Rho GTPase-activating protein

Overview
NameRho GTPase-activating protein
Smed IDSMED30021616
Length (bp)1749
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Rho GTPase-activating protein (SMED30021616) t-SNE clustered cells

Violin plots show distribution of expression levels for Rho GTPase-activating protein (SMED30021616) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Rho GTPase-activating protein (SMED30021616) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Rho GTPase-activating protein (SMED30021616) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021616

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30021616h1SMcG0003224 Contig2140GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30021616h1SMcG0002776 Contig2140GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30021616h1SMcG0002776 dd_Smed_v4_3376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30021616h1SMcG0002776 dd_Smed_v4_3376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30021616h1SMcG0002776 dd_Smed_v4_3376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30021616h1SMcG0002776 dd_Smed_v4_3376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021616h1SMcG0002776 dd_Smed_v4_3376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021616h1SMcG0002776 dd_Smed_v4_3376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021616h1SMcG0002776 dd_Smed_v4_3376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30021616h1SMcG0002776 dd_Smed_v4_3376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021616h1SMcG0002776 Contig25435newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021616h1SMcG0002776 Contig39636newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021616h1SMcG0002776 Contig39636uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30021616h1SMcG0002776 dd_Smed_v4_3376_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Rho GTPase-activating protein vs. Ensembl Human
Match: ARHGAP8 (Rho GTPase activating protein 8 [Source:HGNC Symbol;Acc:HGNC:677])

HSP 1 Score: 249.98 bits (637), Expect = 3.062e-76
Identity = 144/375 (38.40%), Postives = 214/375 (57.07%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIW 1442
             H F D+A+  ++QVAGDDRFG++V+    CR+PP + ++  R   Y   TL Q+V NDY+++YFHYGL  +N P + ++ +AYK+ DR +KKNLK LY+VHPT+ +K + N L P  S K   K+I    L EL      DQ+VIP                  P   ++D+           KL S   G       +         LP  QFGV+LQ++K  +    +PPV+   + YLR + L  EG+FRRSAS   + EIQ+ Y+  + ++  +YGD H+ A +LKTFLR L +PL+TF+ +++I+ +  +++ + V  CRQI+   LP++NY VL+YL+ FL  V+  S  N M   N+A VF  +LIW
Sbjct:   11 SHPFYDVARHGILQVAGDDRFGRRVVTFSCCRMPPSHELDHQRLLEYLKYTLDQYVENDYTIVYFHYGLNSRNKPSLGWLQSAYKEFDRKYKKNLKALYVVHPTSFIKVLWNILKPLISHKFGKKVIYFNYLSELHEHLKYDQLVIP------------------PEVLRYDE-----------KLQSLHEGRTPPPTKT---PPPRPPLPTQQFGVSLQYLKDKNQGELIPPVLRFTVTYLREKGLRTEGLFRRSASVQTVREIQRLYNQGKPVNFDDYGDIHIPAVILKTFLRELPQPLLTFQAYEQILGITCVESSLRVTGCRQILRS-LPEHNYVVLRYLMGFLHAVSRESIFNKMNSSNLACVFGLNLIW 352          
BLAST of Rho GTPase-activating protein vs. Ensembl Human
Match: PRR5-ARHGAP8 (PRR5-ARHGAP8 readthrough [Source:HGNC Symbol;Acc:HGNC:34512])

