BLAST of eIF4E1-like protein vs. Ensembl Mouse
Match: Eif4e1b (eukaryotic translation initiation factor 4E family member 1B [Source:MGI Symbol;Acc:MGI:2685119])

HSP 1 Score: 190.274 bits (482), Expect = 2.060e-59
Identity = 91/178 (51.12%), Postives = 121/178 (67.98%), Query Frame = 3
Query:  111 SELHYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCA--IEYTAHTDAQNKSSSRA 638
            S+LH LQ +W  +FFKNDRS+ W DN++ V  F+TVEDFW + +HI   SKL SGCDY +FK+ I PMWED+RNK GG WLL+ +K  R   LD  WLE L+ LVG  FE+ S E+CGAVVNIR K D++++WT++      + +IGQ  K+ LG++    I Y AH D   KS++ A
Sbjct:   62 SKLHPLQYRWVLWFFKNDRSRAWQDNLQLVTKFNTVEDFWAVYSHIKLASKLSSGCDYALFKEGILPMWEDNRNKQGGRWLLSIDKQLRHFELDRLWLETLLCLVGNCFEEYSREVCGAVVNIRTKRDKIALWTSEAEDKAGVMQIGQIYKERLGISTKTIIGYQAHADTAAKSNNLA 239          
BLAST of eIF4E1-like protein vs. Ensembl Mouse
Match: Eif4e1b (eukaryotic translation initiation factor 4E family member 1B [Source:MGI Symbol;Acc:MGI:2685119])

HSP 1 Score: 190.66 bits (483), Expect = 2.191e-59
Identity = 91/178 (51.12%), Postives = 121/178 (67.98%), Query Frame = 3
Query:  111 SELHYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCA--IEYTAHTDAQNKSSSRA 638
            S+LH LQ +W  +FFKNDRS+ W DN++ V  F+TVEDFW + +HI   SKL SGCDY +FK+ I PMWED+RNK GG WLL+ +K  R   LD  WLE L+ LVG  FE+ S E+CGAVVNIR K D++++WT++      + +IGQ  K+ LG++    I Y AH D   KS++ A
Sbjct:   68 SKLHPLQYRWVLWFFKNDRSRAWQDNLQLVTKFNTVEDFWAVYSHIKLASKLSSGCDYALFKEGILPMWEDNRNKQGGRWLLSIDKQLRHFELDRLWLETLLCLVGNCFEEYSREVCGAVVNIRTKRDKIALWTSEAEDKAGVMQIGQIYKERLGISTKTIIGYQAHADTAAKSNNLA 245          
BLAST of eIF4E1-like protein vs. Ensembl Mouse
Match: Eif4e (eukaryotic translation initiation factor 4E [Source:MGI Symbol;Acc:MGI:95305])

HSP 1 Score: 187.578 bits (475), Expect = 3.825e-59
Identity = 82/145 (56.55%), Postives = 109/145 (75.17%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQ 554
            H LQN+W  +FFKND+SK W  N++ +  FDTVEDFW L NHI   S L  GCDY +FKD I+PMWED++NK GG WL+T  K QR S LD  WLE L+ L+GE+F+D SD++CGAVVN+R KGD++++WTT+C + +A+  IG+
Sbjct:   37 HPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGR 181          
BLAST of eIF4E1-like protein vs. UniProt/SwissProt
Match: sp|O77210|IF4E_APLCA (Eukaryotic translation initiation factor 4E OS=Aplysia californica OX=6500 PE=1 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.869e-67
Identity = 98/181 (54.14%), Postives = 124/181 (68.51%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLT--CAIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN W  +FFKND+S+DW DN++ +  FDTVEDFWGL NH  P SKL SGCDY VFK  IQPMWED +NK GG WL+   K QR +HLD  WLE L+ L+GE F++ S+EICGA VNIR KGD++ +WT D    EA K+IG K+K++L +     I + AH+D   K+ S  K  F +
Sbjct:   35 HPLQNSWAMWFFKNDKSRDWKDNLRVITTFDTVEDFWGLYNHTLPASKLQSGCDYSVFKAGIQPMWEDAQNKKGGRWLINLNKTQRQTHLDDFWLETLLCLIGEGFDEHSEEICGATVNIRNKGDKLGLWTRDAQKTEATKKIGIKLKESLSVPPKIVIGFQAHSDTAGKAGSTVKNRFTV 215          
BLAST of eIF4E1-like protein vs. UniProt/SwissProt
Match: sp|A6NMX2|I4E1B_HUMAN (Eukaryotic translation initiation factor 4E type 1B OS=Homo sapiens OX=9606 GN=EIF4E1B PE=1 SV=3)

HSP 1 Score: 209.92 bits (533), Expect = 3.857e-66
Identity = 99/183 (54.10%), Postives = 124/183 (67.76%), Query Frame = 3
Query:  114 ELHYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLT--CAIEYTAHTDAQNKSSSRAKCTFRI 656
            ELH LQN+W  +FFKNDRS+ W DN+  V   DTVEDFW L +HI   SKL SGCDY +FKD IQPMWED RNK GG WL++  K QR   LD  WLE L+ L+GE+FE+ S E+CGAVVNIR KGD+++VWT +  +   +  +G+  K+ LGL+    I Y AH D   KS+S AK  F +
Sbjct:   60 ELHPLQNRWALWFFKNDRSRAWQDNLHLVTKVDTVEDFWALYSHIQLASKLSSGCDYALFKDGIQPMWEDSRNKRGGRWLVSLAKQQRHIELDRLWLETLLCLIGESFEEHSREVCGAVVNIRTKGDKIAVWTREAENQAGVLHVGRVYKERLGLSPKTIIGYQAHADTATKSNSLAKNKFVV 242          
BLAST of eIF4E1-like protein vs. UniProt/SwissProt
Match: sp|P06730|IF4E_HUMAN (Eukaryotic translation initiation factor 4E OS=Homo sapiens OX=9606 GN=EIF4E PE=1 SV=2)

