Neuronal acetylcholine receptor subunit alpha-2

Overview
NameNeuronal acetylcholine receptor subunit alpha-2
Smed IDSMED30021617
Length (bp)2544
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neuronal acetylcholine receptor subunit alpha-2 (SMED30021617) t-SNE clustered cells

Violin plots show distribution of expression levels for Neuronal acetylcholine receptor subunit alpha-2 (SMED30021617) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neuronal acetylcholine receptor subunit alpha-2 (SMED30021617) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neuronal acetylcholine receptor subunit alpha-2 (SMED30021617) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021617

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30021617SMESG000040082.1 dd_Smed_v4_8486_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021617SMESG000040082.1 dd_Smed_v4_8486_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30021617SMESG000040082.1 dd_Smed_v4_8486_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30021617SMESG000040082.1 dd_Smed_v4_8486_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30021617SMESG000040082.1 dd_Smed_v4_8486_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30021617SMESG000040082.1 dd_Smed_v4_8486_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30021617SMESG000040082.1 dd_Smed_v6_8486_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30021617SMESG000040082.1 dd_Smed_v4_8486_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Human
Match: CHRNA9 (cholinergic receptor nicotinic alpha 9 subunit [Source:HGNC Symbol;Acc:HGNC:14079])

HSP 1 Score: 211.46 bits (537), Expect = 2.069e-59
Identity = 127/340 (37.35%), Postives = 195/340 (57.35%), Query Frame = 1
Query:  403 LINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV-DLG 1419
            L N+L   Y    RPV             E    +  VT++  LS  QI  +DE +QILT+ +     W D ++ W    YD +  + IP+  +W PDI +YN AD+   E    + +++YDG + W   AI KS+C V + YFPFD Q C L FG WTY+G +++I  ++     D ++++ +VEWE+    A    + Y CC EPYPD++F +L++R S+FY   L++PC L+S L  + F+LPA S  K+ LG+ I +A  +  +++ + +P AS + PLIG YY   M LIT ST L ++ +N HF G   + VP W + + +K+ +R+LFV D+G
Sbjct:   34 LFNDLFEDYSNALRPV-------------EDTDKVLNVTLQITLS--QIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDI--FNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFYIVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMP-ASENVPLIGKYYIATMALITASTALTIMVMNIHFCGAEARPVPHWARVVILKYMSRVLFVYDVG 355          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Human
Match: CHRNA10 (cholinergic receptor nicotinic alpha 10 subunit [Source:HGNC Symbol;Acc:HGNC:13800])

HSP 1 Score: 205.682 bits (522), Expect = 1.377e-57
Identity = 124/336 (36.90%), Postives = 189/336 (56.25%), Query Frame = 1
Query:  403 LINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV 1410
            L  +L   Y    RPV D             +Q++  VT+E  LS  QI+ +DE +Q+LT  +     W D ++RW P+ Y  +  + IP+  +W PDI +YN AD +       + ++++DG V W   AI +S+C V +  FPFD Q C L FG WT+ G +L++        L   ++V NVEW ++   A+   + Y CC EPYPD++F +L++R +A Y   L+LPC L+S L  + F LPA+S  K+ LG+ + +A  +  +LL +S+P A  S PLIG YY   MT++T ST L ++ +N H+ G + + VP W + L + H AR L V
Sbjct:   33 LFRDLFANYTSALRPVADT------------DQTLN-VTLEVTLS--QIIDMDERNQVLTLYLWIRQEWTDAYLRWDPNAYGGLDAIRIPSSLVWRPDIVLYNKADAQPPGSASTNVVLRHDGAVRWDAPAITRSSCRVDVAAFPFDAQHCGLTFGSWTHGGHQLDVRPRGAAASL--ADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYVCNLLLPCVLISLLAPLAFHLPADSGEKVSLGVTVLLALTVFQLLLAESMPPA-ESVPLIGKYYMATMTMVTFSTALTILIMNLHYCGPSVRPVPAWARALLLGHLARGLCV 350          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Human
Match: CHRNA4 (cholinergic receptor nicotinic alpha 4 subunit [Source:HGNC Symbol;Acc:HGNC:1958])

HSP 1 Score: 207.608 bits (527), Expect = 1.151e-56
Identity = 120/350 (34.29%), Postives = 206/350 (58.86%), Query Frame = 1
Query:  382 KSWTEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILK 1431
            ++  E+ L+ +L +GY+K SRPV  N++ V              V V FGLS+ Q++ +DE +Q++T+NV     W DY +RW P  Y+N+T + IP++ +W PDI +YN AD          A + +DG V+W P AI+KS+C + + +FPFD+Q C +KFG WTYD  ++++   +  + +DQ ++  + EW ++     + T +Y CC E YPDI++  +++R   FY   LI+PC L+S LT+++F+LP+E   K+ L +++ ++  + ++L+ + IPS S   PLIG Y    M  +TLS  + +  +N H R      +P W++++ +    R+L +    ++K
Sbjct:   33 RAHAEERLLKKLFSGYNKWSRPVA-NISDV--------------VLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLV--NMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPTWVRRVFLDIVPRLLLMKRPSVVK 365          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Human
Match: CHRNA2 (cholinergic receptor nicotinic alpha 2 subunit [Source:HGNC Symbol;Acc:HGNC:1956])

HSP 1 Score: 200.675 bits (509), Expect = 2.703e-55
Identity = 120/353 (33.99%), Postives = 200/353 (56.66%), Query Frame = 1
Query:  391 TEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILKTPPPVE 1449
            TE  L   L  GY++ +RPV          NT++       V V FGLS+ Q++ +DE +Q++T+NV     W DY +RW P  + NIT + +P++ +W+PDI +YN AD          A +   GTV W P AI+KS+C + + +FPFD+Q CK+KFG WTYD  ++++     +  +D  +Y  + EW ++     + + +Y CC E YPD+++  +++R   FY   LI+PC L+S LT+++F+LP++   K+ L +++ ++  + ++L+ + IPS S   PLIG Y    M  +TLS  + +  +N H R  +   +P W++   +    R L ++     + PPPVE
Sbjct:   36 TEDRLFKHLFRGYNRWARPVP---------NTSD------VVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE--QMEQTVDLKDYWESGEWAIVNATGTYNSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHTMPHWVRGALLGCVPRWLLMN-----RPPPPVE 366          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Human
Match: CHRNA2 (cholinergic receptor nicotinic alpha 2 subunit [Source:HGNC Symbol;Acc:HGNC:1956])

HSP 1 Score: 200.29 bits (508), Expect = 5.773e-55
Identity = 120/353 (33.99%), Postives = 200/353 (56.66%), Query Frame = 1
Query:  391 TEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILKTPPPVE 1449
            TE  L   L  GY++ +RPV          NT++       V V FGLS+ Q++ +DE +Q++T+NV     W DY +RW P  + NIT + +P++ +W+PDI +YN AD          A +   GTV W P AI+KS+C + + +FPFD+Q CK+KFG WTYD  ++++     +  +D  +Y  + EW ++     + + +Y CC E YPD+++  +++R   FY   LI+PC L+S LT+++F+LP++   K+ L +++ ++  + ++L+ + IPS S   PLIG Y    M  +TLS  + +  +N H R  +   +P W++   +    R L ++     + PPPVE
Sbjct:   58 TEDRLFKHLFRGYNRWARPVP---------NTSD------VVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE--QMEQTVDLKDYWESGEWAIVNATGTYNSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHTMPHWVRGALLGCVPRWLLMN-----RPPPPVE 388          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Celegans
Match: acr-21 (pep chromosome:WBcel235:III:6583461:6586549:1 gene:WBGene00000060.1 transcript:F27B3.2d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:acr-21)

HSP 1 Score: 222.631 bits (566), Expect = 7.081e-63
Identity = 124/337 (36.80%), Postives = 193/337 (57.27%), Query Frame = 1
Query:  403 LINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADER-MEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV 1410
            L  +LL  Y+   RP V +  P+                V F  SL QI+ +DE +QILT+N      W DY + W P LY N+T +HIP+  +W PDI +YN AD + M+     D I+ Y G + W   AIF S+CP+ +K++PFDRQ C LK+  W YDG ++++     + +L   NY+ N EW LI  RA+   V Y CC EPYP I  H+ ++R + FY + LILPC L+S + L+ F++P +S  K+ LG+   ++  + ++++ + +P  + + PLIG Y+ + + L+ L T + + TVN H  G +   VP +L+    ++ ++ILFV
Sbjct:    3 LYRDLLYDYNNEVRPSVHSKEPI---------------NVTFVFSLTQIIDVDERNQILTTNSWIRLHWVDYKLVWDPRLYQNVTRIHIPSDKIWKPDIILYNNADAQYMKSVMSTDVIVDYLGNIHWPLSAIFTSSCPLDVKHYPFDRQTCILKYASWAYDGTKIDLLLKSEQGDL--TNYITNTEWSLIGIRAEKNQVIYSCCPEPYPFIDVHVTIERRAMFYVFNLILPCVLISLIALMGFYMPTDSGEKVTLGITSLLSTTVFLMMVAEGMPPTAEALPLIGIYFGVTIMLVALGTAMTVFTVNIHHTGVHGYPVPPFLQIFAFRYLSKILFV 322          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Celegans
Match: acr-21 (pep chromosome:WBcel235:III:6583461:6586549:1 gene:WBGene00000060.1 transcript:F27B3.2c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:acr-21)

HSP 1 Score: 222.631 bits (566), Expect = 1.167e-62
Identity = 124/339 (36.58%), Postives = 194/339 (57.23%), Query Frame = 1
Query:  403 LINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADER-MEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDL 1416
            L  +LL  Y+   RP V +  P+                V F  SL QI+ +DE +QILT+N      W DY + W P LY N+T +HIP+  +W PDI +YN AD + M+     D I+ Y G + W   AIF S+CP+ +K++PFDRQ C LK+  W YDG ++++     + +L   NY+ N EW LI  RA+   V Y CC EPYP I  H+ ++R + FY + LILPC L+S + L+ F++P +S  K+ LG+   ++  + ++++ + +P  + + PLIG Y+ + + L+ L T + + TVN H  G +   VP +L+    ++ ++ILFV +
Sbjct:    3 LYRDLLYDYNNEVRPSVHSKEPI---------------NVTFVFSLTQIIDVDERNQILTTNSWIRLHWVDYKLVWDPRLYQNVTRIHIPSDKIWKPDIILYNNADAQYMKSVMSTDVIVDYLGNIHWPLSAIFTSSCPLDVKHYPFDRQTCILKYASWAYDGTKIDLLLKSEQGDL--TNYITNTEWSLIGIRAEKNQVIYSCCPEPYPFIDVHVTIERRAMFYVFNLILPCVLISLIALMGFYMPTDSGEKVTLGITSLLSTTVFLMMVAEGMPPTAEALPLIGIYFGVTIMLVALGTAMTVFTVNIHHTGVHGYPVPPFLQIFAFRYLSKILFVRI 324          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Celegans
Match: acr-21 (pep chromosome:WBcel235:III:6581927:6586549:1 gene:WBGene00000060.1 transcript:F27B3.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:acr-21)

HSP 1 Score: 223.016 bits (567), Expect = 1.187e-62
Identity = 124/337 (36.80%), Postives = 193/337 (57.27%), Query Frame = 1
Query:  403 LINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADER-MEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV 1410
            L  +LL  Y+   RP V +  P+                V F  SL QI+ +DE +QILT+N      W DY + W P LY N+T +HIP+  +W PDI +YN AD + M+     D I+ Y G + W   AIF S+CP+ +K++PFDRQ C LK+  W YDG ++++     + +L   NY+ N EW LI  RA+   V Y CC EPYP I  H+ ++R + FY + LILPC L+S + L+ F++P +S  K+ LG+   ++  + ++++ + +P  + + PLIG Y+ + + L+ L T + + TVN H  G +   VP +L+    ++ ++ILFV
Sbjct:   34 LYRDLLYDYNNEVRPSVHSKEPI---------------NVTFVFSLTQIIDVDERNQILTTNSWIRLHWVDYKLVWDPRLYQNVTRIHIPSDKIWKPDIILYNNADAQYMKSVMSTDVIVDYLGNIHWPLSAIFTSSCPLDVKHYPFDRQTCILKYASWAYDGTKIDLLLKSEQGDL--TNYITNTEWSLIGIRAEKNQVIYSCCPEPYPFIDVHVTIERRAMFYVFNLILPCVLISLIALMGFYMPTDSGEKVTLGITSLLSTTVFLMMVAEGMPPTAEALPLIGIYFGVTIMLVALGTAMTVFTVNIHHTGVHGYPVPPFLQIFAFRYLSKILFV 353          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Celegans
Match: acr-21 (pep chromosome:WBcel235:III:6581927:6586549:1 gene:WBGene00000060.1 transcript:F27B3.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:acr-21)

HSP 1 Score: 222.631 bits (566), Expect = 2.235e-62
Identity = 124/339 (36.58%), Postives = 194/339 (57.23%), Query Frame = 1
Query:  403 LINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADER-MEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDL 1416
            L  +LL  Y+   RP V +  P+                V F  SL QI+ +DE +QILT+N      W DY + W P LY N+T +HIP+  +W PDI +YN AD + M+     D I+ Y G + W   AIF S+CP+ +K++PFDRQ C LK+  W YDG ++++     + +L   NY+ N EW LI  RA+   V Y CC EPYP I  H+ ++R + FY + LILPC L+S + L+ F++P +S  K+ LG+   ++  + ++++ + +P  + + PLIG Y+ + + L+ L T + + TVN H  G +   VP +L+    ++ ++ILFV +
Sbjct:   34 LYRDLLYDYNNEVRPSVHSKEPI---------------NVTFVFSLTQIIDVDERNQILTTNSWIRLHWVDYKLVWDPRLYQNVTRIHIPSDKIWKPDIILYNNADAQYMKSVMSTDVIVDYLGNIHWPLSAIFTSSCPLDVKHYPFDRQTCILKYASWAYDGTKIDLLLKSEQGDL--TNYITNTEWSLIGIRAEKNQVIYSCCPEPYPFIDVHVTIERRAMFYVFNLILPCVLISLIALMGFYMPTDSGEKVTLGITSLLSTTVFLMMVAEGMPPTAEALPLIGIYFGVTIMLVALGTAMTVFTVNIHHTGVHGYPVPPFLQIFAFRYLSKILFVRI 355          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Celegans
Match: unc-63 (Acetylcholine receptor subunit alpha-type unc-63 [Source:UniProtKB/Swiss-Prot;Acc:Q9N587])

HSP 1 Score: 186.037 bits (471), Expect = 1.428e-50
Identity = 120/360 (33.33%), Postives = 194/360 (53.89%), Query Frame = 1
Query:  403 LINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTE------------------------LDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV 1410
            L  +L+  Y+K  RPV +N                + + V F L L Q++ + E +QI+T+NV   + W DY +RW P  Y  +  +++P+  +WLPD+ +YN AD   +      A + Y+GTVEW P AI+KS C + +++FPFDRQ C++KFG WTY G  +++   D   E                        +D ++Y  +VEW+++    K  + RYPCC  P+ DI++ I ++R + FY   LI P   +S LT ++F+LP++   K+ L ++I I+  +  +LL + IPS S   PLIG Y    M L+TLS  + ++T+N H+R      +P W+K+L +    + L +
Sbjct:   30 LFEDLIADYNKLVRPVSENG---------------ETLVVTFKLKLSQLLDVHEKNQIMTTNVWLQHSWMDYKLRWDPVEYGGVEVLYVPSDTIWLPDVVLYNNADGNYQVTIMTKAKLTYNGTVEWAPPAIYKSMCQIDVEFFPFDRQQCEMKFGSWTYGGLEVDLQHRDKHLEKEIEEDVEGVDGPTKEIVWVVDRGIDLSDYYPSVEWDILNVPGKRHSKRYPCCESPFIDITYEIHLRRKTLFYTVNLIFPSVGISFLTALVFYLPSDGGEKISLCISILISLTVFFLLLVEIIPSTSLVIPLIGKYLLFTMVLVTLSVVVTVVTLNVHYRSPTTHTMPKWMKRLFVDFLPKYLLM 374          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Fly
Match: nAChRalpha2 (gene:FBgn0000039 transcript:FBtr0084639)