HSP 1 Score: 251.521 bits (641), Expect = 2.357e-75
Identity = 144/375 (38.40%), Postives = 214/375 (57.07%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIW 1442
             H F D+A+  ++QVAGDDRFG++V+    CR+PP + ++  R   Y   TL Q+V NDY+++YFHYGL  +N P + ++ +AYK+ DR +KKNLK LY+VHPT+ +K + N L P  S K   K+I    L EL      DQ+VIP                  P   ++D+           KL S   G       +         LP  QFGV+LQ++K  +    +PPV+   + YLR + L  EG+FRRSAS   + EIQ+ Y+  + ++  +YGD H+ A +LKTFLR L +PL+TF+ +++I+ +  +++ + V  CRQI+   LP++NY VL+YL+ FL  V+  S  N M   N+A VF  +LIW
Sbjct:  142 SHPFYDVARHGILQVAGDDRFGRRVVTFSCCRMPPSHELDHQRLLEYLKYTLDQYVENDYTIVYFHYGLNSRNKPSLGWLQSAYKEFDRKYKKNLKALYVVHPTSFIKVLWNILKPLISHKFGKKVIYFNYLSELHEHLKYDQLVIP------------------PEVLRYDE-----------KLQSLHEGRTPPPTKT---PPPRPPLPTQQFGVSLQYLKDKNQGELIPPVLRFTVTYLREKGLRTEGLFRRSASVQTVREIQRLYNQGKPVNFDDYGDIHIPAVILKTFLRELPQPLLTFQAYEQILGITCVESSLRVTGCRQILRS-LPEHNYVVLRYLMGFLHAVSRESIFNKMNSSNLACVFGLNLIW 483          
BLAST of Rho GTPase-activating protein vs. Ensembl Human
Match: ARHGAP1 (Rho GTPase activating protein 1 [Source:HGNC Symbol;Acc:HGNC:673])

HSP 1 Score: 245.358 bits (625), Expect = 1.899e-74
Identity = 139/378 (36.77%), Postives = 216/378 (57.14%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCH-VPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            D  + DIA+  +V+VAGDD++G+K+I+  ACR+PP + ++  +   Y   TL Q+V +DY+L+Y H+GLT  N P + ++ +AY++ DR +KKN+K LYIVHPT  +K ++    P  S K   KI  V  L EL     L+Q+ IP                      K+DDF    +K       SP++                  LP  QFGV+LQH+++ + +   +P V+ + + YL++  L  EGIFRRSA+   + E+Q+KY++   +D  +Y + HL A +LKTFLR L EPL+TF+L+  ++   N+     V    Q V   LP+ NY VL++L  FL++++ HSD+N MT  N+A VF P+L+W++
Sbjct:   61 DDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLSWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPLISFKFGQKIFYVNYLSELSEHVKLEQLGIPR------------------QVLKYDDFLKSTQK-------SPATAPKPMPPRP--------PLPNQQFGVSLQHLQEKNPEQEPIPIVLRETVAYLQAHALTTEGIFRRSANTQVVREVQQKYNMGLPVDFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVPATLQ-VLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAK 404          
BLAST of Rho GTPase-activating protein vs. Ensembl Human
Match: PRR5-ARHGAP8 (PRR5-ARHGAP8 readthrough [Source:HGNC Symbol;Acc:HGNC:34512])

HSP 1 Score: 242.276 bits (617), Expect = 1.457e-72
Identity = 145/392 (36.99%), Postives = 215/392 (54.85%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNL-----------------KTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIW 1442
             H F D+A+  ++QVAGDDRFG++V+    CR+PP + ++  R   Y   TL Q+V NDY+++YFHYGL  +N P + ++ +AYK+ DR +KKNLK LY+VHPT+ +K + N L P  S K   K+I    L EL      DQ+VIP                  P   ++D+           KL S   G       +         LP  QFGV+LQ++K  +    +PPV+   + YLR + L  EG+FRRSAS   + EIQ+ Y+  + ++  +YGD H+ A +LKTFLR L +PL+TF+ +++I+ + +L                 ++ + V  CRQI+   LP++NY VL+YL+ FL  V+  S  N M   N+A VF  +LIW
Sbjct:   65 SHPFYDVARHGILQVAGDDRFGRRVVTFSCCRMPPSHELDHQRLLEYLKYTLDQYVENDYTIVYFHYGLNSRNKPSLGWLQSAYKEFDRKYKKNLKALYVVHPTSFIKVLWNILKPLISHKFGKKVIYFNYLSELHEHLKYDQLVIP------------------PEVLRYDE-----------KLQSLHEGRTPPPTKT---PPPRPPLPTQQFGVSLQYLKDKNQGELIPPVLRFTVTYLREKGLRTEGLFRRSASVQTVREIQRLYNQGKPVNFDDYGDIHIPAVILKTFLRELPQPLLTFQAYEQILGITSLPLAPLELSREPHALPGVESSLRVTGCRQILRS-LPEHNYVVLRYLMGFLHAVSRESIFNKMNSSNLACVFGLNLIW 423          
BLAST of Rho GTPase-activating protein vs. Ensembl Human
Match: ARHGAP8 (Rho GTPase activating protein 8 [Source:HGNC Symbol;Acc:HGNC:677])