HSP 1 Score: 207.608 bits (527), Expect = 1.224e-65
Identity = 96/181 (53.04%), Postives = 125/181 (69.06%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLT--CAIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W  +FFKND+SK W  N++ +  FDTVEDFW L NHI   S L  GCDY +FKD I+PMWED++NK GG WL+T  K QR S LD  WLE L+ L+GE+F+D SD++CGAVVN+R KGD++++WTT+C + EA+  IG+  K+ LGL     I Y +H D   KS S  K  F +
Sbjct:   37 HPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV 217          
BLAST of eIF4E1-like protein vs. UniProt/SwissProt
Match: sp|Q9N0T5|IF4E_BOVIN (Eukaryotic translation initiation factor 4E OS=Bos taurus OX=9913 GN=EIF4E PE=2 SV=2)

HSP 1 Score: 206.453 bits (524), Expect = 3.587e-65
Identity = 95/181 (52.49%), Postives = 125/181 (69.06%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLT--CAIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W  +FFKND+SK W  N++ +  FDTVEDFW L NHI   S L  GCDY +FKD I+PMWED++NK GG WL+T  K QR S LD  WLE ++ L+GE+F+D SD++CGAVVN+R KGD++++WTT+C + EA+  IG+  K+ LGL     I Y +H D   KS S  K  F +
Sbjct:   37 HPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETVLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV 217          
BLAST of eIF4E1-like protein vs. UniProt/SwissProt
Match: sp|P63074|IF4E_RAT (Eukaryotic translation initiation factor 4E OS=Rattus norvegicus OX=10116 GN=Eif4e PE=1 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 5.539e-65
Identity = 95/181 (52.49%), Postives = 125/181 (69.06%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLT--CAIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W  +FFKND+SK W  N++ +  FDTVEDFW L NHI   S L  GCDY +FKD I+PMWED++NK GG WL+T  K QR S LD  WLE L+ L+GE+F+D SD++CGAVVN+R KGD++++WTT+C + +A+  IG+  K+ LGL     I Y +H D   KS S  K  F +
Sbjct:   37 HPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDLDRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENRDAVTHIGRVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV 217          
BLAST of eIF4E1-like protein vs. TrEMBL
Match: D2DJT8 (eIF4E1-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 5.322e-111
Identity = 156/156 (100.00%), Postives = 156/156 (100.00%), Query Frame = 3
Query:  189 MKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCAIEYTAHTDAQNKSSSRAKCTFRI 656
            MKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCAIEYTAHTDAQNKSSSRAKCTFRI
Sbjct:    1 MKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCAIEYTAHTDAQNKSSSRAKCTFRI 156          
BLAST of eIF4E1-like protein vs. TrEMBL
Match: D5JG41 (Eukaryotic initiation factor-4E (Fragment) OS=Dugesia japonica OX=6161 GN=eIF4E PE=2 SV=1)

HSP 1 Score: 308.145 bits (788), Expect = 8.445e-103
Identity = 157/208 (75.48%), Postives = 181/208 (87.02%), Query Frame = 3
Query:   18 EMVDETSLGXXXXXXXXXXXXXXXXXXXAGDSELHYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCAIEYTAHTDAQNKSSSRAK 641
            EMV++ SL +L NLKLE +DN EN  +LA D++LHYL+NKW FYFFK DRSKDWIDNMKKVIDFDTVE FWGL+N+IAPPSKLP+GCDYY+FKDVIQPMWED+RNKNGGM +L F+K + IS+LD CWLEILMLLVGETFEDDS+EICGAV N RGKGDR+SVW T+CSS E IKRIG KIKDALGL C++EY AH DA+  S+SRAK
Sbjct:    1 EMVEKASLVDLVNLKLEGDDNFENNNTLAPDTDLHYLENKWAFYFFKYDRSKDWIDNMKKVIDFDTVEGFWGLVNYIAPPSKLPNGCDYYIFKDVIQPMWEDERNKNGGMCILPFDKRENISYLDSCWLEILMLLVGETFEDDSEEICGAVFNKRGKGDRISVWXTNCSSTEPIKRIGNKIKDALGLRCSVEYVAHADAKKMSNSRAK 208          
BLAST of eIF4E1-like protein vs. TrEMBL
Match: A0A1W6I191 (Translation initiation factor 4E-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 1.155e-93
Identity = 156/159 (98.11%), Postives = 156/159 (98.11%), Query Frame = 3
Query:   21 MVDETSLGXXXXXXXXXXXXXXXXXXXAGDSELHYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDR 497
            MVDETSLGNLSNLKLEDEDNEENLKSLAGDSELHYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDS EICGAV  IRGKGDR
Sbjct:    1 MVDETSLGNLSNLKLEDEDNEENLKSLAGDSELHYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSXEICGAVAXIRGKGDR 159          
BLAST of eIF4E1-like protein vs. TrEMBL
Match: K1PGU1 (Eukaryotic translation initiation factor 4E OS=Crassostrea gigas OX=29159 GN=CGI_10000487 PE=3 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 1.080e-67
Identity = 98/181 (54.14%), Postives = 133/181 (73.48%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCAIE--YTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W  +FFKNDR+K+W  N+K +  FDTVEDFW L NH+   SKLPSGCDY +FKD +QPMWED+RNK+GG WL+   KNQR++ LD  WLE L+ L+GE+FE+ S++ICGAVVNIR KGD++S+WT +    +AI +IG+K+K+ L +   I+  + +H D   K+ S AK  FR+
Sbjct:    9 HPLQNRWALWFFKNDRNKEWTANLKLITAFDTVEDFWALYNHVQKASKLPSGCDYSLFKDGVQPMWEDERNKDGGRWLINLNKNQRMTDLDNFWLETLLCLIGESFEEYSEDICGAVVNIRNKGDKLSLWTKEAGRPDAILKIGRKLKERLSIPAKIQIGFQSHRDTMTKTGSTAKDRFRV 189          
BLAST of eIF4E1-like protein vs. TrEMBL
Match: A0A210PSB7 (Eukaryotic translation initiation factor 4E OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT05288 PE=3 SV=1)