HSP 1 Score: 219.935 bits (559), Expect = 9.258e-62
Identity = 127/346 (36.71%), Postives = 204/346 (58.96%), Query Frame = 1
Query:  397 KVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFY------DNKTE--LDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV 1410
            K L ++LL+ Y++  RPV +N                  V V+ GL L Q++ L+  DQILT+NV   + W+D+  +W P  Y  +T +++P++++WLPDI +YN AD          AI+ Y G V W P AIFKS+C + ++YFPFD+Q C +KFG WTYDG ++++         DNK E  +D   Y  +VEW+++   A+     YPCC EPYPDI F+I ++R + FY   LI+PC  +S L++++F+LPA+S  K+ L ++I ++  +  +L+ + IPS S + PL+G Y    M L+ LS  + +I +N H+R  +  ++  W++   IK   ++L +
Sbjct:   46 KRLYDDLLSNYNRLIRPVSNN---------------TDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLM 376          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Fly
Match: nAChRalpha2 (gene:FBgn0000039 transcript:FBtr0084640)

HSP 1 Score: 219.935 bits (559), Expect = 9.258e-62
Identity = 127/346 (36.71%), Postives = 204/346 (58.96%), Query Frame = 1
Query:  397 KVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFY------DNKTE--LDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV 1410
            K L ++LL+ Y++  RPV +N                  V V+ GL L Q++ L+  DQILT+NV   + W+D+  +W P  Y  +T +++P++++WLPDI +YN AD          AI+ Y G V W P AIFKS+C + ++YFPFD+Q C +KFG WTYDG ++++         DNK E  +D   Y  +VEW+++   A+     YPCC EPYPDI F+I ++R + FY   LI+PC  +S L++++F+LPA+S  K+ L ++I ++  +  +L+ + IPS S + PL+G Y    M L+ LS  + +I +N H+R  +  ++  W++   IK   ++L +
Sbjct:   46 KRLYDDLLSNYNRLIRPVSNN---------------TDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLM 376          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Fly
Match: nAChRalpha5 (gene:FBgn0028875 transcript:FBtr0300594)

HSP 1 Score: 209.534 bits (532), Expect = 1.415e-56
Identity = 114/326 (34.97%), Postives = 196/326 (60.12%), Query Frame = 1
Query:  394 EKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLK 1371
            EK L+++LL+ Y+   RPV++   P+                + FGL+L+QI+ +DE +Q+L +NV     W D ++RW    Y  +  + IP   +W PD+ +YN ADE  +   + + +++ +G+  + P  IFKSTC + I +FPFD Q C++KFG WTYDGF+L++   D +T  D ++YV N EWEL+    K   + Y CC EPY DI+F I+++R + +Y + LI+PC L++S+ L+ F LP +S  K+ LG+ I ++  + + ++ +++P+ S + PL+GTY+   M ++  S    ++ +N+H R  +  E+  W++
Sbjct:  313 EKRLLHDLLDPYNTLERPVLNESDPL---------------QLSFGLTLMQIIDVDEKNQLLVTNVWLKLEWNDMNLRWNTSDYGGVKDLRIPPHRIWKPDVLMYNSADEGFDGTYQTNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQD-ETGGDISSYVLNGEWELLGVPGKRNEIYYNCCPEPYIDITFAIIIRRRTLYYFFNLIIPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNADTHEMSEWIR 622          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Fly
Match: nAChRalpha5 (gene:FBgn0028875 transcript:FBtr0080594)

HSP 1 Score: 209.534 bits (532), Expect = 1.415e-56
Identity = 114/326 (34.97%), Postives = 196/326 (60.12%), Query Frame = 1
Query:  394 EKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLK 1371
            EK L+++LL+ Y+   RPV++   P+                + FGL+L+QI+ +DE +Q+L +NV     W D ++RW    Y  +  + IP   +W PD+ +YN ADE  +   + + +++ +G+  + P  IFKSTC + I +FPFD Q C++KFG WTYDGF+L++   D +T  D ++YV N EWEL+    K   + Y CC EPY DI+F I+++R + +Y + LI+PC L++S+ L+ F LP +S  K+ LG+ I ++  + + ++ +++P+ S + PL+GTY+   M ++  S    ++ +N+H R  +  E+  W++
Sbjct:  313 EKRLLHDLLDPYNTLERPVLNESDPL---------------QLSFGLTLMQIIDVDEKNQLLVTNVWLKLEWNDMNLRWNTSDYGGVKDLRIPPHRIWKPDVLMYNSADEGFDGTYQTNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQD-ETGGDISSYVLNGEWELLGVPGKRNEIYYNCCPEPYIDITFAIIIRRRTLYYFFNLIIPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNADTHEMSEWIR 622          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Fly
Match: nAChRalpha5 (gene:FBgn0028875 transcript:FBtr0309867)

HSP 1 Score: 209.534 bits (532), Expect = 1.415e-56
Identity = 114/326 (34.97%), Postives = 196/326 (60.12%), Query Frame = 1
Query:  394 EKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLK 1371
            EK L+++LL+ Y+   RPV++   P+                + FGL+L+QI+ +DE +Q+L +NV     W D ++RW    Y  +  + IP   +W PD+ +YN ADE  +   + + +++ +G+  + P  IFKSTC + I +FPFD Q C++KFG WTYDGF+L++   D +T  D ++YV N EWEL+    K   + Y CC EPY DI+F I+++R + +Y + LI+PC L++S+ L+ F LP +S  K+ LG+ I ++  + + ++ +++P+ S + PL+GTY+   M ++  S    ++ +N+H R  +  E+  W++
Sbjct:  313 EKRLLHDLLDPYNTLERPVLNESDPL---------------QLSFGLTLMQIIDVDEKNQLLVTNVWLKLEWNDMNLRWNTSDYGGVKDLRIPPHRIWKPDVLMYNSADEGFDGTYQTNVVVRNNGSCLYVPPGIFKSTCKIDITWFPFDDQRCEMKFGSWTYDGFQLDLQLQD-ETGGDISSYVLNGEWELLGVPGKRNEIYYNCCPEPYIDITFAIIIRRRTLYYFFNLIIPCVLIASMALLGFTLPPDSGEKLSLGVTILLSLTVFLNMVAETMPATSDAVPLLGTYFNCIMFMVASSVVSTILILNYHHRNADTHEMSEWIR 622          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Zebrafish
Match: chrna4b (cholinergic receptor, nicotinic, alpha 4b [Source:ZFIN;Acc:ZDB-GENE-090505-3])

HSP 1 Score: 219.55 bits (558), Expect = 3.509e-61
Identity = 133/375 (35.47%), Postives = 209/375 (55.73%), Query Frame = 1
Query:  316 VFLLKCLRCQYQEKLSIKNHPEKSWTEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILKTPP 1440
            VF L C+  Q     S+   P  +  E+ L+  L   Y+K SRPV  N++ V              V V FGLS+ Q++ +DE +Q++T+NV     W DY +RW P  Y+N+T + IP++ +W PDI +YN AD          A + Y+G ++W P AI+KS+C + + +FPFD+Q CK+KFG WTYD  R  I      +++DQ +Y  + EW +I     +   +Y CC E YPDI++  +++R   FY   LI+PC L+S LT+++F+LP+E   K+ L +++ ++  + ++L+ + IPS S   PLIG Y    M  +TLS  + +  +N H R      +P W+++L +    R LF      +K PP
Sbjct:    7 VFFLLCVHLQLAYVFSMS--PAHAHAEERLLQSLFINYNKLSRPVA-NISDV--------------VLVHFGLSIAQLIDVDEKNQMMTTNVWVKQEWNDYKLRWNPEEYENVTSIRIPSEIIWRPDIVLYNNADGDFAVTHLTKAQVFYNGRIKWKPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYD--RAKIDLISMASDVDQMDYWESGEWVIINAVGTYNIKKYECCTEIYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECAEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSSRTHSMPHWVRQLFLHLVPRYLF------MKRPP 356          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Zebrafish
Match: chrna10a (cholinergic receptor, nicotinic, alpha 10a [Source:ZFIN;Acc:ZDB-GENE-060503-725])

HSP 1 Score: 214.542 bits (545), Expect = 3.796e-60
Identity = 129/348 (37.07%), Postives = 201/348 (57.76%), Query Frame = 1
Query:  403 LINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV-DLGFILKTPPP 1443
            L+N+L N Y    RPV             E  + I  VT++  LS  QI+ +DE +QILT+ +     W D ++ W    YD +  + IP  Y+W PDI +YN AD+      + + +I++DG + W   AI KS+C V + +FPFD Q C+L +G WTY+G +L+I   +     D  + V NVEWE++   AK   + Y CC +PYPD+++ + ++R ++FY + L++PC ++S L  + F+LPA+S  K+ LG+ + +A  +  +L+ + +P  S + PLIG YY   MT+IT ST L +  +N H  G + K VP W KK  +++ ARI FV ++G    TP P
Sbjct:   33 LLNDLFNNYTSALRPV-------------EDTEDILNVTLQITLS--QIIDMDERNQILTAYLWIRQVWIDKYLTWNKENYDGLDTIRIPGSYVWRPDIVLYNSADDHFTSTMDTNVVIRHDGQIMWDAPAITKSSCKVDVSFFPFDAQQCRLTYGSWTYNGNQLDI--LNAMESADLADLVDNVEWEVLGMPAKRNIILYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIMPP-SENVPLIGKYYIATMTMITASTALTIFVMNIHHCGPDAKPVPDWAKKFILQYLARICFVYEVGENCMTPQP 362          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Zebrafish
Match: chrna10a (cholinergic receptor, nicotinic, alpha 10a [Source:ZFIN;Acc:ZDB-GENE-060503-725])

HSP 1 Score: 214.157 bits (544), Expect = 4.283e-60
Identity = 129/348 (37.07%), Postives = 201/348 (57.76%), Query Frame = 1
Query:  403 LINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV-DLGFILKTPPP 1443
            L+N+L N Y    RPV             E  + I  VT++  LS  QI+ +DE +QILT+ +     W D ++ W    YD +  + IP  Y+W PDI +YN AD+      + + +I++DG + W   AI KS+C V + +FPFD Q C+L +G WTY+G +L+I   +     D  + V NVEWE++   AK   + Y CC +PYPD+++ + ++R ++FY + L++PC ++S L  + F+LPA+S  K+ LG+ + +A  +  +L+ + +P  S + PLIG YY   MT+IT ST L +  +N H  G + K VP W KK  +++ ARI FV ++G    TP P
Sbjct:   28 LLNDLFNNYTSALRPV-------------EDTEDILNVTLQITLS--QIIDMDERNQILTAYLWIRQVWIDKYLTWNKENYDGLDTIRIPGSYVWRPDIVLYNSADDHFTSTMDTNVVIRHDGQIMWDAPAITKSSCKVDVSFFPFDAQQCRLTYGSWTYNGNQLDI--LNAMESADLADLVDNVEWEVLGMPAKRNIILYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIMPP-SENVPLIGKYYIATMTMITASTALTIFVMNIHHCGPDAKPVPDWAKKFILQYLARICFVYEVGENCMTPQP 357          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Zebrafish
Match: CR388402.1 (cholinergic receptor, nicotinic, alpha 9 [Source:NCBI gene;Acc:568807])

HSP 1 Score: 213.001 bits (541), Expect = 1.676e-59
Identity = 144/432 (33.33%), Postives = 222/432 (51.39%), Query Frame = 1
Query:  403 LINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERR-ECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV-DLGFILKTPPPVETIKTKQCINPSFLNKAPPKHLPSSDFIDKTIQGAQFYDQFYQSNF---PQRNQNSNIHYLHSNHMRNMFESSDVRNSRPNT 1683
            L+N+L+ GY    RPV D               + + + V   ++L QI  +DE +Q+LT+ +     W D ++ W    YD +  + IP+  +W PDI +YN ADE       + + +++Y+G + W   AI KS+C V + YFPFD Q C L FG WTY+G +++I         D +++V NVEWE     A    + Y CC +PYPDI++ +L++R S+FY + L+LPCFL+S L  + F+LPA+S  K+ LG+ + +A  +  +++ +S+P  S S PLIG YY   MT+IT ST L +  +N HF G   K VP W K L I + ++I FV ++G         E   T +     F ++ P   L    + DK        D+  +S F     R+      Y H N           R +R ++
Sbjct:   28 LLNDLMEGYSNALRPVED---------------TDKALNVTLQITLSQIKDMDERNQVLTTYLWVRQIWHDAYLSWDKEEYDGLEVIRIPSNLVWRPDIVLYNNADEEDSSGPPDTNVVLRYNGEITWDSPAITKSSCKVDVSYFPFDSQECNLTFGSWTYNGNQVDIAM--GMESGDLSDFVDNVEWECHGMPAVKNVIMYGCCSDPYPDITYTVLLKRRSSFYIFNLLLPCFLISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLMVAESMP-PSESVPLIGKYYIATMTMITASTSLTIFIMNIHFCGAEAKPVPHWAKVLIIDYMSKIFFVYEVG---------ENCTTPESDRGPFFSEDPLASLERDGYFDKGFYEDCHLDERIRSQFNGYSHRDHRHGNGYHHKNSSYRQHRHEQQRRTRSSS 432          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Zebrafish
Match: chrna9 (cholinergic receptor, nicotinic, alpha 9 [Source:ZFIN;Acc:ZDB-GENE-090312-63])

HSP 1 Score: 213.386 bits (542), Expect = 2.268e-59
Identity = 144/432 (33.33%), Postives = 223/432 (51.62%), Query Frame = 1
Query:  403 LINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERR-ECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV-DLGFILKTPPPVETIKTKQCINPSFLNKAPPKHLPSSDFIDKTIQGAQFYDQFYQSNF---PQRNQNSNIHYLHSNHMRNMFESSDVRNSRPNT 1683
            L+N+L+ GY    RPV D               + + + V   ++L QI  +DE +Q+LT+ +     W D ++ W    YD +  + IP+  +W PDI +YN ADE       + + +++Y+G + W   AI KS+C V + YFPFD Q C L FG WTY+G +++I         D +++V NVEWE     A    + Y CC +PYPDI++ +L++R S+FY + L+LPCFL+S L  + F+LPA+S  K+ LG+ + +A  +  +++ +S+P  S S PLIG YY   MT+IT ST L +  +N HF G   K VP W K L I + ++I FV ++G         E   T +     F ++ P   L    + DK        D+  +S F     R+      Y H N       +   R +R ++
Sbjct:   28 LLNDLMEGYSNALRPVED---------------TDKALNVTLQITLSQIKDMDERNQVLTTYLWVRQIWHDAYLSWDKEEYDGLEVIRIPSNLVWRPDIVLYNNADEEDSSGPPDTNVVLRYNGEITWDSPAITKSSCKVDVSYFPFDSQECNLTFGSWTYNGNQVDIAM--GMESGDLSDFVDNVEWECHGMPAVKNVIMYGCCSDPYPDITYTVLLKRRSSFYIFNLLLPCFLISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLMVAESMP-PSESVPLIGKYYIATMTMITASTSLTIFIMNIHFCGAEAKPVPHWAKVLIIDYMSKIFFVYEVG---------ENCTTPESDRGPFFSEDPLASLERDGYFDKGFYEDCHLDERIRSQFNGYSHRDHRHGNGYHHKNSSYRQHRNEQQRRTRSSS 432          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Xenopus
Match: CHRNA2 (cholinergic receptor, nicotinic alpha 2 [Source:NCBI gene;Acc:100495873])

HSP 1 Score: 219.164 bits (557), Expect = 6.954e-62
Identity = 143/467 (30.62%), Postives = 250/467 (53.53%), Query Frame = 1
Query:  391 TEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILKTPPPVETIKTKQCINPSFLNKAPPKHLPSSDFIDKTIQGAQFYDQFYQSNFPQRNQNSNIHYLHSNHMRNMFESSDVRNSRPNTPDCAADV-PSVFDRYPTAESISGNEEELDDDLDFRQ 1788
             E+ L   L  GY++ SRPV          NT++       V V+FGLS+ Q++ +DE +Q++T+NV     W DY +RW P  YDN+T + +P++ +W+PDI +YN AD          A + ++G V+W P AI+KS+C + + +FPFD+Q CK+KFG WTYD   L++   +   +L   +Y  + EW ++    K+ + +Y CC E YPDI+++ +++R   FY   LI+PC L+S LT+++F+LP++   K+ L +++ ++  + ++L+ + IPS S   PLIG Y    M  +TLS  + +  +N H R  +  ++P W++ + + H  R LF+      + P PVE + ++   +   L  +  K+   +D  DK  +        +  +    NQ+    Y +++H+    +S   R+S   T + +  + PSV         I+ +    D D   ++
Sbjct:   31 AEERLFKRLFTGYNRWSRPVP---------NTSD------VVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPADYDNVTSIRVPSEMIWIPDIVLYNNADGEFAITHMTKAHLFHNGKVKWVPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTYDKAWLDLESMERNVDL--KDYWESGEWAIVNAVGKYNSKKYDCCTEIYPDITYYFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPLWVRSVFLDHIPRWLFMK-----RPPAPVEEVVSQY--DAPELKLSTSKYWMETDVDDKWAEPEAELQTCHVRHMTTHNQSLQYRYDYNHHVSGG-QSQTPRHSSTETAESSFLLSPSVLKALEGVHYIANHLRAEDADFSVKE 472          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Xenopus
Match: prepl (prolyl endopeptidase-like [Source:Xenbase;Acc:XB-GENE-981635])

HSP 1 Score: 218.394 bits (555), Expect = 9.521e-62
Identity = 127/336 (37.80%), Postives = 199/336 (59.23%), Query Frame = 1
Query:  403 LINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV 1410
            L+N+L   Y    RPV             E       VT++  LS  QI+ +DE +QIL + +     W D ++RW    YD +  + IP+ Y+W PDI +YN AD++     E + +I+YDG + W   AI KS+C V + +FPFD Q C+L FG WTY+G +++I  + +  +L   ++V NVEWE++   AK + + Y CC EPYPD+++ ++++R ++FY + L+LPC ++S L  + F+LPA+S  K+ LG+ + +A  +  +L+ +S+P  S + PLIG YY   MT+IT ST L +  +N H  G   K VP W KK  +++ +RI FV
Sbjct:   28 LMNDLFANYSNALRPV-------------EDMDKAMNVTLQVTLS--QIIDMDERNQILMAYLWIRQVWFDAYLRWNKEDYDGLDTIRIPSSYVWRPDIVLYNNADDQFTGSMETNVVIRYDGQIMWDSPAITKSSCKVDVSFFPFDGQQCRLTFGSWTYNGNQIDILNHLDTGDL--TDFVENVEWEILGMPAKKSVITYGCCSEPYPDVTYTLILKRRASFYIFNLLLPCVMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMP-PSENVPLIGKYYIATMTMITASTALTIFIMNIHHCGPEAKPVPQWAKKFILQYMSRIFFV 345          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Xenopus
Match: CHRNA2 (cholinergic receptor, nicotinic alpha 2 [Source:NCBI gene;Acc:100495873])

HSP 1 Score: 217.624 bits (553), Expect = 1.526e-61
Identity = 143/462 (30.95%), Postives = 248/462 (53.68%), Query Frame = 1
Query:  394 EKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILKTPPPVETIKTKQCINPSFLNKAPPKHLPSSDFIDKTIQGAQFYDQFYQSNFPQRNQNSNIHYLHSNHMRNMFESSDVRNSRPNTPDCAADV-PSVFDRYPTAESISGNEEELDDDL 1776
            E+ L   L  GY++ SRPV          NT++       V V+FGLS+ Q++ +DE +Q++T+NV     W DY +RW P  YDN+T + +P++ +W+PDI +YN AD          A + ++G V+W P AI+KS+C + + +FPFD+Q CK+KFG WTYD   L++   +   +L   +Y  + EW ++    K+ + +Y CC E YPDI+++ +++R   FY   LI+PC L+S LT+++F+LP++   K+ L +++ ++  + ++L+ + IPS S   PLIG Y    M  +TLS  + +  +N H R  +  ++P W++ + + H  R LF+      + P PVE + ++   +   L  +  K+   +D  DK  +        +  +    NQ+    Y +++H+    +S   R+S   T + +  + PSV         I+ +    D D 
Sbjct:   32 EERLFKRLFTGYNRWSRPVP---------NTSD------VVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPADYDNVTSIRVPSEMIWIPDIVLYNNADGEFAITHMTKAHLFHNGKVKWVPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTYDKAWLDLESMERNVDL--KDYWESGEWAIVNAVGKYNSKKYDCCTEIYPDITYYFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPLWVRSVFLDHIPRWLFMK-----RPPAPVEEVVSQY--DAPELKLSTSKYWMETDVDDKWAEPEAELQTCHVRHMTTHNQSLQYRYDYNHHVSGG-QSQTPRHSSTETAESSFLLSPSVLKALEGVHYIANHLRAEDADF 468          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Xenopus
Match: CHRNA9 (cholinergic receptor, nicotinic alpha 9 [Source:NCBI gene;Acc:100493319])

HSP 1 Score: 211.846 bits (538), Expect = 1.409e-59
Identity = 123/342 (35.96%), Postives = 196/342 (57.31%), Query Frame = 1
Query:  397 KVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV-DLG 1419
            ++L  +L   Y    RPV D               + + + V   ++L QI  +DE +QILT+ +     W D +++W    YD +  + IP+  +W PDI +YN AD+   E    + +++YDG + W   AI KS+C V + YFPFD Q C L FG WTY+G +++I   +     D +++V NVEWE+    A    + Y CC EPYPDI+F ++++R S+FY + L++PC ++S L  + F+LPA+S  K+ LG+ + +A  +  +++ +S+P  S S PLIG YY   MT+IT ST L +I +N H  G   K +P W + + + + ++I FV D+G
Sbjct:   16 QMLFRDLFEDYSNALRPVED---------------TDKALNVSLQITLSQIKDVDERNQILTAYLWIRLSWYDAYLKWDRDEYDGLDSIRIPSNMVWRPDIVLYNKADDEFSEPVNTNVVLRYDGKITWDSPAITKSSCVVDVSYFPFDNQQCNLTFGSWTYNGNQVDII--NTMDSGDLSDFVENVEWEMQGMPAVKNVITYGCCSEPYPDITFTLILKRRSSFYIFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLMVAESMP-PSESVPLIGKYYIATMTMITASTALTIIIMNIHLCGPEAKPIPRWARIVILDYMSKIFFVYDVG 339          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Xenopus
Match: CHRNA9 (cholinergic receptor, nicotinic alpha 9 [Source:NCBI gene;Acc:100493319])

HSP 1 Score: 211.846 bits (538), Expect = 2.854e-59
Identity = 123/342 (35.96%), Postives = 196/342 (57.31%), Query Frame = 1
Query:  397 KVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV-DLG 1419
            ++L  +L   Y    RPV D               + + + V   ++L QI  +DE +QILT+ +     W D +++W    YD +  + IP+  +W PDI +YN AD+   E    + +++YDG + W   AI KS+C V + YFPFD Q C L FG WTY+G +++I   +     D +++V NVEWE+    A    + Y CC EPYPDI+F ++++R S+FY + L++PC ++S L  + F+LPA+S  K+ LG+ + +A  +  +++ +S+P  S S PLIG YY   MT+IT ST L +I +N H  G   K +P W + + + + ++I FV D+G
Sbjct:   39 QMLFRDLFEDYSNALRPVED---------------TDKALNVSLQITLSQIKDVDERNQILTAYLWIRLSWYDAYLKWDRDEYDGLDSIRIPSNMVWRPDIVLYNKADDEFSEPVNTNVVLRYDGKITWDSPAITKSSCVVDVSYFPFDNQQCNLTFGSWTYNGNQVDII--NTMDSGDLSDFVENVEWEMQGMPAVKNVITYGCCSEPYPDITFTLILKRRSSFYIFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLMVAESMP-PSESVPLIGKYYIATMTMITASTALTIIIMNIHLCGPEAKPIPRWARIVILDYMSKIFFVYDVG 362          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Mouse
Match: Chrna9 (cholinergic receptor, nicotinic, alpha polypeptide 9 [Source:MGI Symbol;Acc:MGI:1202403])

HSP 1 Score: 215.312 bits (547), Expect = 6.117e-61
Identity = 142/410 (34.63%), Postives = 218/410 (53.17%), Query Frame = 1
Query:  403 LINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV-DLGFILKTP----PPVETIKTKQCINPSFLNKAPPKHLPSSDFIDKTIQGAQFYDQFYQSNFPQRNQNSNIHY 1617
            L ++L   Y    RPV             E   ++  VT++  LS  QI  +DE +QILT+ +     W D ++ W    YD +  + IP+  +W PDI +YN AD+   E    + +++YDG + W   AI KS+C V + YFPFD Q C L FG WTY+G +++I  ++     D ++++ +VEWE+    A    + Y CC EPYPD++F +L++R S+FY   L++PC L+S L  + F+LPA S  K+ LG+ I +A  +  +++ + +P AS + PLIG YY   M LIT ST L ++ +N HF G   + VP W K + +K+ +RILFV D+G    +P     P +  K    +  S L  +  K L     + K ++     D  YQ   PQ   +    Y
Sbjct:   34 LFSDLFEDYSNALRPV-------------EDTDAVLNVTLQVTLS--QIKDMDERNQILTAYLWIRQTWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDSPAITKSSCVVDVTYFPFDSQQCNLTFGSWTYNGNQVDI--FNALDSGDLSDFIEDVEWEVQGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFYIVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMP-ASENVPLIGKYYIATMALITASTALTIMVMNIHFCGAEARPVPHWAKVVILKYMSRILFVYDVGESCLSPRHSQEPEQITKVYGKLPGSNLKASRNKDLSRKKELRKLLKN----DLGYQGGIPQNTDSYCARY 421          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Mouse
Match: Chrna4 (cholinergic receptor, nicotinic, alpha polypeptide 4 [Source:MGI Symbol;Acc:MGI:87888])

HSP 1 Score: 211.075 bits (536), Expect = 4.588e-58
Identity = 122/350 (34.86%), Postives = 206/350 (58.86%), Query Frame = 1
Query:  382 KSWTEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILK 1431
            ++  E+ L+  L +GY+K SRPV  N++ V              V V FGLS+ Q++ +DE +Q++T+NV     W DY +RW P  Y+N+T + IP++ +W PDI +YN AD          A + YDG V+W P AI+KS+C + + +FPFD+Q C +KFG WTYD  ++++    ++  +DQ ++  + EW ++     + T +Y CC E YPDI++  +++R   FY   LI+PC L+S LT+++F+LP+E   K+ L +++ ++  + ++L+ + IPS S   PLIG Y    M  +TLS  + +  +N H R      +P W++++ +    R+LF+    ++K
Sbjct:   35 RAHAEERLLKRLFSGYNKWSRPVA-NISDV--------------VLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSMHSR--VDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLFMKRPSVVK 367          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Mouse
Match: Chrna4 (cholinergic receptor, nicotinic, alpha polypeptide 4 [Source:MGI Symbol;Acc:MGI:87888])

HSP 1 Score: 211.075 bits (536), Expect = 5.922e-58
Identity = 122/350 (34.86%), Postives = 206/350 (58.86%), Query Frame = 1
Query:  382 KSWTEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILK 1431
            ++  E+ L+  L +GY+K SRPV  N++ V              V V FGLS+ Q++ +DE +Q++T+NV     W DY +RW P  Y+N+T + IP++ +W PDI +YN AD          A + YDG V+W P AI+KS+C + + +FPFD+Q C +KFG WTYD  ++++    ++  +DQ ++  + EW ++     + T +Y CC E YPDI++  +++R   FY   LI+PC L+S LT+++F+LP+E   K+ L +++ ++  + ++L+ + IPS S   PLIG Y    M  +TLS  + +  +N H R      +P W++++ +    R+LF+    ++K
Sbjct:   35 RAHAEERLLKRLFSGYNKWSRPVA-NISDV--------------VLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSMHSR--VDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTMPAWVRRVFLDIVPRLLFMKRPSVVK 367          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Mouse
Match: Chrna10 (cholinergic receptor, nicotinic, alpha polypeptide 10 [Source:MGI Symbol;Acc:MGI:3609260])

HSP 1 Score: 201.06 bits (510), Expect = 3.686e-56
Identity = 121/336 (36.01%), Postives = 186/336 (55.36%), Query Frame = 1
Query:  403 LINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV 1410
            L  +L   Y    RPV D             +Q++  VT+E  LS  QI+ +DE +Q+LT  +     W D ++ W P  Y ++  + IP+  +W PDI +YN AD +       + ++++DG V W   AI +S+C V +  FPFD Q C L FG WT+ G +L++      T     ++V NVEW ++   A+   + Y CC EPYPD++F +L++R +A Y   L+LPC  +S L  + F LPA+S  K+ LG+ + +A  +  ++L +S+P A  S PLIG YY   MT++T ST L ++ +N H+ G N   VP W + L + H A+ L V
Sbjct:   33 LFRDLFANYTSALRPVADT------------DQTLN-VTLEVTLS--QIIDMDERNQVLTLYLWIRQEWTDAYLHWDPKAYGDLDAIRIPSSLVWRPDIVLYNKADTQPPASASTNVVVRHDGAVRWDAPAITRSSCRVDVSAFPFDAQRCGLTFGSWTHGGHQLDVR--PRGTSASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYVCNLLLPCVFISLLAPLAFHLPADSGEKVSLGVTVLLALTVFQLILAESMPPA-ESVPLIGKYYMATMTMVTFSTALTILIMNLHYCGPNAHPVPAWARVLLLGHLAKGLCV 350          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Mouse
Match: Chrna6 (cholinergic receptor, nicotinic, alpha polypeptide 6 [Source:MGI Symbol;Acc:MGI:106213])