HSP 1 Score: 218.779 bits (556), Expect = 1.664e-67
Identity = 102/181 (56.35%), Postives = 132/181 (72.93%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLT--CAIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQNKW  +FFKNDR+K+W  N+K V  FDTVEDFW L NH+   SKLPSGCDY +FKD IQPMWED +NK+GG WL+   K QR S LD  WLE L+ L+GE+FE+ SD++ GAVVN+R KGD++S+WT D +  +AI +IG+K+KD+L +    AI + AHTD   K+ S A+  FR+
Sbjct:   36 HPLQNKWALWFFKNDRTKEWTANLKLVTSFDTVEDFWALYNHVQKASKLPSGCDYSLFKDGIQPMWEDAQNKDGGRWLINLNKQQRHSDLDNFWLETLLCLIGESFEEFSDDVNGAVVNVRNKGDKLSLWTRDATRPDAIMKIGKKLKDSLKIPIKIAIGFQAHTDTMTKTGSTARDRFRV 216          
BLAST of eIF4E1-like protein vs. Ensembl Cavefish
Match: eif4ea (eukaryotic translation initiation factor 4E-1A [Source:NCBI gene;Acc:103043705])

HSP 1 Score: 204.527 bits (519), Expect = 1.943e-65
Identity = 99/181 (54.70%), Postives = 123/181 (67.96%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGL--TCAIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W  +FFKND+SK W  N++ +  FDTVEDFW L NHI   S L SGCDY +FKD I+PMWED+RNK GG WL+T  K QR + LD  WLE L+ LVGE F+D SD++CGAVVNIR KGD++S+WTTD  + +AI  IG+  K  LG+     I Y +H D   KS S  K  F +
Sbjct:   38 HPLQNRWALWFFKNDKSKTWQANLQLISKFDTVEDFWALYNHIQLSSNLISGCDYSLFKDGIEPMWEDERNKKGGRWLITLSKQQRRADLDRFWLETLLCLVGEAFDDHSDDVCGAVVNIRTKGDKISIWTTDYENKDAIVHIGRVYKARLGVPPKVIIGYQSHADTATKSGSTTKNKFVV 218          
BLAST of eIF4E1-like protein vs. Ensembl Cavefish
Match: eif4e1c (eukaryotic translation initiation factor 4E-like [Source:NCBI gene;Acc:103032634])

HSP 1 Score: 202.601 bits (514), Expect = 1.100e-64
Identity = 92/181 (50.83%), Postives = 127/181 (70.17%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCA--IEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W  ++FKND+SK W +N++ +  FDTVEDFW L NHI  PSKL  GCDY +FKD I+PMWEDDRNK GG WL+T  K QR + LD  W+E L+ L+GE+F++ S+++CGAVVN+R KGD++++WT +C + +AI  IG + K+ L L     I Y +H D  +KS S  K  + +
Sbjct:   30 HPLQNRWALWYFKNDKSKSWTENLRLISKFDTVEDFWALYNHIQQPSKLGFGCDYCLFKDGIKPMWEDDRNKLGGRWLMTLSKQQRHNDLDRYWMETLLCLIGESFDEASEDVCGAVVNVRPKGDKIAIWTGNCQNRDAIMTIGLQYKERLNLPIKTLIGYQSHDDTSSKSGSTTKNMYSV 210          
BLAST of eIF4E1-like protein vs. Ensembl Cavefish
Match: eif4eb (eukaryotic translation initiation factor 4E-1A [Source:NCBI gene;Acc:103043156])

HSP 1 Score: 201.83 bits (512), Expect = 3.809e-64
Identity = 96/181 (53.04%), Postives = 123/181 (67.96%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALG--LTCAIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W+ +FFKND+SK W  N++ +  FDTVEDFW L NHI   S L SGCDY +FKD I+PMWED+RNK GG WL+T  K QR   LD  WLE L+ L+GE F+D SD++CGAVVN+R KGD+++VWTTD  + + I  IG+  K+ LG  +   I Y +H D   KS S  K  F +
Sbjct:   47 HPLQNRWSLWFFKNDKSKTWQANLRLISKFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDERNKKGGRWLITLNKQQRKLDLDRFWLETLLCLIGEAFDDYSDDVCGAVVNVRTKGDKIAVWTTDYENRDGITHIGRVYKERLGIPMKMTIGYQSHADTATKSGSTTKNKFVV 227          
BLAST of eIF4E1-like protein vs. Ensembl Cavefish
Match: eif4e1b (eukaryotic translation initiation factor 4E family member 1B [Source:NCBI gene;Acc:30738])

HSP 1 Score: 143.28 bits (360), Expect = 9.958e-42
Identity = 78/181 (43.09%), Postives = 107/181 (59.12%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLT--CAIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W  +F+KND+SK W DN++ +  FDT EDFW L N+I   SKL SGCDY VFK  + P     R      +LL             C L+ L+ ++GE F   S ++CG+V+N+R KGD+++VWTT+  +AEA+  IG+K K+ LGL     I Y AH D   KS+S  K  F +
Sbjct:   35 HPLQNRWALWFYKNDKSKMWQDNLRLITKFDTAEDFWALYNNIQAASKLSSGCDYSVFK--VNP-----RVYKACFFLL-------------CILQ-LLCMIGEGFGSYSRDVCGSVINVRAKGDKIAVWTTNTENAEAVTHIGRKYKEILGLPSKLVIGYQAHADTATKSNSITKNKFVV 194          
BLAST of eIF4E1-like protein vs. Ensembl Cavefish
Match: eif4e2 (eukaryotic translation initiation factor 4E family member 2 [Source:NCBI gene;Acc:103021705])