HSP 1 Score: 200.675 bits (509), Expect = 1.852e-55
Identity = 115/340 (33.82%), Postives = 192/340 (56.47%), Query Frame = 1
Query:  391 TEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV 1410
            +E+ L + L   Y++  RPV +   PV               TV F L++ Q+  +DE++QI+ +N+   + WKDY +RW P  YD I  + +P   +W PDI +YN A    +   +  A++KYDG + W P AIFKS+CP+ I +FPFD Q C LKFG WTYD   +++    +K  +D N++  N EWE++        ++Y CC E Y DI++   ++R   FY   LI+PC  +S LT+++F+LP++   K+ L +++ ++  + ++++ ++IPS S   PL+G Y    M  +TLS  + +  +N H+R      +P W+K + ++    IL +
Sbjct:   33 SEEQLFHRLFAHYNRFIRPVENVSDPV---------------TVHFELAITQLANVDEVNQIMETNLWLRHIWKDYRLRWDPTEYDGIETLRVPADNIWKPDIVLYNNAVGDFQVEGKTKALLKYDGVITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSK--VDMNDFWENSEWEIVDASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPATHTMPKWVKTIFLQAFPSILMM 355          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. UniProt/SwissProt
Match: sp|Q9I8C7|ACH10_CHICK (Neuronal acetylcholine receptor subunit alpha-10 OS=Gallus gallus OX=9031 GN=CHRNA10 PE=3 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 7.792e-61
Identity = 129/337 (38.28%), Postives = 193/337 (57.27%), Query Frame = 1
Query:  403 LINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNI-TFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV 1410
            L+++L   Y    RP             AE  +    VT++  LS  QI+ +DE +Q+LTS +     W D H+ W    Y  I  + IP+ Y+W PDI +YN ADER     E + +++ DG + W   AI KS+C V + YFPFD Q C+L FG WTY+G ++++    D     D  ++V NVEWE++   A    V Y CC EPYPD+++ +L++R ++FY + L+LPC ++S L  + F+LPA+S  K+ LG+ + +A  +  +L+ +S+P  S S PLIG YY   MT+IT ST L +  +N H  G   + VP W ++L + H AR L V
Sbjct:   35 LLHDLFANYSSALRP-------------AEDTERALNVTLQVTLS--QIIDMDERNQVLTSYLWVRQAWLDAHLAWDKDAYGGIDSIRIPSSYVWRPDIVLYNNADERFGGSMETNVVLRSDGHIMWDSPAITKSSCKVDVSYFPFDGQQCRLTFGSWTYNGNQIDLRNLLDTG---DLTDFVENVEWEVLGMPATRNVVTYGCCSEPYPDVTYTLLLRRRASFYIFNLLLPCVMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPP-SESVPLIGKYYIATMTMITASTALTIFIMNIHHCGPGARPVPPWARRLILHHLARALCV 352          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. UniProt/SwissProt
Match: sp|P17644|ACH2_DROME (Acetylcholine receptor subunit alpha-like 2 OS=Drosophila melanogaster OX=7227 GN=nAChRalpha2 PE=2 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 9.280e-61
Identity = 127/346 (36.71%), Postives = 204/346 (58.96%), Query Frame = 1
Query:  397 KVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFY------DNKTE--LDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV 1410
            K L ++LL+ Y++  RPV +N                  V V+ GL L Q++ L+  DQILT+NV   + W+D+  +W P  Y  +T +++P++++WLPDI +YN AD          AI+ Y G V W P AIFKS+C + ++YFPFD+Q C +KFG WTYDG ++++         DNK E  +D   Y  +VEW+++   A+     YPCC EPYPDI F+I ++R + FY   LI+PC  +S L++++F+LPA+S  K+ L ++I ++  +  +L+ + IPS S + PL+G Y    M L+ LS  + +I +N H+R  +  ++  W++   IK   ++L +
Sbjct:   46 KRLYDDLLSNYNRLIRPVSNN---------------TDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLM 376          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. UniProt/SwissProt
Match: sp|P23414|ACH1_SCHGR (Acetylcholine receptor subunit alpha-L1 OS=Schistocerca gregaria OX=7010 PE=2 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 1.207e-60
Identity = 124/345 (35.94%), Postives = 207/345 (60.00%), Query Frame = 1
Query:  397 KVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNI-----TFYDNKTE--LDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV 1410
            K L ++LL+ Y++  RPV +N                  V V+ GL L Q++ L+  DQILT+NV   + W+D+  RW P  Y  +T +++P++++WLPDI +YN AD          A++ + G V W P AIFKS+C + ++YFPFD+Q C +KFG WTYDG ++++      + DNK +  +D   Y  +VEW+++   A+     YPCC EPYPDI F+I ++R + FY   LI+PC  +S L++++F+LPA+S  K+ L ++I ++  +  +L+ + IPS S + PL+G Y    M L+ LS  + ++ +N H+R  +  ++  W++K+ I+   ++L +
Sbjct:   28 KRLYDDLLSNYNRLIRPVSNN---------------TDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFRWDPAEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAVLHHTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHINQKYDDNKVKVGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIVPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMVLVGLSVVITIMVLNVHYRKPSTHKMAPWVRKVFIRRLPKLLLM 357          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. UniProt/SwissProt
Match: sp|P43144|ACHA9_RAT (Neuronal acetylcholine receptor subunit alpha-9 OS=Rattus norvegicus OX=10116 GN=Chrna9 PE=1 SV=2)

HSP 1 Score: 215.698 bits (548), Expect = 2.839e-60
Identity = 142/410 (34.63%), Postives = 218/410 (53.17%), Query Frame = 1
Query:  403 LINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV-DLGFILKTP----PPVETIKTKQCINPSFLNKAPPKHLPSSDFIDKTIQGAQFYDQFYQSNFPQRNQNSNIHY 1617
            L ++L   Y    RPV             E   ++  VT++  LS  QI  +DE +QILT+ +     W D ++ W    YD +  + IP+  +W PDI +YN AD+   E    + +++YDG + W   AI KS+C V + YFPFD Q C L FG WTY+G +++I  ++     D ++++ +VEWE+    A    + Y CC EPYPD++F +L++R S+FY   L++PC L+S L  + F+LPA S  K+ LG+ I +A  +  +++ + +P AS + PLIG YY   M LIT ST L ++ +N HF G   + VP W K + +K+ +RILFV D+G    +P     P +  K    +  S L  +  K L     + K ++     D  YQ   PQ   +    Y
Sbjct:   34 LFSDLFEDYSSALRPV-------------EDTDAVLNVTLQVTLS--QIKDMDERNQILTAYLWIRQTWHDAYLTWDRDQYDRLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDSPAITKSSCVVDVTYFPFDSQQCNLTFGSWTYNGNQVDI--FNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFYIVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMP-ASENVPLIGKYYIATMALITASTALTIMVMNIHFCGAEARPVPHWAKVVILKYMSRILFVYDVGESCLSPRHSQEPEQVTKVYSKLPESNLKTSRNKDLSRKKEVRKLLKN----DLGYQGGIPQNTDSYCARY 421          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. UniProt/SwissProt
Match: sp|Q9UGM1|ACHA9_HUMAN (Neuronal acetylcholine receptor subunit alpha-9 OS=Homo sapiens OX=9606 GN=CHRNA9 PE=1 SV=2)

HSP 1 Score: 211.46 bits (537), Expect = 9.936e-59
Identity = 127/340 (37.35%), Postives = 195/340 (57.35%), Query Frame = 1
Query:  403 LINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV-DLG 1419
            L N+L   Y    RPV             E    +  VT++  LS  QI  +DE +QILT+ +     W D ++ W    YD +  + IP+  +W PDI +YN AD+   E    + +++YDG + W   AI KS+C V + YFPFD Q C L FG WTY+G +++I  ++     D ++++ +VEWE+    A    + Y CC EPYPD++F +L++R S+FY   L++PC L+S L  + F+LPA S  K+ LG+ I +A  +  +++ + +P AS + PLIG YY   M LIT ST L ++ +N HF G   + VP W + + +K+ +R+LFV D+G
Sbjct:   34 LFNDLFEDYSNALRPV-------------EDTDKVLNVTLQITLS--QIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLYNKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNGNQVDI--FNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFYIVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMP-ASENVPLIGKYYIATMALITASTALTIMVMNIHFCGAEARPVPHWARVVILKYMSRVLFVYDVG 355          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. TrEMBL
Match: A0A1I8H1Z4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 7.668e-132
Identity = 227/385 (58.96%), Postives = 287/385 (74.55%), Query Frame = 1
Query:  322 LLKC-----LRCQYQEK------LSIKNHPEKSWTEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQS---------IQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDL 1416
            LL+C     L CQ+  +      +S    P+    EK LI +LL  YDK+SRPV+D   P Y     ER +          IQQVTVEFGL L+QI+ LDEM+Q+LT+++ +LY W DYH+RW+P   D I  VHIPTK +WLPDI++YNYADER+EERR+  A + Y G VEWHPMAI+KS C ++IK+FPFD+Q C LKFGPWTYDG+R+NI++Y N T+ D    + + EW ++  +AK+    YPCC EPY DI+F I ++R++AFY +ILILPCFLLSSLTLVLFWLP E+PAKMVLGMNIF+AFFLL++LLEK  PSAS SFPLIG YYC+NM +ITLSTFL +I VNFHFRGDNR+EVP+WLKKL I+HG+R+LFV+L
Sbjct:    3 LLECIAALLLLCQWAPRQPILTAVSALGQPQMKMAEKNLIKQLLQHYDKKSRPVIDA-DPPYGTPKIERRKEKHANSSTIPIQQVTVEFGLRLVQILDLDEMEQVLTTSMISLYEWTDYHLRWEPEDEDGIMFVHIPTKDIWLPDIALYNYADERLEERRDVAAKVHYTGLVEWHPMAIYKSACEIKIKFFPFDKQVCWLKFGPWTYDGWRVNISYYHNMTKFDLEEMIDSPEWTILSHKAKYNEEVYPCCPEPYVDITFWIWIRRSTAFYTFILILPCFLLSSLTLVLFWLPPETPAKMVLGMNIFVAFFLLMLLLEKQTPSASDSFPLIGQYYCLNMGIITLSTFLSVIVVNFHFRGDNRQEVPYWLKKLAIQHGSRLLFVNL 386          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. TrEMBL
Match: A0A267E180 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032313g2 PE=3 SV=1)

HSP 1 Score: 414.846 bits (1065), Expect = 1.139e-130
Identity = 229/393 (58.27%), Postives = 290/393 (73.79%), Query Frame = 1
Query:  322 LLKC-----LRCQYQEK------LSIKNHPEKSWTEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQS---------IQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILKTPP 1440
            LL+C     L CQ+  +      +S    P+    EK LI +LL  YDK+SRPV+D   P Y     ER +          IQQVTVEFGL L+QI+ LDEM+Q+LT+++ +LY W DYH+RW+P   D I  VHIPTK +WLPDI++YNYADER+EERR+  A + Y G VEWHPMAI+KS C ++IK+FPFD+Q C LKFGPWTYDG+R+NI++Y N T+ D    + + EW ++  +AK+    YPCC EPY DI+F I ++R++AFY +ILILPCFLLSSLTLVLFWLP E+PAKMVLGMNIF+AFFLL++LLEK  PSAS SFPLIG YYC+NM +ITLSTFL +I VNFHFRGDNR+EVP+WLKKL I+HG+R+LFV+L    + PP
Sbjct:    3 LLECIAALLLLCQWAPRQPILTAVSALGQPQMKMAEKNLIKQLLQHYDKKSRPVIDA-DPPYGTPKIERRKEKHANSSTIPIQQVTVEFGLRLVQILDLDEMEQVLTTSMISLYEWTDYHLRWEPEDEDGIMFVHIPTKDIWLPDIALYNYADERLEERRDVAAKVHYTGLVEWHPMAIYKSACEIKIKFFPFDKQVCWLKFGPWTYDGWRVNISYYHNMTKFDLEEMIDSPEWTILSHKAKYNEEVYPCCPEPYVDITFWIWIRRSTAFYTFILILPCFLLSSLTLVLFWLPPETPAKMVLGMNIFVAFFLLMLLLEKQTPSASDSFPLIGQYYCLNMGIITLSTFLSVIVVNFHFRGDNRQEVPYWLKKLAIQHGSRLLFVNLN---RKPP 391          

HSP 2 Score: 104.375 bits (259), Expect = 2.751e-19
Identity = 44/70 (62.86%), Postives = 61/70 (87.14%), Query Frame = 1
Query: 2059 RRINLVTKDISDIIKDLTFIQKTNENKERVNKIVSEWRAVGLVLDRFFFMLYVIAIILSLILFFPKAGND 2268
            RRIN++TKD+ DI+K L +IQK +EN+E+VNK+V EWR+V LVLDR FF++YV+ I+LS+I FFPK+GN+
Sbjct:  561 RRINMLTKDVQDIVKALRYIQKLHENREKVNKVVQEWRSVALVLDRLFFLIYVLTIMLSIIFFFPKSGNE 630          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. TrEMBL
Match: A0A267F2A9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032313g1 PE=3 SV=1)

HSP 1 Score: 414.846 bits (1065), Expect = 1.173e-130
Identity = 229/393 (58.27%), Postives = 290/393 (73.79%), Query Frame = 1
Query:  322 LLKC-----LRCQYQEK------LSIKNHPEKSWTEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQS---------IQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILKTPP 1440
            LL+C     L CQ+  +      +S    P+    EK LI +LL  YDK+SRPV+D   P Y     ER +          IQQVTVEFGL L+QI+ LDEM+Q+LT+++ +LY W DYH+RW+P   D I  VHIPTK +WLPDI++YNYADER+EERR+  A + Y G VEWHPMAI+KS C ++IK+FPFD+Q C LKFGPWTYDG+R+NI++Y N T+ D    + + EW ++  +AK+    YPCC EPY DI+F I ++R++AFY +ILILPCFLLSSLTLVLFWLP E+PAKMVLGMNIF+AFFLL++LLEK  PSAS SFPLIG YYC+NM +ITLSTFL +I VNFHFRGDNR+EVP+WLKKL I+HG+R+LFV+L    + PP
Sbjct:    3 LLECIAALLLLCQWAPRQPILTAVSALGQPQMKMAEKNLIKQLLQHYDKKSRPVIDA-DPPYGTPKIERRKEKHANSSTIPIQQVTVEFGLRLVQILDLDEMEQVLTTSMISLYEWTDYHLRWEPEDEDGIMFVHIPTKDIWLPDIALYNYADERLEERRDVAAKVHYTGLVEWHPMAIYKSACEIKIKFFPFDKQVCWLKFGPWTYDGWRVNISYYHNMTKFDLEEMIDSPEWTILSHKAKYNEEVYPCCPEPYVDITFWIWIRRSTAFYTFILILPCFLLSSLTLVLFWLPPETPAKMVLGMNIFVAFFLLMLLLEKQTPSASDSFPLIGQYYCLNMGIITLSTFLSVIVVNFHFRGDNRQEVPYWLKKLAIQHGSRLLFVNLN---RKPP 391          

HSP 2 Score: 104.375 bits (259), Expect = 2.760e-19
Identity = 44/70 (62.86%), Postives = 61/70 (87.14%), Query Frame = 1
Query: 2059 RRINLVTKDISDIIKDLTFIQKTNENKERVNKIVSEWRAVGLVLDRFFFMLYVIAIILSLILFFPKAGND 2268
            RRIN++TKD+ DI+K L +IQK +EN+E+VNK+V EWR+V LVLDR FF++YV+ I+LS+I FFPK+GN+
Sbjct:  562 RRINMLTKDVQDIVKALRYIQKLHENREKVNKVVQEWRSVALVLDRLFFLIYVLTIMLSIIFFFPKSGNE 631          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. TrEMBL
Match: A0A4E0RKE5 (Acetylcholine-gated chloride channel subunit OS=Fasciola hepatica OX=6192 GN=D915_002089 PE=3 SV=1)

HSP 1 Score: 417.927 bits (1073), Expect = 5.185e-130
Identity = 226/353 (64.02%), Postives = 281/353 (79.60%), Query Frame = 1
Query:  361 SIKN-HPEKSWTEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDL 1416
            SI+N + +  WTEK LI +LL+ Y+KR+RPVVDN +PV ++     + ++QQ+TV FGL LIQI+ L+E +Q LT +V++LYRW DYH+ W P  Y+NITH+ IPT  +W+PDI++YNYADER+EERREC A I ++G VEWHPMAI+KSTCPV+IKYFP+DRQ C L+FGPWTYD  R+NI+FY+    L+  +YV + EW LI T        YPCC E Y DI F + ++R  A+YNYILILPCFLLSSLTLVLFWLP E+PAKMVLGMNIF+AFFLL++LLEKSIP+ASSSFPLIG YYCINMTL+TLSTFLCLI VN HFRGD R EVP WL+KL I+HGAR+L V++
Sbjct:   24 SIENPYSKGKWTEKSLIKDLLHDYEKRARPVVDNKSPVIQLG----DLTVQQITVGFGLGLIQILDLNENEQTLTVSVKSLYRWPDYHLVWNPEEYENITHITIPTDKIWIPDIALYNYADERLEERRECAARIDHNGIVEWHPMAIYKSTCPVKIKYFPYDRQECNLRFGPWTYDNSRVNISFYE-AVNLNLKDYVVSPEWNLISTDVIMRQRAYPCCPEKYSDIFFRMTIERQPAYYNYILILPCFLLSSLTLVLFWLPPETPAKMVLGMNIFVAFFLLLLLLEKSIPNASSSFPLIGNYYCINMTLVTLSTFLCLIVVNLHFRGDRRTEVPHWLRKLAIQHGARLLLVNV 371          

HSP 2 Score: 88.9669 bits (219), Expect = 2.400e-14
Identity = 33/70 (47.14%), Postives = 59/70 (84.29%), Query Frame = 1
Query: 2059 RRINLVTKDISDIIKDLTFIQKTNENKERVNKIVSEWRAVGLVLDRFFFMLYVIAIILSLILFFPKAGND 2268
            RR+  V +D+S+I++ + F+Q+ NENK +VNK+++EWR VG+VLDR FF++Y++A+ +S++L+FP++G +
Sbjct:  728 RRVENVKRDVSEIVRGIRFMQRQNENKVKVNKLIAEWRLVGMVLDRLFFVIYLLALGISILLYFPRSGEE 797          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. TrEMBL
Match: G4M0G9 (Acetylcholine-gated chloride channel subunit OS=Schistosoma mansoni OX=6183 GN=ACC-1 PE=2 SV=1)

HSP 1 Score: 416.387 bits (1069), Expect = 2.993e-129
Identity = 262/508 (51.57%), Postives = 337/508 (66.34%), Query Frame = 1
Query:  301 IIIGFVFLLKCLRCQYQEKLSIKNHPEKSWTEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILKTPPPVETIKTKQCINP--------SFLNKAP----------PK--HLPSSDFIDKTIQGAQFYDQFYQSNFPQRNQNSNIHYLHSN----HMRNMFESSDVRNSRPNT--PDCAADVP--SVFDRYPTAES 1740
            +I+ +   L  L  QY +K          WTEK LI +LL  Y+KR+RPVVD ++P   +     N ++QQ+TV FGL LIQI++L+E +QILT +VR+LYRW DYH+ W P  Y+NITH++IPT  +WLPDI++YNYADER+EERREC   + ++G VEWHPMAI+KSTCPV+IKYFP+D+Q C L+FGPWT+D  R+NITFYD    +   +YV + EW ++    K  T  YPCC E Y D  F I ++R +A+YNYILILPCFLLSSLTLVLFWLP E+PAKMVLGMNIF+AFFLL++LLE SIPSASSSFPLIG YYCINMTL+TLSTFLCLI VN HFRGD R EVPFWL+KL + HG+RIL V++G     PPP      K    P        +F+ K+P          PK   +P SDF +K    A+  ++F +   P  N+  +  Y ++N    HMR+ F +    +  P    PD  A++   S F R  T E+
Sbjct:   10 LIMFYANFLHPLESQYTDK----------WTEKSLIKDLLRDYEKRARPVVDGMSPEITVG----NTTVQQITVAFGLGLIQILQLNENEQILTVSVRSLYRWTDYHLVWNPEEYENITHINIPTDKIWLPDIALYNYADERLEERRECAVRVDHNGVVEWHPMAIYKSTCPVKIKYFPYDKQVCYLRFGPWTFDSARVNITFYDEGFSM--KDYVESPEWSVLNYWQKHRTHAYPCCPEQYSDTLFFIKIERQAAYYNYILILPCFLLSSLTLVLFWLPPETPAKMVLGMNIFLAFFLLLLLLENSIPSASSSFPLIGNYYCINMTLVTLSTFLCLIVVNLHFRGDRRTEVPFWLRKLALHHGSRILLVNVGPPGGPPPPTSASSNKTSEKPITNMNSVHNFM-KSPDNFLCGDSFNPKMFSVPRSDFTEKFGDNAKV-NRFGK---PHGNKFCSPEYCYANSRQAHMRSQFPTGSPNHKFPGCYYPDNEAEMKHFSQFSRRQTQET 496          

HSP 2 Score: 97.0561 bits (240), Expect = 9.362e-17
Identity = 38/70 (54.29%), Postives = 61/70 (87.14%), Query Frame = 1
Query: 2059 RRINLVTKDISDIIKDLTFIQKTNENKERVNKIVSEWRAVGLVLDRFFFMLYVIAIILSLILFFPKAGND 2268
            +R+++VT+D+S+I+K + F+QK NE KE+ NKI+SEWRAVG+VLDR FF++Y+ A+ +S++L+FP++G D
Sbjct:  730 KRVHMVTRDVSEIVKGIRFMQKQNEKKEKNNKIISEWRAVGMVLDRLFFIIYLCALGISILLYFPRSGED 799          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Cavefish
Match: chrna4b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:103025036])

HSP 1 Score: 221.476 bits (563), Expect = 5.473e-62
Identity = 133/375 (35.47%), Postives = 218/375 (58.13%), Query Frame = 1
Query:  316 VFLLKCLRCQYQEKLSIKNHPEKSWTEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILKTPP 1440
            + L+ CL+  Y   L+    P ++  E+ L+  L + Y+K SRPV  N++ V              V V FGLS+ Q++ +DE +Q++T+NV     W DY +RW P  Y+N+T + IP++ +W PDI +YN AD          A + +DG ++W P AI+KS+C + + +FPFD+Q CK+KFG WTYD  ++++   D+  ++DQ +Y  + EW +I    K+ T +Y CC E YPDI++  +++R   FY   LI+PC L+S LT+++F+LP+E   K+ L +++ ++  + ++L+ + IPS S   PLIG Y    M  +TLS  + +  +N H R      +P W+++L ++   R LF      +K PP
Sbjct:    9 LVLIICLQHGYVCTLT----PARAHAEERLLQVLFSRYNKLSRPVA-NISDV--------------VLVHFGLSIAQLIDVDEKNQMMTTNVWVKQEWSDYKLRWNPEEYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAQLFHDGRIKWKPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDRAKIDLVSMDD--DVDQMDYWESGEWVIINAVGKYNTKKYECCTEIYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECAEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSSRTHRMPHWVRQLFLQLVPRYLF------MKRPP 356          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Cavefish
Match: chrna4b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:103025036])

HSP 1 Score: 216.853 bits (551), Expect = 1.231e-60
Identity = 132/382 (34.55%), Postives = 216/382 (56.54%), Query Frame = 1
Query:  382 KSWTEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILKTPPPVETIKTKQCINPSFLNKAPPKHLPSSDF 1527
            ++  E+ L+  L + Y+K SRPV  N++ V              V V FGLS+ Q++ +DE +Q++T+NV     W DY +RW P  Y+N+T + IP++ +W PDI +YN AD          A + +DG ++W P AI+KS+C + + +FPFD+Q CK+KFG WTYD  ++++   D+  ++DQ +Y  + EW +I    K+ T +Y CC E YPDI++  +++R   FY   LI+PC L+S LT+++F+LP+E   K+ L +++ ++  + ++L+ + IPS S   PLIG Y    M  +TLS  + +  +N H R      +P W+++L ++   R LF      +K PP       ++ I        P    PSS +
Sbjct:   24 RAHAEERLLQVLFSRYNKLSRPVA-NISDV--------------VLVHFGLSIAQLIDVDEKNQMMTTNVWVKQEWSDYKLRWNPEEYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAQLFHDGRIKWKPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDRAKIDLVSMDD--DVDQMDYWESGEWVIINAVGKYNTKKYECCTEIYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECAEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSSRTHRMPHWVRQLFLQLVPRYLF------MKRPPASGKRNCRKLIEMMHKPVMPQAISPSSQY 382          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Cavefish
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 211.075 bits (536), Expect = 4.770e-59
Identity = 144/457 (31.51%), Postives = 239/457 (52.30%), Query Frame = 1
Query:  391 TEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILKTPPPVETIKTKQCINPSFLNKAPPKHLPSSDFIDKTIQGAQFYDQFYQSNFPQRNQNSNIHYLHSNHMRNMFESSDVRNSRPNTPDCAADVPSVFDRYPTAESISGNEEE 1761
             E  L  +L +GY+K SRPV  N+T V              V V+FGLS+ Q++ +DE +Q++T+NV     W DY +RWKP  YDN+T + +P++ +W+PDI +YN AD          A + + G V W P AI+KS+C + + +FPFD+Q CK+KFG WTYD  ++++   +N  +L   +Y  + EW ++     + T +Y CC E YPDI++  +++R   FY   LI+PC L+S LT+++F+LP++   K+ L +++ ++  + ++L+ + IPS S   PLIG Y    M  +TLS  + +  +N H R  +  ++P W++ + +    R LF      +K P P +T +         LN    K +P                          NQ SN+    S+ ++   +  D+   + +       +P+ F  +PTA S+  +E E
Sbjct:   22 AEDQLFKKLFSGYNKWSRPV-RNITDV--------------VIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMTKAHLFHTGKVLWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLERIENTVDL--KDYWESGEWAIVNAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPGWVQSIFLGFIPRWLF------MKRPAPDQTRRRL------LLNAQEKKQVP--------------------------NQTSNLSTSRSSWLQQETD-VDIGRYQDSNGRAGMGIPASFS-FPTATSLHLSESE 421          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Cavefish
Match: ENSAMXT00000019858.2 (neuronal acetylcholine receptor subunit alpha-10 [Source:NCBI gene;Acc:103033580])

HSP 1 Score: 208.764 bits (530), Expect = 5.447e-59
Identity = 131/366 (35.79%), Postives = 209/366 (57.10%), Query Frame = 1
Query:  403 LINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV-DLGFILKTPPPVETIKTKQCINPSFLNKA 1497
            L+ +L   Y    RPV             E   +I  VT++  LS  QI+ +DE +QILT+ +     W D ++ W    YD +  + IP+ Y+W PDI +YN AD++     E + +I +DG + W   AI KS+C V + +FPFD Q C+L FG WT++G +++I   +     D  ++V NVEWE++   AK   + Y CC EPYPDI++ + ++R ++FY + L++PC ++S L  + F+LPA+S  K+ LG+ + +A  +  +L+ +S+P  S + PLIG YY   MT+IT ST L +  +N H  G + + VP W ++  + + ARI FV ++G    T P   T  T +  N  F+N++
Sbjct:   23 LLKDLFVNYSNAVRPV-------------EDTDNIINVTLQITLS--QIIDMDERNQILTTYLWIRQVWLDAYLTWNKADYDGLDTIRIPSSYVWRPDIVLYNNADDQFSSSMETNVVIHHDGQIMWDQPAISKSSCKVDVSFFPFDSQKCRLTFGSWTHNGNQMDIL--NGMDSADLADFVENVEWEVLGMPAKKNVILYGCCSEPYPDITYTLQLKRRASFYIFNLLIPCMMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMP-PSENVPLIGKYYIATMTMITASTALTIFIMNIHHCGSDAQPVPEWARRFILNYLARICFVYEVGESCLTVP---TETTSRRGNSCFVNES 367          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Cavefish
Match: chrna10a (cholinergic receptor, nicotinic, alpha 10a [Source:ZFIN;Acc:ZDB-GENE-060503-725])