HSP 1 Score: 110.153 bits (274), Expect = 1.219e-28
Identity = 57/172 (33.14%), Postives = 93/172 (54.07%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKND-----RSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGL--TCAIEYTAHTDA 614
            H LQ  +TF++ +        ++ +  N+K++  F +VE FW   +H+  P  L    D+++FK+ I+PMWEDD NK+GG W++   K         CW  +++ ++GE F    +EICGAVV++R + D +S+W    S      RI   ++  L L     +EY  HTD+
Sbjct:   53 HPLQYNYTFWYSRRTPGRPASTQSYEQNIKQIGSFASVEQFWRFYSHMIRPGDLTGHSDFHLFKEGIKPMWEDDANKSGGKWIIRLRKGL----ASRCWENLILAMLGEQFM-VGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDS 219          
BLAST of eIF4E1-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001509.1 (pep scaffold:Pmarinus_7.0:GL501028:982:8648:-1 gene:ENSPMAG00000001359.1 transcript:ENSPMAT00000001509.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 184.111 bits (466), Expect = 2.942e-58
Identity = 81/144 (56.25%), Postives = 105/144 (72.92%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIG 551
            H LQN+W  +F+KND+SK W  N++ +   DTVEDFW L NHI   S+L  GCDY +FKD I+PMWED+RNK GG WL+T  K QR S LD  WLE L+ L+GE F+D SD++CGAVVN+R K D+++VWT DC + E++  IG
Sbjct:   56 HPLQNRWALWFYKNDKSKSWQANLRLITKVDTVEDFWALYNHIQVASRLMPGCDYSLFKDGIEPMWEDERNKRGGRWLITLTKTQRHSDLDRYWLETLLCLIGEAFDDHSDDVCGAVVNVRPKADKIAVWTADCDNRESVVGIG 199          
BLAST of eIF4E1-like protein vs. Ensembl Sea Lamprey
Match: eif4e2 (eukaryotic translation initiation factor 4E family member 2 [Source:ZFIN;Acc:ZDB-GENE-050327-59])

HSP 1 Score: 107.842 bits (268), Expect = 1.419e-28
Identity = 58/172 (33.72%), Postives = 92/172 (53.49%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSK-----DWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGL--TCAIEYTAHTDA 614
            H LQ  ++ +F +    +     ++  N+K +  F +VE FW   +HI  PS L    D+++FK+ I+PMWEDD NK+GG W++   K         CW  +++ ++GE F    +EICGAVV++R + D +S+W    S      RI   ++  L L     +EY  HTD+
Sbjct:   45 HPLQYNYSLWFSRRTPGRQASKQNYEQNIKHIGTFASVEMFWRFYSHIVRPSDLTGHSDFHLFKEGIKPMWEDDANKSGGKWIVRLRKGL----ASRCWENLILAMLGEQFM-VGEEICGAVVSLRFQEDIISIWNKTASDQGTTSRIRDTLRRVLNLPPNTIMEYKTHTDS 211          
BLAST of eIF4E1-like protein vs. Ensembl Yeast
Match: CDC33 (mRNA cap binding protein and translation initiation factor eIF4E; the eIF4E-cap complex is responsible for mediating cap-dependent mRNA translation via interactions with translation initiation factor eIF4G (Tif4631p or Tif4632p); protein abundance increases in response to DNA replication stress; mutants are defective for adhesion and pseudohyphal growth; human homolog EIF4E can complement yeast cdc33 null mutant [Source:SGD;Acc:S000005499])

HSP 1 Score: 124.79 bits (312), Expect = 2.342e-35
Identity = 62/172 (36.05%), Postives = 101/172 (58.72%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKN--DRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLT--CAIEYTAHTDAQNK 623
            H L  KWT ++ K   D+S+ W D ++ V  F TVE+FW ++ +I  P +LP   DY+VF++ ++P WED+ N  GG W  +F+   + + +D  WL  L+ ++GET ++D  +I G V++IR  G++ ++WT      E + RIG K K  L LT    +E+  H+ A  +
Sbjct:   37 HPLNTKWTLWYTKPAVDKSESWSDLLRPVTSFQTVEEFWAIIQNIPEPHELPLKSDYHVFRNDVRPEWEDEANAKGGKW--SFQLRGKGADIDELWLRTLLAVIGETIDEDDSQINGVVLSIRKGGNKFALWTK-SEDKEPLLRIGGKFKQVLKLTDDGHLEFFPHSSANGR 205          
BLAST of eIF4E1-like protein vs. Ensembl Nematostella
Match: EDO49832 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REQ6])

HSP 1 Score: 204.527 bits (519), Expect = 2.779e-66
Identity = 95/181 (52.49%), Postives = 121/181 (66.85%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCA--IEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W  +FFKND+SK W  N++ +  FDTVEDFWG+ NHI   S+L  GCDY +FKD I+PMWED RNK+GG WL+   KNQR S LD  WLE L+ L+GE F + S+ +CGAVV IR KGD+++VWT + +  E  +RIGQ  K+ LGL     I Y AH D   K+ S  K  F +
Sbjct:    3 HPLQNRWVLWFFKNDKSKSWAANLRNITSFDTVEDFWGIYNHIQQASRLQPGCDYSLFKDGIEPMWEDKRNKDGGRWLINTNKNQRQSDLDRFWLETLLCLIGEAFGEYSEGVCGAVVQIRNKGDKIAVWTGNATDEEGTRRIGQVFKERLGLPPKMFIGYQAHQDTMTKTGSTTKSLFSV 183          
BLAST of eIF4E1-like protein vs. Ensembl Nematostella
Match: EDO26680 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBC7])