HSP 1 Score: 208.379 bits (529), Expect = 8.862e-59
Identity = 125/337 (37.09%), Postives = 193/337 (57.27%), Query Frame = 1
Query:  403 LINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTE-LDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV 1410
            L+N+L   Y    RPV             E    I  VT++  LS  QI+ +DE +QILT+ +     W D ++ W    YD +  + IP  Y+W PDI +YN AD+      + + +I+YDG + W    I KS+C V + +FPFD Q C+L +G WTY+G +L+I    N  E  D  + V NVEWE++   AK   ++Y CC +PYPD+++ + ++R ++FY + L++PC ++S L  + F+LPA+S  K+ LG+ + +A  +  +L+ + +P  S + PLIG YY   MT+IT ST L +  +N H  G + K VP W K   +++ ARI FV
Sbjct:   18 LLNDLFRNYTSAMRPV-------------ENTNDILNVTLQITLS--QIIGMDERNQILTAYLWIRQVWTDAYLTWNKDDYDGLDTIRIPGSYVWRPDIVLYNSADDHFTGTMDTNVVIRYDGQIMWDSPIITKSSCKVDVSFFPFDAQQCRLTYGSWTYNGKQLDIL---NALESADLADLVDNVEWEVLGMPAKKNVIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIMPP-SENVPLIGKYYIATMTMITASTALTIFIMNIHHCGPDAKPVPEWAKTFILQYLARICFV 335          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Sea Lamprey
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 194.897 bits (494), Expect = 2.356e-54
Identity = 103/299 (34.45%), Postives = 181/299 (60.54%), Query Frame = 1
Query:  514 VTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV 1410
            V V F +S+ Q++KLDE++QI+ +N+   + W DY  +W P  ++ + ++ +P+  +W PDI +YN AD   +   +  A++KYDGTV W P AIFKS+C + + YFPFD Q C +KFG WTYD  ++++     K  L   ++  + EW +I        ++Y CC + YPDI++ + V+R   FY   LI+PC L+S LT+++F+LP++   K+ L +++ ++  + ++++ ++IPS S   PLIG Y    M  +TLS  + +  +N H+R      +P W++++ +    +I+ +
Sbjct:   33 VIVRFEVSMSQLVKLDEVNQIMATNLWLKHTWNDYKFQWNPGQFEGMEYIRVPSDKIWKPDIVLYNNADGDFQVEGKTKALLKYDGTVMWMPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVLVGTKINL--KDFWESGEWVIIDVPGYKHDIKYNCCEQIYPDITYSVYVRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLSISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITIFVLNVHYRTPEAHTMPNWVRRVFLDTLPKIMLL 329          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Sea Lamprey
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 179.489 bits (454), Expect = 3.310e-49
Identity = 112/342 (32.75%), Postives = 188/342 (54.97%), Query Frame = 1
Query:  394 EKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRA----KFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKE-VPFWLKKLTIKHGARIL 1404
            E  L+  +L  Y K  RPV D L+                V V+FGL + Q++ +DE +Q++T+NV     W D ++RW P  Y  I  + +P   +WLPDI +Y+ AD R E      A++K+DG ++W P AI+KS+C + + +FPFD+Q C +KFG WTYDG  +++   +  +++D+  Y  N EWE +        +    R+      YP I++  +++R   FY   LI+PC  LS LT+ +F+LP++   K+ L  ++ ++  + ++++E+ IPS+S   PLIG Y    M  +TLS  + +  +N H R  +    +  W+++L +    +IL
Sbjct:   35 EDRLLKRMLKDYQKWVRPV-DKLS--------------DTVEVKFGLGIAQLVDVDEKNQLMTTNVWLKQEWVDINLRWNPDDYGGINSIRVPASSIWLPDIVLYDNADGRFEGSIVTKAVVKHDGRIKWTPPAIYKSSCTIDVTFFPFDQQNCSMKFGSWTYDGTLVDLIMVN--SDVDRGEYFDNGEWEFLNATGNKGVRLDGHRF------YPYITYSFVIRRLPLFYTLFLIVPCLGLSFLTVFVFYLPSDEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIITVFVINVHHRSSSTHHPMAPWVRQLFLHKLPKIL 353          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Sea Lamprey
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 173.326 bits (438), Expect = 3.728e-46
Identity = 99/300 (33.00%), Postives = 171/300 (57.00%), Query Frame = 1
Query:  544 QIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILKTPPP 1443
             +   DE +Q++T+NV     W DY ++W P  Y+N+T + +P++ +W+PDI +YN AD          A + + G V W P AI+KS+C + + +FPFD+Q C +KFG WTYD  +  I       ++D  +Y  + EW ++     + T +Y CC + YPDI++  +++R   FY   LI+PC L+S LT+++F+LP++   K+ L +++ ++  + ++L+ + IPS S   PLIG Y    M  +TLS  + +  +N H R      +P W++++ +    R L      +++ PPP
Sbjct:    9 HLCDCDEKNQMMTTNVWLKQEWDDYKLQWDPAEYENVTSIRVPSELIWVPDIVLYNNADGDFAVTHMTKAHLFHTGRVRWKPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYD--KAKIDLVSMARDVDLKDYWESGEWAIVHAVGTYNTKKYDCCPQVYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPATHAMPRWVRRVFLDRVPRWL------VMRRPPP 300          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008550.1 (pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene:ENSPMAG00000007717.1 transcript:ENSPMAT00000008550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 157.532 bits (397), Expect = 7.798e-42
Identity = 81/234 (34.62%), Postives = 146/234 (62.39%), Query Frame = 1
Query:  682 LWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTI 1383
            +W PDI +YN ADER +     + ++ Y G  +  P  + KSTC + +++FPFD Q C LKFG WT+DG+ +++       E D + Y+AN EW+L++   K   + Y CC EPYPD+++ + ++R + +Y   L++PC L+S+L+L++F LPA+S  K+ LG+ + ++  + ++L+ + +P+ S S PLIG Y+   M ++  S  + +I + +H    + K++P W++ + +
Sbjct:   16 IWTPDILLYNSADERFDATFHTNVLVNYTGNCQHLPPGMLKSTCYIDVRWFPFDVQKCDLKFGSWTHDGWLIDLQML----EADTSGYIANGEWDLVEIPGKRNELYYDCCQEPYPDVTYTLTIRRRTLYYGLNLLVPCVLISALSLLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIGQYFASTMIIVAFSVVVTVIVLQYHHHNPDGKKMPQWVRVILL 245          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Sea Lamprey
Match: chrnb1l (cholinergic receptor, nicotinic, beta 1 (muscle) like [Source:ZFIN;Acc:ZDB-GENE-060811-1])

HSP 1 Score: 138.658 bits (348), Expect = 5.895e-35
Identity = 98/357 (27.45%), Postives = 183/357 (51.26%), Query Frame = 1
Query:  472 YRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFY--DNKTE-----LDQNNYVANVEWELI-KTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILKTPP--PVETIKTKQCINPSFLNKAPPKHL 1512
            Y+        +  +VTV  G++L Q++ L      +T +      W+D  + W P  YDN+  + +  K +WLPDI++ N  D   +       ++ Y G V W P +I++S+C +++KYFPFD Q C + F  +TYD   +N+ +   +++ E     +D++ +  + EW++  K   K T  R P     Y DI+F+++++R   FY   +++PC L++   +  F+LP ++  KM L +++ +A  + ++LL   +P  S   P+I  Y    M ++T    L +I +N HFR      +P+W++++ I    + L+++     +  P  PV T   + C +  F+   P + L
Sbjct:   37 YKTLVRPARTATGRVTVRLGMTLSQLISLPACQPDMTLSRLISLSWEDPRLSWDPRNYDNLRSIRLSPKRVWLPDIALSNNNDGNFDFGLYVHVLVDYTGAVRWVPPSIYRSSCGMQVKYFPFDWQNCSMVFQSFTYDTSEINLEYALDEHRQEIRHIIIDESTFPVSGEWQIKHKPSRKNTNPRDPL----YQDITFYLIMERKPLFYIINIVVPCILITICAVFTFYLPPDAGEKMGLCISVLLALTVFLLLLADKVPETSLGVPVIVNYLMFTMVIVTACVILTVIVLNLHFRSPATHIMPYWVRRIFIHSLPKYLWIERPKKEELAPKLPVLTQHQQHCHDEYFIRTPPSQAL 389          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Nematostella
Match: EDO42054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J7])

HSP 1 Score: 189.889 bits (481), Expect = 1.565e-52
Identity = 120/354 (33.90%), Postives = 190/354 (53.67%), Query Frame = 1
Query:  346 YQEKLSIKNHPEKSWTEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERME---ERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGAR 1398
            + E    +    +   EK L+ +L   YD   RPV ++                 +V VEF LSLIQI+ ++   Q++T +V    +W +  + W    Y  I  V++    +W+PDI +YN ADE      E+ +   I   DGT EW+  A F STC + ++YFPFD Q C LKFG WTY G RL +T   +  +L +  YV N EW L+   AK   V Y CC  P+ D++ ++ +QR   +Y + LI+PC L+++LTL+ F+LP ES  K+ LG+ + +A  + ++L+ +++PS S   PL+G Y+   M +  +S     + +NF  R  +   +P W+K + + + AR
Sbjct:   22 FSESSRKRRGASRETAEKRLLADLFRNYDSEVRPVFND---------------SDKVNVEFSLSLIQIIAVNSKSQLVTVSVWIRQKWTNPMLAWNTSKYGGIESVNLNPAKVWIPDIILYNNADETYAGGLEKYKTSVIASSDGTQEWNSPASFTSTCNINVRYFPFDSQNCSLKFGSWTYVGNRLTMTSTSDSADLSK--YVNNGEWHLLAMPAKLNRVFYNCCKYPFYDVTLYLEIQRKPLYYVFNLIIPCALIATLTLIKFFLPPESGEKVGLGITVLLAMTVFLLLVAETLPSTSDHIPLLGQYFVATMFVTAISLVATCLILNFFHRNPSTSPMPHWVKVIILDYMAR 358          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Nematostella
Match: EDO43642 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY59])

HSP 1 Score: 179.489 bits (454), Expect = 1.150e-50
Identity = 110/306 (35.95%), Postives = 174/306 (56.86%), Query Frame = 1
Query:  394 EKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERME---ERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTF 1302
            E  L+ +L + Y+   RPV+               ++   VTV+ G+SL QI+ LDE +QIL SN+    +W +  + W P  + N+T +++    +W PD+ +YN AD   +   +R      +K+DG+  W    IFKSTC   + YFPFD Q C LKFG WTYDG RLNI   +N T++  + +V+N EWEL    A    + Y CC+EPYPD++F + ++R + FY   +++PCFL++ LTL+ + LP ES  ++ L +   +A  + ++L+ + +P  +   PLI  YY   M ++T+  F
Sbjct:    2 ENKLLKDLFSNYNPSVRPVL---------------KATSSVTVQLGVSLHQIIDLDERNQILISNLWVRQKWNNPLLTWDPTHFGNLTSINVDPLRVWRPDLILYNNADRDTDGALDRFYTKVQLKFDGSSLWLAPIIFKSTCKFDVAYFPFDEQSCILKFGSWTYDGLRLNIV-PENGTDIGIDKFVSNGEWELTGVSANRNVMFYDCCVEPYPDVTFTLKIRRLTLFYYMNMLIPCFLITGLTLLSYILPPESGERITLVVTSLLAQAVYLLLVSEIMPPVAEVVPLISIYYTTAMFMVTVFKF 291          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Nematostella
Match: EDO44896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUG1])

HSP 1 Score: 178.333 bits (451), Expect = 4.018e-48
Identity = 109/344 (31.69%), Postives = 186/344 (54.07%), Query Frame = 1
Query:  394 EKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERME---ERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFR--GDNRKEVPFWLKKLTIKHGARILFV 1410
            E  L+ +LL GY+K + PV     P+        N++  Q  V FGL L+Q++ +D+ +QI+T+NV    RW +  ++W P  Y  IT V I    +W+PDI +YN AD       E+ +   I+ +DG   W+  A F+STC + + +FPFD+Q C +KFG WT++   L+I  + +K+ L  + Y+ + EW+LI    K     Y CC  P+ D++   + +R   FY + LI+PC +++ + L+ F LP ES  ++ L + + +A  + + L  +++P  S + P++G +Y   M  + LS       ++ H +  G     VP W++   + +  +IL V
Sbjct:   12 EHTLLGDLLKGYNKDAHPV-----PIL-------NKT--QYMVTFGLELVQLVNVDDKNQIITTNVWVRQRWTNLLLKWDPDKYGGITRVRIDASKIWIPDIVLYNSADSEFSGGLEKYKTRVILNHDGVNAWYSPASFRSTCQIDVTFFPFDQQTCFMKFGSWTFEVVDLDI--FADKSPLHSSQYMKSAEWDLIAASKKRNVEYYACCTYPFSDVTVTWVFRRKPLFYVFNLIVPCLIITGMVLLGFMLPPESGERITLSITVLLAMAVFLQLAAENLPRNSDNVPVLGIFYITVMVEVALSLIATCYVLHIHHKNSGIAVVPVPHWVQVYMLGYLGKILGV 339          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Nematostella
Match: EDO47969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKU6])

HSP 1 Score: 170.244 bits (430), Expect = 6.788e-47
Identity = 105/345 (30.43%), Postives = 184/345 (53.33%), Query Frame = 1
Query:  394 EKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERME---ERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRK---EVPFWLKKLTIKHGARILFV 1410
            E+ LI++LL GY + +RPV+++            N +++   V FG+ ++QI+ ++  +QI+ +NV    RW +  + W P  Y+ +  V +  K +W+PDI +Y+ AD       E+ +   II  DG+  W   A F+STC + + YFPFD Q C +KFG WTY    ++I    +   +  + Y+ + EW+L+       +  Y CC EP  D++  + ++R   FY + LI PC ++ ++ L+ F+LP ES  ++ L + + +A  + + L+ +++P  S S PL+G +Y   MT I +S       +N H R        E+P W+  + ++  A +L V
Sbjct:    1 EQRLISDLLQGYSRNARPVLNS------------NHTLK---VFFGMEIVQIVNVENRNQIIQTNVWIRQRWDNELLTWHPSNYEGVQTVRLDAKSVWIPDIVLYDSADSVFSGGHEKYKTHVIISKDGSSAWFSPASFRSTCKIDVTYFPFDEQTCYMKFGSWTYTIADVDIQ--ASPAPVKSSKYLKSAEWDLMSATTSRKSQIYACCPEPISDVTIAMTIRRKPLFYAFNLITPCMIMLTMILLGFFLPPESGERITLSITVLLAMAVFLQLVAETLPRNSESIPLLGRFYITIMTEIAVSLMATCWVLNIHHRNSGTTLVVEMPKWVDVIVLRWLAVVLCV 328          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Nematostella
Match: EDO40862 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S622])

HSP 1 Score: 161.77 bits (408), Expect = 2.083e-44
Identity = 103/314 (32.80%), Postives = 174/314 (55.41%), Query Frame = 1
Query:  394 EKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADE---RMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNF 1326
            E+ L+ +L   Y K +RP +++  P                 V F   L QI+ L + +Q+L   +    +W++  + W P  Y  +  +++  + +W+PDI IYN A++    +  + + D +I+ +GT  W   A+F +TC + ++YFPFD Q C LKFG WT+D  RL++    N +  +++ Y  + EW+L+    K     Y CC +PY DIS+ + ++R S FY+  LILP  L++S+ LV F LP ES  +M LG+ + +A  + +  + +++PS S S PL+G +Y + M LI+LS     I +N+
Sbjct:    1 EQRLLRDLFQNYSKYARPSIESDAPA---------------IVTFRAKLKQIVDLKDNEQLLKIILYNYMQWENPILTWDPRDYGGVQEINVAPEEVWVPDIVIYNSAEDVLGGLTHKYKTDVVIQANGTNIWLAPAMFLTTCQLDVRYFPFDEQKCLLKFGSWTHDSSRLDMRTQTNGS--NKDIYTEHGEWQLVGVEQKRNVKYYDCCPKPYVDISYTVHIRRKSLFYSLYLILPALLITSMVLVGFHLPPESGERMQLGITVLLAMIVFLQFVYQNLPSTSDSAPLLGKFYIVMMFLISLSLGCTCIILNY 297          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Medaka
Match: CHRNA9 (neuronal acetylcholine receptor subunit alpha-9-II-like [Source:NCBI gene;Acc:101173314])

HSP 1 Score: 211.846 bits (538), Expect = 2.563e-60
Identity = 128/336 (38.10%), Postives = 193/336 (57.44%), Query Frame = 1
Query:  403 LINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV 1410
            L+N+L+  Y    RPV             E   S   VT++  LS  QI  +DE +Q+L + +     W D +++W    YD +  +HIP+  +W PD+ +YN AD+      + +  ++Y+G + W   AI KS+C V + YFPFD Q C L FG WTY+G +++I  Y      D +++V NVEWE     A    + Y CC +PYPDI++ +L+QR S+FY + L+LPCFL+S L  + F+LPA+S  K+ LG+ + +A  +  +++ +S+P  S S PLIG YY   MT++T ST L +  +N HF G   K VP W K L I + ++I FV
Sbjct:   27 LLNDLMENYSNALRPV-------------EDTDSALNVTLQVTLS--QIKDMDERNQVLIAYLWIRQTWHDAYLKWNKDDYDGLDVIHIPSSLVWRPDLVLYNKADDDFSGPMDTNVKLRYNGEITWDAPAITKSSCVVDVSYFPFDSQECNLTFGSWTYNGNQVDI--YMGMDSGDLSDFVENVEWECHGMPATKNVIMYGCCSDPYPDITYTVLLQRRSSFYIFNLLLPCFLISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLMVAESMP-PSESVPLIGKYYIATMTMVTASTALTIFIMNIHFCGAEAKPVPHWAKVLIIDYMSKIFFV 344          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Medaka
Match: chrna4b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:101158195])