HSP 1 Score: 117.857 bits (294), Expect = 2.045e-33
Identity = 58/117 (49.57%), Postives = 74/117 (63.25%), Query Frame = 3
Query:  312 MWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCA--IEYTAHTDAQNKSSSRAKCTFRI 656
            MWED RNK+GG WL+   KNQR S LD  WLE L+ L+GE F + S+ +CGAVV IR KGD+++VWT + +  E  +RIGQ  K+ LGL     I Y AH D   K+ S  K  F +
Sbjct:    1 MWEDKRNKDGGRWLINTNKNQRQSDLDRFWLETLLCLIGEAFGEYSEGVCGAVVQIRNKGDKIAVWTGNATDEEGTRRIGQVFKERLGLPPKMFIGYQAHQDTMTKTGSTTKSLFSV 117          
BLAST of eIF4E1-like protein vs. Ensembl Nematostella
Match: EDO43460 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYG8])

HSP 1 Score: 109.383 bits (272), Expect = 1.440e-28
Identity = 61/178 (34.27%), Postives = 95/178 (53.37%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSK-----DWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGL--TCAIEYTAHTDAQNKSSS 632
            H LQ  + F+F +    K     ++ DN+K V  F +VE FWG  + +  P +L    D ++FKD I+PMWED+ NK GG W++   K         CW  +++ ++GE F   S E+CGAV+++R + D +S+W  + +      RI   +K  L L     +EY AH D+   +SS
Sbjct:   68 HPLQCPYVFWFSRRPPGKIQSATNYADNIKIVGKFASVEQFWGFYSFMVRPGELTGHSDIHLFKDGIKPMWEDEANKCGGKWIVRLRK----GLASRCWENLVLAMLGEQFMVGS-EVCGAVISVRFQEDIISIWNRNAADQATTTRIRDTLKRVLNLPPNTIMEYKAHQDSIKDNSS 240          
BLAST of eIF4E1-like protein vs. Ensembl Nematostella
Match: EDO39481 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SA12])

HSP 1 Score: 73.559 bits (179), Expect = 1.646e-16
Identity = 34/107 (31.78%), Postives = 58/107 (54.21%), Query Frame = 3
Query:  126 LQNKWTFY---FFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETF 437
            L + WT +   + +   + ++  N++K+ +F TV+ FW + N+I   S+L S   Y+  + V +P+WED  N NGG W +   K+      D  W E+L+  +GE F
Sbjct:   19 LNSSWTLWHDRYIRGATAAEYAANLRKIYNFHTVQSFWSVFNNIPKASELGSRASYHCMRGVRRPIWEDAENANGGYWKMRCPKDM----TDKVWKELLLAAIGEQF 121          
BLAST of eIF4E1-like protein vs. Ensembl Medaka
Match: eif4ea (eukaryotic translation initiation factor 4E-1A [Source:NCBI gene;Acc:100049330])

HSP 1 Score: 212.616 bits (540), Expect = 6.787e-68
Identity = 99/179 (55.31%), Postives = 126/179 (70.39%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGL--TCAIEYTAHTDAQNKSSSRAKCTF 650
            H LQN+WT +FFKND+SK W  N++ +  FDTVEDFW L NHI   S L SGCDY +FKD I+PMWED+RN+ GG WL+T  K QR   LD  WLE L+ LVGE F+D SD++CGAV+NIR KGD++++WTT+C + EAI +IG+  K+ LG+     I Y +H D   KSSS  K  F
Sbjct:   85 HPLQNRWTLWFFKNDKSKTWQANLRLISTFDTVEDFWALYNHIQLSSNLMSGCDYSLFKDGIEPMWEDERNRRGGRWLITLSKQQRKMDLDRFWLETLLCLVGEAFDDHSDDVCGAVINIRAKGDKIAIWTTNCENKEAITQIGRVYKERLGVPPKVIIGYQSHADTATKSSSTTKNKF 263          
BLAST of eIF4E1-like protein vs. Ensembl Medaka
Match: eif4eb (eukaryotic translation initiation factor 4E [Source:NCBI gene;Acc:101166761])

HSP 1 Score: 203.371 bits (516), Expect = 5.428e-65
Identity = 96/181 (53.04%), Postives = 124/181 (68.51%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGL--TCAIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W+ +F+KND+SK W  N++ +  FDTVEDFW L NHI   S L SGCDY +FKD I+PMWED+RNK GG WL+T  K  R S LD  WLE L+ LVGE F+D SD++CGAVVN+R KGD+++VWT++  + EA+  IG+  K+ LGL     I Y +H D   KS S  K  F +
Sbjct:   36 HPLQNRWSLWFYKNDKSKTWQANLRLISKFDTVEDFWALYNHIQVSSNLISGCDYSLFKDGIEPMWEDERNKRGGRWLITLNKQLRRSDLDRFWLETLLCLVGEAFDDYSDDVCGAVVNVRNKGDKIAVWTSNYENREAVTHIGRVYKERLGLPMNMTIGYQSHADTATKSGSTTKNKFVV 216          
BLAST of eIF4E1-like protein vs. Ensembl Medaka
Match: eif4e1c (eukaryotic translation initiation factor 4E [Source:NCBI gene;Acc:101169085])

HSP 1 Score: 202.601 bits (514), Expect = 1.142e-64
Identity = 95/181 (52.49%), Postives = 127/181 (70.17%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGL--TCAIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W  ++FKND++K W +N++ +  FDTVEDFW L NHI  PSKL  GCDY +FKD I+PMWEDD+NK GG WL+T  K Q+ + LD  W+E L+ LVGE+F+D S+E+CGAVVN+R KGD++S+WT +C + EAI  IGQ  K+ L L     I Y +H D  +KS S  K  + +
Sbjct:   31 HPLQNRWALWYFKNDKTKSWTENLRLISKFDTVEDFWALYNHIQQPSKLVLGCDYCLFKDGIKPMWEDDKNKLGGRWLMTLNK-QKHNDLDRYWMETLLCLVGESFDDASEEVCGAVVNVRHKGDKISIWTGNCQNKEAIMTIGQLYKERLNLPMKAIIGYQSHDDTSSKSGSTTKNMYSV 210          
BLAST of eIF4E1-like protein vs. Ensembl Medaka
Match: eif4e1c (eukaryotic translation initiation factor 4E [Source:NCBI gene;Acc:101169085])