HSP 1 Score: 214.157 bits (544), Expect = 4.120e-59
Identity = 127/364 (34.89%), Postives = 207/364 (56.87%), Query Frame = 1
Query:  382 KSWTEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILKTPPPVETIKTKQCI 1473
            ++  E+ L+  L   Y+K SRPV          NT++       V V FGLS+ Q++ +DE +Q++T+NV     W DY +RW P  Y+N+T + IP++ +W PDI +YN AD          A + YDG ++W P AI+KS+C + + +FPFD+Q CK+KFG WTYD  R  I      +++DQ +Y  + EW ++    K+ T +Y CC E Y DI+++ +++R   FY   LI+PC L+S LT+++F+LP++   K+ L +++ ++  + ++L+ + IPS S   PLIG Y    M  +TLS  + +  +N H R      +P W++++ +    R+LF      +K PP       K+ I
Sbjct:   41 RAHAEERLLQNLFARYNKLSRPVQ---------NTSD------TVLVHFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPEDYENVTSIRIPSEIIWRPDIVLYNNADGDFAVTHLTKAHLFYDGQIKWMPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTYD--RAKIDLISMASDVDQMDYWESGEWVIVNAVGKYNTKKYECCAEIYADITYYFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSQCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMVFVTLSIIITIFVLNVHHRSPQTHGMPHWVRRVFLDLVPRVLF------MKRPPGTAKQHCKRLI 381          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Medaka
Match: chrna2b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:101155076])

HSP 1 Score: 210.69 bits (535), Expect = 6.921e-59
Identity = 124/340 (36.47%), Postives = 200/340 (58.82%), Query Frame = 1
Query:  391 TEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV 1410
             E+ L   L  GY+K SRPV  N++ V              V V+FGLS+ Q++ +DE +Q++T+NV     W DY +RWKP  YDN+T + +P++ +W+PDI +YN AD          A + + G V W P AI+KS+C + + +FPFD+Q CK+KFG WTYD  ++++   +N  +L  NNY  + EW +I     + T +Y CC E YPDI++  +++R   FY   LI+PC L+S LT+++F+LP++   K+ L +++ ++  + ++L+ + IPS S   PLIG Y    M  +TLS  + +  +N H R  +  ++P W+  + +    R LF+
Sbjct:   43 AEEELFQTLFTGYNKWSRPV-PNISDV--------------VIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMTKAHLFHTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLERIENTVDL--NNYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPRWVHTVFLDLIPRWLFM 365          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Medaka
Match: chrna2b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:101155076])

HSP 1 Score: 210.69 bits (535), Expect = 6.921e-59
Identity = 124/340 (36.47%), Postives = 200/340 (58.82%), Query Frame = 1
Query:  391 TEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV 1410
             E+ L   L  GY+K SRPV  N++ V              V V+FGLS+ Q++ +DE +Q++T+NV     W DY +RWKP  YDN+T + +P++ +W+PDI +YN AD          A + + G V W P AI+KS+C + + +FPFD+Q CK+KFG WTYD  ++++   +N  +L  NNY  + EW +I     + T +Y CC E YPDI++  +++R   FY   LI+PC L+S LT+++F+LP++   K+ L +++ ++  + ++L+ + IPS S   PLIG Y    M  +TLS  + +  +N H R  +  ++P W+  + +    R LF+
Sbjct:   43 AEEELFQTLFTGYNKWSRPV-PNISDV--------------VIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMTKAHLFHTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLERIENTVDL--NNYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPRWVHTVFLDLIPRWLFM 365          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Medaka
Match: chrna10a (neuronal acetylcholine receptor subunit alpha-9-like [Source:NCBI gene;Acc:101158786])

HSP 1 Score: 206.453 bits (524), Expect = 2.872e-58
Identity = 126/339 (37.17%), Postives = 197/339 (58.11%), Query Frame = 1
Query:  397 KVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTE-LDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFV 1410
            K L+ +L++ Y K   PV             E    I  VT++  LS  QI+ +DE +QILT+ +     W D H++W    +D +  + IP  Y+W PDI +YN AD+R     + + +I++DG + W    I KS+C V + +FPFD Q C+  +G WTY+G +L+I    N  E  D  + V NVEWE++   AK   V Y CC +PYPD++F + ++R ++FY + L++PC ++S L  + F+LPA+S  K+ LG+ + +A  +  +L+ + +P  S + PLIG YY   MT+IT ST L +  +N H  G + K VP W KK+ +++ AR+ FV
Sbjct:   22 KKLLTDLMSNYTKALIPV-------------EDTNIILNVTLQVTLS--QIIDMDERNQILTAYLWIRQVWFDAHLKWNKEDFDGLDTIRIPGSYVWRPDIVLYNSADDRFTGPMDTNVVIRHDGQMMWDSPYITKSSCKVDVSFFPFDAQQCRFTYGSWTYNGNQLDI---QNAMESADLADLVENVEWEVLGMPAKKNIVLYGCCADPYPDVTFTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIMPP-SENVPLIGKYYIATMTMITASTALTIFIMNIHHCGPDAKPVPKWAKKVILQYMARVCFV 341          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Planmine SMEST
Match: SMESG000040082.1 (SMESG000040082.1)

HSP 1 Score: 1311.98 bits (3394), Expect = 0.000e+0
Identity = 679/679 (100.00%), Postives = 679/679 (100.00%), Query Frame = 1
Query:  277 MHFHRDQTIIIGFVFLLKCLRCQYQEKLSIKNHPEKSWTEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILKTPPPVETIKTKQCINPSFLNKAPPKHLPSSDFIDKTIQGAQFYDQFYQSNFPQRNQNSNIHYLHSNHMRNMFESSDVRNSRPNTPDCAADVPSVFDRYPTAESISGNEEELDDDLDFRQQQPGNXXXXXXXXXXXXXXXCIQSPIPSQLAASWASYNSAGDFSNSFKQPGHEMGLHSRCQPAFDLKCNPNFEKPILNQHSVAPINVFVARRINLVTKDISDIIKDLTFIQKTNENKERVNKIVSEWRAVGLVLDRFFFMLYVIAIILSLILFFPKAGNDPYYELDNSLNCEISS 2313
            MHFHRDQTIIIGFVFLLKCLRCQYQEKLSIKNHPEKSWTEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYILILPCFLLSSLTLVLFWLPAESPAKMVLGMNIFIAFFLLVVLLEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILKTPPPVETIKTKQCINPSFLNKAPPKHLPSSDFIDKTIQGAQFYDQFYQSNFPQRNQNSNIHYLHSNHMRNMFESSDVRNSRPNTPDCAADVPSVFDRYPTAESISGNEEELDDDLDFRQQQPGNYFKEYEEDLEEFLTECIQSPIPSQLAASWASYNSAGDFSNSFKQPGHEMGLHSRCQPAFDLKCNPNFEKPILNQHSVAPINVFVARRINLVTKDISDIIKDLTFIQKTNENKERVNKIVSEWRAVGLVLDRFFFMLYVIAIILSLILFFPKAGNDPYYELDNSLNCEISS
Sbjct:    1 MHFHRDQTIIIGFVFLLKCLRCQYQEKLSIKNHPEKSWTEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYILILPCFLLSSLTLVLFWLPAESPAKMVLGMNIFIAFFLLVVLLEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILKTPPPVETIKTKQCINPSFLNKAPPKHLPSSDFIDKTIQGAQFYDQFYQSNFPQRNQNSNIHYLHSNHMRNMFESSDVRNSRPNTPDCAADVPSVFDRYPTAESISGNEEELDDDLDFRQQQPGNYFKEYEEDLEEFLTECIQSPIPSQLAASWASYNSAGDFSNSFKQPGHEMGLHSRCQPAFDLKCNPNFEKPILNQHSVAPINVFVARRINLVTKDISDIIKDLTFIQKTNENKERVNKIVSEWRAVGLVLDRFFFMLYVIAIILSLILFFPKAGNDPYYELDNSLNCEISS 679          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Planmine SMEST
Match: SMESG000071641.1 (SMESG000071641.1)

HSP 1 Score: 407.527 bits (1046), Expect = 1.558e-132
Identity = 214/344 (62.21%), Postives = 273/344 (79.36%), Query Frame = 1
Query:  385 SWTEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDL 1416
             WTEK+LI +L   YDKRSRPVVD ++ + R++    N ++QQ+TVEFG +LIQI+ L+EMDQ+LT++ R+L+RW D ++ W P +Y NI+ V++P   LW+PDIS+YNYADER+EERR CDA I  DGTV+W PMAI+KSTC V IKYFPFD Q C LKFGPWTYDG+R+NITFY N   +D  N++ + EW+++ TRA  T ++YPCC E YPDI F+I ++R  AFY YILILPCFLLSSLTLVLFWLP ESPAKMVLGMNIF+AFFLL++LLE + PSASS+FPLIGTYYC+NM LIT S+F+  + VNFHFRGDN+++VP W+KK+     A++L V L
Sbjct:   17 GWTEKILIRDLFENYDKRSRPVVDGISKLSRVS---ENYTVQQITVEFGFNLIQILDLNEMDQVLTTSTRSLFRWTDPNLVWTPEMYGNISVVNVPADMLWIPDISLYNYADERLEERRSCDAKIYPDGTVDWQPMAIYKSTCSVNIKYFPFDEQTCWLKFGPWTYDGYRVNITFYGNNPNMDLTNFITSPEWKVLATRANHTEIKYPCCPEIYPDIKFYIWIKRQPAFYTYILILPCFLLSSLTLVLFWLPPESPAKMVLGMNIFVAFFLLLLLLEDTTPSASSNFPLIGTYYCLNMGLITFSSFVSCLIVNFHFRGDNKRQVPNWIKKVLFLFIAKLLCVKL 357          

HSP 2 Score: 58.151 bits (139), Expect = 2.351e-8
Identity = 26/63 (41.27%), Postives = 40/63 (63.49%), Query Frame = 1
Query: 2074 VTKDISDIIKDLTFIQKTNENKERVNKIVSEWRAVGLVLDRFFFMLYVIAIILSLILFFPKAG 2262
            ++  I DI+K+L F+Q  +  +E       EW+AVGLV+DR FF  Y+  I+LS+  +FP+ G
Sbjct:  484 ISNHIRDIVKNLRFLQNLHHVREISQITEMEWQAVGLVVDRVFFFCYIFIIVLSMASYFPRDG 546          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Planmine SMEST
Match: SMESG000071641.1 (SMESG000071641.1)

HSP 1 Score: 388.652 bits (997), Expect = 2.454e-125
Identity = 210/344 (61.05%), Postives = 264/344 (76.74%), Query Frame = 1
Query:  385 SWTEKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDL 1416
             WTEK+LI +L   YDKRSRPVVD ++ + R++    N ++QQ+TVEFG +LIQI+ L+EMDQ          RW D ++ W P +Y NI+ V++P   LW+PDIS+YNYADER+EERR CDA I  DGTV+W PMAI+KSTC V IKYFPFD Q C LKFGPWTYDG+R+NITFY N   +D  N++ + EW+++ TRA  T ++YPCC E YPDI F+I ++R  AFY YILILPCFLLSSLTLVLFWLP ESPAKMVLGMNIF+AFFLL++LLE + PSASS+FPLIGTYYC+NM LIT S+F+  + VNFHFRGDN+++VP W+KK+     A++L V L
Sbjct:   25 GWTEKILIRDLFENYDKRSRPVVDGISKLSRVS---ENYTVQQITVEFGFNLIQILDLNEMDQ----------RWTDPNLVWTPEMYGNISVVNVPADMLWIPDISLYNYADERLEERRSCDAKIYPDGTVDWQPMAIYKSTCSVNIKYFPFDEQTCWLKFGPWTYDGYRVNITFYGNNPNMDLTNFITSPEWKVLATRANHTEIKYPCCPEIYPDIKFYIWIKRQPAFYTYILILPCFLLSSLTLVLFWLPPESPAKMVLGMNIFVAFFLLLLLLEDTTPSASSNFPLIGTYYCLNMGLITFSSFVSCLIVNFHFRGDNKRQVPNWIKKVLFLFIAKLLCVKL 355          

HSP 2 Score: 58.151 bits (139), Expect = 2.345e-8
Identity = 26/63 (41.27%), Postives = 40/63 (63.49%), Query Frame = 1
Query: 2074 VTKDISDIIKDLTFIQKTNENKERVNKIVSEWRAVGLVLDRFFFMLYVIAIILSLILFFPKAG 2262
            ++  I DI+K+L F+Q  +  +E       EW+AVGLV+DR FF  Y+  I+LS+  +FP+ G
Sbjct:  482 ISNHIRDIVKNLRFLQNLHHVREISQITEMEWQAVGLVVDRVFFFCYIFIIVLSMASYFPRDG 544          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Planmine SMEST
Match: SMESG000015256.1 (SMESG000015256.1)

HSP 1 Score: 288.115 bits (736), Expect = 2.888e-87
Identity = 159/235 (67.66%), Postives = 193/235 (82.13%), Query Frame = 1
Query:  715 ADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKKLTIKHGARILFVDLG 1419
            ADER+EERR C A I  DGTVEW PMAI+KSTC V IKYFPFD Q C LKFGPWTYDGFR+NITFY+N++ LD ++ V + EW ++++ A  T VRYPCC EPYPDISF++ ++R+  FY YILILPCFLLSSLTLVLFW+P ESPAKMVLGMNIF+AFFL+++LL+ + PSAS +FPLIGTYYC+NM +ITLSTFL  I VN HFRGDNR+EVP+WLKKL   +  + L ++LG
Sbjct:    3 ADERLEERRPCAAKISSDGTVEWQPMAIYKSTCFVNIKYFPFDIQTCWLKFGPWTYDGFRVNITFYNNESFLDLSSLVPSPEWTILQSWANHTEVRYPCCDEPYPDISFYVKIRRSPMFYTYILILPCFLLSSLTLVLFWMPPESPAKMVLGMNIFVAFFLMLLLLQDTTPSASRNFPLIGTYYCVNMGIITLSTFLSCIVVNLHFRGDNRQEVPYWLKKLVFNYAVKFLCINLG 237          

HSP 2 Score: 78.1814 bits (191), Expect = 1.214e-14
Identity = 34/63 (53.97%), Postives = 46/63 (73.02%), Query Frame = 1
Query: 2074 VTKDISDIIKDLTFIQKTNENKERVNKIVSEWRAVGLVLDRFFFMLYVIAIILSLILFFPKAG 2262
            + KD+  I+K L +IQK  ENKE V++I SEWR+VGLVLDR FF  Y+  +I S+I++FPK  
Sbjct:  473 ICKDVKVIVKSLKYIQKLQENKENVSRIFSEWRSVGLVLDRIFFYCYLFTVIFSIIMYFPKTN 535          
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Planmine SMEST
Match: SMESG000069967.1 (SMESG000069967.1)

HSP 1 Score: 261.536 bits (667), Expect = 2.512e-77
Identity = 155/327 (47.40%), Postives = 213/327 (65.14%), Query Frame = 1
Query:  394 EKVLINELLNGYDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQILTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADERMEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPWTYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPYPDISFHILVQRNSAFYNYXXXXXXXXXXXXXXXXXXXXAESPAKMVLGMNIFIAXXXXXXXXEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNFHFRGDNRKEVPFWLKK 1374
            EK LI ++L  Y K+ +           I    RN     V V++GL+LIQIM LDE +QILT NV   Y W D  + W P  + N+  V +P   +W PDI +YNYADER+ E+R+    + Y G + W P AIFKSTC + I  FPFD Q C LKFG WTY G +L+I  Y+N +E+D  +Y  + EW ++   A+   ++        PD++F ++++RNSA++ Y+L++PC LLS LTLV+FWLP ESPAKM+LGMNIF+AF LL+ LL ++ PSAS+S P +G YYC+NM LITLSTFL +I +N +FR D R+ +P WL+K
Sbjct:    4 EKKLITKMLKDYKKKGK-----------IGRPVRNVQ-DTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYLLVVPCVLLSLLTLVIFWLPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMILITLSTFLSIIVINLYFRCDKRRNLPDWLRK 318          

HSP 2 Score: 55.4546 bits (132), Expect = 1.295e-7
Identity = 28/64 (43.75%), Postives = 40/64 (62.50%), Query Frame = 1
Query: 2071 LVTKDISDIIKDLTFIQKTNENKERVNKIVSEWRAVGLVLDRFFFMLYVIAIILS-LILFFPKA 2259
            L+ K++S+I K L  +      K+R N+I  EWR V +VLDR FF +Y + +ILS LIL  P+ 
Sbjct:  471 LLEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVILSGLILLLPRG 534          
The following BLAST results are available for this feature:
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA92.069e-5937.35cholinergic receptor nicotinic alpha 9 subunit [So... [more]
CHRNA101.377e-5736.90cholinergic receptor nicotinic alpha 10 subunit [S... [more]
CHRNA41.151e-5634.29cholinergic receptor nicotinic alpha 4 subunit [So... [more]
CHRNA22.703e-5533.99cholinergic receptor nicotinic alpha 2 subunit [So... [more]
CHRNA25.773e-5533.99cholinergic receptor nicotinic alpha 2 subunit [So... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acr-217.081e-6336.80pep chromosome:WBcel235:III:6583461:6586549:1 gene... [more]
acr-211.167e-6236.58pep chromosome:WBcel235:III:6583461:6586549:1 gene... [more]
acr-211.187e-6236.80pep chromosome:WBcel235:III:6581927:6586549:1 gene... [more]
acr-212.235e-6236.58pep chromosome:WBcel235:III:6581927:6586549:1 gene... [more]
unc-631.428e-5033.33Acetylcholine receptor subunit alpha-type unc-63 ... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nAChRalpha29.258e-6236.71gene:FBgn0000039 transcript:FBtr0084639[more]
nAChRalpha29.258e-6236.71gene:FBgn0000039 transcript:FBtr0084640[more]
nAChRalpha51.415e-5634.97gene:FBgn0028875 transcript:FBtr0300594[more]
nAChRalpha51.415e-5634.97gene:FBgn0028875 transcript:FBtr0080594[more]
nAChRalpha51.415e-5634.97gene:FBgn0028875 transcript:FBtr0309867[more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna4b3.509e-6135.47cholinergic receptor, nicotinic, alpha 4b [Source:... [more]
chrna10a3.796e-6037.07cholinergic receptor, nicotinic, alpha 10a [Source... [more]
chrna10a4.283e-6037.07cholinergic receptor, nicotinic, alpha 10a [Source... [more]
CR388402.11.676e-5933.33cholinergic receptor, nicotinic, alpha 9 [Source:N... [more]
chrna92.268e-5933.33cholinergic receptor, nicotinic, alpha 9 [Source:Z... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA26.954e-6230.62cholinergic receptor, nicotinic alpha 2 [Source:NC... [more]
prepl9.521e-6237.80prolyl endopeptidase-like [Source:Xenbase;Acc:XB-G... [more]
CHRNA21.526e-6130.95cholinergic receptor, nicotinic alpha 2 [Source:NC... [more]
CHRNA91.409e-5935.96cholinergic receptor, nicotinic alpha 9 [Source:NC... [more]
CHRNA92.854e-5935.96cholinergic receptor, nicotinic alpha 9 [Source:NC... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chrna96.117e-6134.63cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna44.588e-5834.86cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna45.922e-5834.86cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna103.686e-5636.01cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna61.852e-5533.82cholinergic receptor, nicotinic, alpha polypeptide... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9I8C7|ACH10_CHICK7.792e-6138.28Neuronal acetylcholine receptor subunit alpha-10 O... [more]
sp|P17644|ACH2_DROME9.280e-6136.71Acetylcholine receptor subunit alpha-like 2 OS=Dro... [more]
sp|P23414|ACH1_SCHGR1.207e-6035.94Acetylcholine receptor subunit alpha-L1 OS=Schisto... [more]
sp|P43144|ACHA9_RAT2.839e-6034.63Neuronal acetylcholine receptor subunit alpha-9 OS... [more]
sp|Q9UGM1|ACHA9_HUMAN9.936e-5937.35Neuronal acetylcholine receptor subunit alpha-9 OS... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8H1Z47.668e-13258.96Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267E1801.139e-13058.27Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F2A91.173e-13058.27Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4E0RKE55.185e-13064.02Acetylcholine-gated chloride channel subunit OS=Fa... [more]
G4M0G92.993e-12951.57Acetylcholine-gated chloride channel subunit OS=Sc... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna4b5.473e-6235.47neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrna4b1.231e-6034.55neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrna2a4.770e-5931.51cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
ENSAMXT00000019858.25.447e-5935.79neuronal acetylcholine receptor subunit alpha-10 [... [more]
chrna10a8.862e-5937.09cholinergic receptor, nicotinic, alpha 10a [Source... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna32.356e-5434.45cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
chrnb3b3.310e-4932.75cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
chrna2a3.728e-4633.00cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
ENSPMAT00000008550.17.798e-4234.62pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene... [more]
chrnb1l5.895e-3527.45cholinergic receptor, nicotinic, beta 1 (muscle) l... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420541.565e-5233.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436421.150e-5035.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448964.018e-4831.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479696.788e-4730.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408622.083e-4432.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA92.563e-6038.10neuronal acetylcholine receptor subunit alpha-9-II... [more]
chrna4b4.120e-5934.89neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrna2b6.921e-5936.47neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrna2b6.921e-5936.47neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrna10a2.872e-5837.17neuronal acetylcholine receptor subunit alpha-9-li... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040082.10.000e+0100.00SMESG000040082.1[more]
SMESG000071641.11.558e-13262.21SMESG000071641.1[more]
SMESG000071641.12.454e-12561.05SMESG000071641.1[more]
SMESG000015256.12.888e-8767.66SMESG000015256.1[more]
SMESG000069967.12.512e-7747.40SMESG000069967.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021617 ID=SMED30021617|Name=Neuronal acetylcholine receptor subunit alpha-2|organism=Schmidtea mediterranea sexual|type=transcript|length=2544bp
CTAATTTTAAACCAGGCTTTTTTTCATAGAAAGAAAACTAATAACCATAA
TAATAATAAAAATAATATAAATTTTTCTCGAGGTCAATTATTAAAAGAAA
AAAGTCGAAAAGATATTCTATTCAAAAATGGGGAATCTATTTTTGGAATA
ATATTTAAATGAGCTTTCTAAATGGGAATTTCTAGATTTGGATTTACATT
TATGCCGATATTGAAACAAAAAGATTGATACTGCTCAAGGTATCACTGTT
GTTCTTTTTTTTGAAACACCAAACCCATGCATTTTCACCGTGATCAAACG
ATTATTATAGGATTTGTATTTTTGCTCAAATGTCTCAGATGTCAATATCA
GGAGAAATTGAGTATCAAAAACCATCCGGAAAAATCCTGGACAGAGAAAG
TTTTAATTAACGAATTGCTCAACGGTTATGACAAGAGGTCACGGCCTGTT
GTGGACAACTTGACCCCTGTTTATCGAATAAACACTGCCGAAAGAAATCA
GTCAATTCAACAGGTTACGGTGGAATTCGGATTAAGTCTTATTCAAATAA
TGAAACTTGATGAGATGGACCAGATTCTCACGAGTAATGTCAGGACCCTT
TACAGATGGAAAGATTATCATATGCGATGGAAGCCTCATTTATATGATAA
TATCACGCATGTTCATATTCCTACGAAATATTTGTGGCTTCCGGATATAT
CAATTTATAACTATGCGGACGAAAGAATGGAAGAAAGACGAGAATGTGAC
GCTATTATCAAATACGACGGCACAGTTGAATGGCACCCGATGGCTATTTT
CAAATCTACATGTCCAGTGCGGATAAAATATTTCCCATTTGATCGACAAT
GCTGCAAACTGAAGTTTGGCCCGTGGACATACGATGGATTTCGTCTCAAT
ATCACGTTCTATGACAATAAAACTGAACTCGATCAAAATAATTACGTAGC
AAATGTTGAATGGGAATTGATCAAAACTAGGGCAAAGTTTACCACTGTCA
GATATCCTTGCTGTTTAGAACCTTATCCTGATATTAGTTTTCATATTTTA
GTACAGAGAAACTCAGCGTTTTACAACTATATTCTTATTCTTCCTTGTTT
TCTTCTGTCTTCATTAACTCTTGTTTTATTTTGGCTTCCTGCTGAAAGTC
CAGCAAAAATGGTGCTAGGAATGAATATATTTATCGCATTTTTTCTTCTG
GTGGTTCTGCTCGAGAAATCTATTCCCTCGGCATCAAGTTCGTTTCCGTT
AATAGGTACCTACTACTGTATAAACATGACACTGATCACTTTGTCAACTT
TTCTTTGTTTGATCACAGTAAACTTTCACTTTAGAGGTGACAATCGGAAG
GAAGTTCCATTTTGGTTGAAAAAACTGACAATAAAGCATGGAGCTAGGAT
TCTGTTTGTAGATTTGGGATTTATATTGAAAACCCCTCCACCTGTAGAGA
CAATCAAGACTAAACAATGCATCAATCCTTCTTTCTTAAATAAAGCACCG
CCAAAACACCTTCCATCCTCAGATTTTATTGATAAAACAATACAGGGAGC
TCAGTTCTATGATCAATTTTATCAATCTAATTTTCCACAGCGAAATCAAA
ATTCAAATATTCACTATTTACACAGTAATCACATGAGAAACATGTTCGAA
TCTTCTGACGTGAGGAATAGTCGACCGAATACTCCTGACTGCGCTGCGGA
TGTTCCTTCTGTGTTCGATCGATATCCTACTGCTGAAAGCATTAGTGGAA
ATGAAGAGGAGCTCGATGATGACCTTGATTTTAGGCAACAACAACCTGGG
AATTATTTCAAAGAATATGAAGAAGACTTAGAAGAATTTCTTACAGAATG
TATTCAGTCTCCAATTCCGAGTCAATTGGCGGCCTCTTGGGCTAGTTATA
ATAGTGCAGGAGATTTTTCAAACAGCTTTAAACAACCCGGTCACGAAATG
GGTTTACATTCTCGCTGCCAGCCAGCTTTTGACTTGAAATGCAATCCGAA
TTTTGAAAAGCCAATATTAAATCAGCATTCCGTCGCTCCGATTAACGTAT
TTGTTGCTAGACGCATCAATCTTGTCACAAAAGATATCAGTGATATTATC
AAAGATCTCACATTCATTCAGAAAACAAATGAAAACAAAGAACGGGTCAA
TAAAATCGTTTCCGAGTGGCGTGCAGTTGGATTGGTGCTTGACAGATTCT
TTTTTATGCTCTACGTTATTGCTATTATTCTTTCGTTAATTCTCTTCTTT
CCAAAAGCCGGAAATGATCCGTATTACGAACTCGATAACAGTTTGAATTG
TGAGATCAGTAGTTAAATTTCAAACGATTTTCTTCGTTTTTTTTGAAAAC
GCGCTCCTCTCTAATTTTAAACAAAAAAGGAGACTTATTTTCATAATAGT
TAGCTGTGTTAAAATGTAAAGTTTTCGACTATATAGTTGTTATACTAGAG
TGATTTATGTAACTTGTTGCTTAGATTTAAAAATAATATCTTAATTTCAA
CTGGAGTACCTGTCAGAGTTTTCAATAAATAAATTTGATATGAG
back to top

protein sequence of SMED30021617-orf-1

>SMED30021617-orf-1 ID=SMED30021617-orf-1|Name=SMED30021617-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=680bp
MHFHRDQTIIIGFVFLLKCLRCQYQEKLSIKNHPEKSWTEKVLINELLNG
YDKRSRPVVDNLTPVYRINTAERNQSIQQVTVEFGLSLIQIMKLDEMDQI
LTSNVRTLYRWKDYHMRWKPHLYDNITHVHIPTKYLWLPDISIYNYADER
MEERRECDAIIKYDGTVEWHPMAIFKSTCPVRIKYFPFDRQCCKLKFGPW
TYDGFRLNITFYDNKTELDQNNYVANVEWELIKTRAKFTTVRYPCCLEPY
PDISFHILVQRNSAFYNYILILPCFLLSSLTLVLFWLPAESPAKMVLGMN
IFIAFFLLVVLLEKSIPSASSSFPLIGTYYCINMTLITLSTFLCLITVNF
HFRGDNRKEVPFWLKKLTIKHGARILFVDLGFILKTPPPVETIKTKQCIN
PSFLNKAPPKHLPSSDFIDKTIQGAQFYDQFYQSNFPQRNQNSNIHYLHS
NHMRNMFESSDVRNSRPNTPDCAADVPSVFDRYPTAESISGNEEELDDDL
DFRQQQPGNYFKEYEEDLEEFLTECIQSPIPSQLAASWASYNSAGDFSNS
FKQPGHEMGLHSRCQPAFDLKCNPNFEKPILNQHSVAPINVFVARRINLV
TKDISDIIKDLTFIQKTNENKERVNKIVSEWRAVGLVLDRFFFMLYVIAI
ILSLILFFPKAGNDPYYELDNSLNCEISS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0004889acetylcholine-activated cation-selective channel activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0022848acetylcholine-gated cation-selective channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002056medial muscle cell
PLANA:0003104enteric muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR006201Neur_channel
IPR002394Nicotinic_acetylcholine_rcpt
IPR027361Acetylcholine_rcpt_TM
IPR006029Neurotrans-gated_channel_TM
IPR006202Neur_chan_lig-bd
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0045211postsynaptic membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0030054cell junction
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
GO:0060078regulation of postsynaptic membrane potential
GO:0060079excitatory postsynaptic potential
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002394Nicotinic acetylcholine receptorPRINTSPR00254NICOTINICRcoord: 141..153
score: 34.36
coord: 89..105
score: 40.39
coord: 159..177
score: 46.2
coord: 123..137
score: 29.33
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 102..118
score: 27.18
coord: 135..146
score: 40.91
coord: 179..193
score: 47.9
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 42..655
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 36..266
e-value: 1.0E-69
score: 236.3
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 40..262
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 42..262
e-value: 1.7E-53
score: 181.3
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 267..384
e-value: 6.8E-27
score: 96.0
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 585..664
e-value: 2.2E-5
score: 26.2
NoneNo IPR availablePANTHERPTHR18945:SF778ACETYLCHOLINE RECEPTOR SUBUNIT BETA-LIKE 2coord: 42..655
NoneNo IPR availableCDDcd19033LGIC_ECD_nAChR_proto-likecoord: 80..262
e-value: 7.32975E-108
score: 322.313
NoneNo IPR availableCDDcd19051LGIC_TM_cationcoord: 265..378
e-value: 1.25003E-31
score: 116.693
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.547
NoneNo IPR availableTMHMMTMhelixcoord: 294..311
NoneNo IPR availableTMHMMTMhelixcoord: 636..658
NoneNo IPR availableTMHMMTMhelixcoord: 326..348
NoneNo IPR availableTMHMMTMhelixcoord: 265..287
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 270..653
e-value: 2.4E-29
score: 103.1
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 179..193
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 265..659