HSP 1 Score: 202.216 bits (513), Expect = 1.998e-64
Identity = 95/181 (52.49%), Postives = 127/181 (70.17%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGL--TCAIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W  ++FKND++K W +N++ +  FDTVEDFW L NHI  PSKL  GCDY +FKD I+PMWEDD+NK GG WL+T  K Q+ + LD  W+E L+ LVGE+F+D S+E+CGAVVN+R KGD++S+WT +C + EAI  IGQ  K+ L L     I Y +H D  +KS S  K  + +
Sbjct:   37 HPLQNRWALWYFKNDKTKSWTENLRLISKFDTVEDFWALYNHIQQPSKLVLGCDYCLFKDGIKPMWEDDKNKLGGRWLMTLNK-QKHNDLDRYWMETLLCLVGESFDDASEEVCGAVVNVRHKGDKISIWTGNCQNKEAIMTIGQLYKERLNLPMKAIIGYQSHDDTSSKSGSTTKNMYSV 216          
BLAST of eIF4E1-like protein vs. Ensembl Medaka
Match: eif4eb (eukaryotic translation initiation factor 4E [Source:NCBI gene;Acc:101166761])

HSP 1 Score: 202.986 bits (515), Expect = 2.347e-64
Identity = 96/181 (53.04%), Postives = 124/181 (68.51%), Query Frame = 3
Query:  120 HYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGL--TCAIEYTAHTDAQNKSSSRAKCTFRI 656
            H LQN+W+ +F+KND+SK W  N++ +  FDTVEDFW L NHI   S L SGCDY +FKD I+PMWED+RNK GG WL+T  K  R S LD  WLE L+ LVGE F+D SD++CGAVVN+R KGD+++VWT++  + EA+  IG+  K+ LGL     I Y +H D   KS S  K  F +
Sbjct:   63 HPLQNRWSLWFYKNDKSKTWQANLRLISKFDTVEDFWALYNHIQVSSNLISGCDYSLFKDGIEPMWEDERNKRGGRWLITLNKQLRRSDLDRFWLETLLCLVGEAFDDYSDDVCGAVVNVRNKGDKIAVWTSNYENREAVTHIGRVYKERLGLPMNMTIGYQSHADTATKSGSTTKNKFVV 243          
BLAST of eIF4E1-like protein vs. Planmine SMEST
Match: SMESG000031703.1 (SMESG000031703.1)

HSP 1 Score: 399.438 bits (1025), Expect = 2.143e-142
Identity = 212/212 (100.00%), Postives = 212/212 (100.00%), Query Frame = 3
Query:   21 MVDETSLGXXXXXXXXXXXXXXXXXXXAGDSELHYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCAIEYTAHTDAQNKSSSRAKCTFRI 656
            MVDETSLGNLSNLKLEDEDNEENLKSLAGDSELHYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCAIEYTAHTDAQNKSSSRAKCTFRI
Sbjct:    1 MVDETSLGNLSNLKLEDEDNEENLKSLAGDSELHYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCAIEYTAHTDAQNKSSSRAKCTFRI 212          
BLAST of eIF4E1-like protein vs. Planmine SMEST
Match: SMESG000062612.1 (SMESG000062612.1)

HSP 1 Score: 205.682 bits (522), Expect = 3.062e-66
Identity = 87/177 (49.15%), Postives = 127/177 (71.75%), Query Frame = 3
Query:  126 LQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCAIEYTAHTDAQNKSSSRAKCTFRI 656
            L ++W FY+FK D+ K WI+NM K++  D++E FWG+M+H+ P S L  G D+Y F+  I+PMWED  N+NGG W+++  K++R + LD  W+E+LM L+GET ++DSD ICGA +NIRG  D+++VWT+D S+ EA +RIG K+K  L L   IEY +H + QNK++S AK T  +
Sbjct:   18 LADQWNFYYFKLDKKKQWIENMNKILTIDSIESFWGIMHHLKPISTLNFGSDFYFFRSHIRPMWEDTSNQNGGTWIISSHKSKRHTELDILWMELLMFLIGETMDEDSDLICGAAINIRGTNDKITVWTSDSSNLEANRRIGMKLKSILNLHDTIEYISHINNQNKNNSSAKVTLTV 194          
BLAST of eIF4E1-like protein vs. Planmine SMEST
Match: SMESG000046515.1 (SMESG000046515.1)

HSP 1 Score: 191.045 bits (484), Expect = 1.439e-60
Identity = 82/180 (45.56%), Postives = 122/180 (67.78%), Query Frame = 3
Query:  117 LHYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCAIEYTAHTDAQNKSSSRAKCTFRI 656
            ++ L ++W  Y+FK D+ K WIDNMK +   D+VE FWG++ H+ P S +  GCDYY F+  I PMWE++ N+NGG W+++  K++R S L+  W E+LM L+GET  +DS EICGA +NIRG  D+++VWT + ++ E  KRIG ++K  L LT  IEY +H++ Q K++   K T  +
Sbjct:   11 INKLADEWKIYYFKMDKEKRWIDNMKTIFTVDSVESFWGILRHLKPVSDMSYGCDYYFFRKHIAPMWENEFNQNGGTWVISSHKSKRHSELNSMWTEVLMFLIGETTNEDSSEICGAAINIRGNYDKITVWTANSANDETNKRIGLQLKSLLNLTTTIEYISHSENQKKNNCAPKPTLIV 190          
BLAST of eIF4E1-like protein vs. Planmine SMEST
Match: SMESG000074929.1 (SMESG000074929.1)

HSP 1 Score: 162.155 bits (409), Expect = 1.341e-48
Identity = 73/169 (43.20%), Postives = 109/169 (64.50%), Query Frame = 3
Query:  108 DSELHYLQNKWTFYFFKNDRSKDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCAIEYTAHTDA 614
            ++  +YLQN+W+ +F K D S+DW +++  +  F+TVEDFW L++HI PP  LP+GCDYY+F+  I+PMWE + N+ GG W +TF+ + R   L+  W  + MLLVGE    DS+ +CG VVN+R   DR+ +W ++    + I RIG+ IK  L +   IE+  H D 
Sbjct:   59 ETAFNYLQNEWSLWFCKRDSSRDWTESLHLIEHFNTVEDFWRLIDHITPPFALPTGCDYYLFRRDIKPMWEHNTNRCGGSWQVTFKNSTRSLLLNRFWENLTMLLVGEGCGSDSEIVCGGVVNVRKMTDRLCLWVSNYEDKQQIMRIGRHIKRILEIDFPIEFYPHIDV 227          
BLAST of eIF4E1-like protein vs. Planmine SMEST
Match: SMESG000046520.1 (SMESG000046520.1)

HSP 1 Score: 149.828 bits (377), Expect = 3.122e-45
Identity = 63/137 (45.99%), Postives = 94/137 (68.61%), Query Frame = 3
Query:  189 MKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWEDDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAVVNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCAIEYT 599
            MK +   D+VE FWG+++H+ P S +  GCDYY F+  I PMWE++ N+NGG W+++  K++R S L+  W E+LM L+GET  +DS EICGA +NIRG  D+++VWT + ++ E  KRIG ++K  L LT    ++
Sbjct:    1 MKPMFTVDSVESFWGILSHLKPVSDMSYGCDYYFFRKHIAPMWENEFNQNGGTWVISSHKSKRHSELNSMWTEVLMFLIGETTNEDSSEICGAAINIRGNYDKITVWTANSANDETNKRIGLQLKSLLNLTTTTYFS 137          
The following BLAST results are available for this feature:
BLAST of eIF4E1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EIF4E1B8.031e-6754.10eukaryotic translation initiation factor 4E family... [more]
EIF4E1B8.031e-6754.10eukaryotic translation initiation factor 4E family... [more]
EIF4E1B8.031e-6754.10eukaryotic translation initiation factor 4E family... [more]
EIF4E2.548e-6653.04eukaryotic translation initiation factor 4E [Sourc... [more]
EIF4E3.693e-6653.04eukaryotic translation initiation factor 4E [Sourc... [more]
back to top
BLAST of eIF4E1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ife-32.082e-5348.86Eukaryotic translation initiation factor 4E-3 [So... [more]
ife-32.082e-5348.86Eukaryotic translation initiation factor 4E-3 [So... [more]
ife-31.831e-5148.31Eukaryotic translation initiation factor 4E-3 [So... [more]
ife-31.831e-5148.31Eukaryotic translation initiation factor 4E-3 [So... [more]
ife-32.415e-5148.04Eukaryotic translation initiation factor 4E-3 [So... [more]
back to top
BLAST of eIF4E1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eIF4E19.876e-5747.51gene:FBgn0015218 transcript:FBtr0076488[more]
eIF4E11.642e-5647.51gene:FBgn0015218 transcript:FBtr0076493[more]
eIF4E11.642e-5647.51gene:FBgn0015218 transcript:FBtr0076489[more]
eIF4E11.642e-5647.51gene:FBgn0015218 transcript:FBtr0076490[more]
eIF4E11.642e-5647.51gene:FBgn0015218 transcript:FBtr0076487[more]
back to top
BLAST of eIF4E1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4e1c6.603e-6651.38eukaryotic translation initiation factor 4E family... [more]
eif4e1c8.527e-6651.38eukaryotic translation initiation factor 4E family... [more]
eif4e1c8.527e-6651.38eukaryotic translation initiation factor 4E family... [more]
eif4ea1.185e-6554.14eukaryotic translation initiation factor 4ea [Sour... [more]
eif4ea1.279e-6554.14eukaryotic translation initiation factor 4ea [Sour... [more]
back to top
BLAST of eIF4E1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000049404.19.077e-6551.93eukaryotic translation initiation factor 4E family... [more]
snx11.024e-6451.93sorting nexin 1 [Source:Xenbase;Acc:XB-GENE-992259... [more]
ENSXETT00000049401.12.120e-6451.93eukaryotic translation initiation factor 4E family... [more]
snx16.522e-6451.93sorting nexin 1 [Source:Xenbase;Acc:XB-GENE-992259... [more]
txnrd13.009e-3034.30thioredoxin reductase 1 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of eIF4E1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Eif4e7.919e-6652.49eukaryotic translation initiation factor 4E [Sourc... [more]
Eif4e1b2.060e-5951.12eukaryotic translation initiation factor 4E family... [more]
Eif4e1b2.060e-5951.12eukaryotic translation initiation factor 4E family... [more]
Eif4e1b2.191e-5951.12eukaryotic translation initiation factor 4E family... [more]
Eif4e3.825e-5956.55eukaryotic translation initiation factor 4E [Sourc... [more]
back to top
BLAST of eIF4E1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O77210|IF4E_APLCA3.869e-6754.14Eukaryotic translation initiation factor 4E OS=Apl... [more]
sp|A6NMX2|I4E1B_HUMAN3.857e-6654.10Eukaryotic translation initiation factor 4E type 1... [more]
sp|P06730|IF4E_HUMAN1.224e-6553.04Eukaryotic translation initiation factor 4E OS=Hom... [more]
sp|Q9N0T5|IF4E_BOVIN3.587e-6552.49Eukaryotic translation initiation factor 4E OS=Bos... [more]
sp|P63074|IF4E_RAT5.539e-6552.49Eukaryotic translation initiation factor 4E OS=Rat... [more]
back to top
BLAST of eIF4E1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D2DJT85.322e-111100.00eIF4E1-like protein (Fragment) OS=Schmidtea medite... [more]
D5JG418.445e-10375.48Eukaryotic initiation factor-4E (Fragment) OS=Duge... [more]
A0A1W6I1911.155e-9398.11Translation initiation factor 4E-like protein (Fra... [more]
K1PGU11.080e-6754.14Eukaryotic translation initiation factor 4E OS=Cra... [more]
A0A210PSB71.664e-6756.35Eukaryotic translation initiation factor 4E OS=Miz... [more]
back to top
BLAST of eIF4E1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4ea1.943e-6554.70eukaryotic translation initiation factor 4E-1A [So... [more]
eif4e1c1.100e-6450.83eukaryotic translation initiation factor 4E-like [... [more]
eif4eb3.809e-6453.04eukaryotic translation initiation factor 4E-1A [So... [more]
eif4e1b9.958e-4243.09eukaryotic translation initiation factor 4E family... [more]
eif4e21.219e-2833.14eukaryotic translation initiation factor 4E family... [more]
back to top
BLAST of eIF4E1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000001509.12.942e-5856.25pep scaffold:Pmarinus_7.0:GL501028:982:8648:-1 gen... [more]
eif4e21.419e-2833.72eukaryotic translation initiation factor 4E family... [more]
back to top
BLAST of eIF4E1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CDC332.342e-3536.05mRNA cap binding protein and translation initiatio... [more]
back to top
BLAST of eIF4E1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO498322.779e-6652.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO266802.045e-3349.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434601.440e-2834.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO394811.646e-1631.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of eIF4E1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
eif4ea6.787e-6855.31eukaryotic translation initiation factor 4E-1A [So... [more]
eif4eb5.428e-6553.04eukaryotic translation initiation factor 4E [Sourc... [more]
eif4e1c1.142e-6452.49eukaryotic translation initiation factor 4E [Sourc... [more]
eif4e1c1.998e-6452.49eukaryotic translation initiation factor 4E [Sourc... [more]
eif4eb2.347e-6453.04eukaryotic translation initiation factor 4E [Sourc... [more]
back to top
BLAST of eIF4E1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031703.12.143e-142100.00SMESG000031703.1[more]
SMESG000062612.13.062e-6649.15SMESG000062612.1[more]
SMESG000046515.11.439e-6045.56SMESG000046515.1[more]
SMESG000074929.11.341e-4843.20SMESG000074929.1[more]
SMESG000046520.13.122e-4545.99SMESG000046520.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30021622
GenBankACT98275.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021622 ID=SMED30021622|Name=eIF4E1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=858bp
CTATATAAATCTTATATGAAATGGTTGATGAAACATCGTTGGGGAATTTA
TCAAATTTAAAATTAGAAGACGAAGATAATGAGGAAAATTTGAAAAGCTT
AGCAGGTGATTCAGAATTACATTATCTGCAAAATAAGTGGACGTTTTACT
TTTTTAAAAATGATAGAAGTAAGGATTGGATTGATAATATGAAGAAAGTT
ATTGATTTTGACACCGTCGAAGATTTTTGGGGTTTAATGAATCATATAGC
TCCTCCTTCTAAATTGCCATCTGGATGTGATTATTATGTATTTAAAGATG
TAATTCAGCCTATGTGGGAAGACGACAGAAATAAGAATGGAGGTATGTGG
CTGTTAACATTTGAAAAAAATCAGCGCATTTCCCACCTTGATCCTTGTTG
GTTGGAAATTCTTATGCTTTTAGTTGGTGAAACTTTTGAAGATGATTCAG
ATGAAATATGCGGTGCAGTCGTCAATATAAGAGGTAAAGGTGATCGTGTT
AGTGTATGGACCACAGATTGTTCATCTGCAGAAGCTATTAAGCGAATTGG
ACAAAAAATTAAAGACGCTCTTGGTTTAACATGTGCTATAGAATACACAG
CTCATACTGATGCACAGAATAAATCAAGTTCAAGAGCAAAGTGCACTTTT
AGAATATAATTATCAAGTGTGATTAGGTGTAATTTTTGTGTTTCTGTGGT
TAAAATTTCCCTTTATATGAACTGTTGCTTAAATATGAATCCCTGTTTAT
TTTGTTAATAGTTAGTGATTGTTCAGTTTTTAGATTATTTAAATTTAATT
AAAAAGTCAAATCGATATTATCTACTTTGTTAAAAATTAATTCATTTGGT
ATTGGGCG
back to top

protein sequence of SMED30021622-orf-1

>SMED30021622-orf-1 ID=SMED30021622-orf-1|Name=SMED30021622-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=213bp
MVDETSLGNLSNLKLEDEDNEENLKSLAGDSELHYLQNKWTFYFFKNDRS
KDWIDNMKKVIDFDTVEDFWGLMNHIAPPSKLPSGCDYYVFKDVIQPMWE
DDRNKNGGMWLLTFEKNQRISHLDPCWLEILMLLVGETFEDDSDEICGAV
VNIRGKGDRVSVWTTDCSSAEAIKRIGQKIKDALGLTCAIEYTAHTDAQN
KSSSRAKCTFRI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0000231vitelline gland
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR001040TIF_eIF_4E
IPR023398TIF_eIF4e-like
Vocabulary: molecular function
TermDefinition
GO:0003743translation initiation factor activity
GO:0003723RNA binding
Vocabulary: biological process
TermDefinition
GO:0006413translational initiation
GO:0006412translation
GO:0006417regulation of translation
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR023398Translation Initiation factor eIF- 4e-likeGENE3DG3DSA:3.30.760.10coord: 29..213
e-value: 4.4E-71
score: 240.3
IPR023398Translation Initiation factor eIF- 4e-likeSUPERFAMILYSSF55418eIF4e-likecoord: 11..208
IPR001040Translation Initiation factor eIF- 4ePFAMPF01652IF4Ecoord: 37..188
e-value: 7.9E-55
score: 185.0
IPR001040Translation Initiation factor eIF- 4ePANTHERPTHR11960EUKARYOTIC TRANSLATION INITIATION FACTOR 4E RELATEDcoord: 24..211
NoneNo IPR availablePANTHERPTHR11960:SF3EUKARYOTIC TRANSLATION INITIATION FACTOR 4E TYPE 1Bcoord: 24..211