HSP 1 Score: 233.802 bits (595), Expect = 8.792e-70
Identity = 144/406 (35.47%), Postives = 214/406 (52.71%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRD-------------------------------FKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIW 1442
             H F D+A+  ++QVAGDDRFG++V+    CR+PP + ++  R   Y   TL Q+V NDY+++YFHYGL  +N P + ++ +AYK+ DR                                +KKNLK LY+VHPT+ +K + N L P  S K   K+I    L EL      DQ+VIP                  P   ++D+           KL S   G       +         LP  QFGV+LQ++K  +    +PPV+   + YLR + L  EG+FRRSAS   + EIQ+ Y+  + ++  +YGD H+ A +LKTFLR L +PL+TF+ +++I+ +  +++ + V  CRQI+   LP++NY VL+YL+ FL  V+  S  N M   N+A VF  +LIW
Sbjct:   11 SHPFYDVARHGILQVAGDDRFGRRVVTFSCCRMPPSHELDHQRLLEYLKYTLDQYVENDYTIVYFHYGLNSRNKPSLGWLQSAYKEFDRKDGDLTMWPRLVSNSKLKRSSHLSLPKYWDYRYKKNLKALYVVHPTSFIKVLWNILKPLISHKFGKKVIYFNYLSELHEHLKYDQLVIP------------------PEVLRYDE-----------KLQSLHEGRTPPPTKT---PPPRPPLPTQQFGVSLQYLKDKNQGELIPPVLRFTVTYLREKGLRTEGLFRRSASVQTVREIQRLYNQGKPVNFDDYGDIHIPAVILKTFLRELPQPLLTFQAYEQILGITCVESSLRVTGCRQILRS-LPEHNYVVLRYLMGFLHAVSRESIFNKMNSSNLACVFGLNLIW 383          
BLAST of Rho GTPase-activating protein vs. Ensembl Celegans
Match: rga-1 (Rho GTPase Activating protein [Source:UniProtKB/TrEMBL;Acc:Q23130])

HSP 1 Score: 202.601 bits (514), Expect = 1.170e-58
Identity = 129/381 (33.86%), Postives = 199/381 (52.23%), Query Frame = 3
Query:  327 FSDIAKLNVVQVAGD-DRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDL--------SEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIW 1442
            F+DI+   ++QV  D DR G+ ++++YA R+P    I+  R   Y V+ + + V  DY+++YFHYGL   N P ++++  AYKQ+DR FKKNLK LY+VHPT  ++ I +    F S+K ++K   V  + ELE+   + ++ +P  I                             +DHD             +Q + P T   + LP  QFGV L+ I   H   ++PP+++Q I YL +  L  EG+FR+SA+   +  +Q + +  E ID         +EY     A+ LLKTF RSL EPL T  L+ ++  L  +         ++ V  +LP  NY +LK +I+FL  VAE+S  N+MT  N++ VF P+L W
Sbjct:   73 FNDISAHEIIQVIADGDRVGRPIVVVYAYRLPSSKEIDHARLLQYLVQIIDKIVDQDYTIVYFHYGLRSHNKPPVRWLFQAYKQLDRRFKKNLKALYVVHPTRFIRIIFSLFKGFISSKFENKFHYVMCIDELENALSVARLNLPSPI-----------------------------RDHDKSFS---------TQSNRPETPPAQPLPTQQFGVPLEFILS-HCGGNIPPIVDQLIEYLEAHALTMEGVFRKSANIGSIKRLQDRINKGEKIDFENDPEYKDNEYVASLHASVLLKTFFRSLGEPLTTNRLYPKLAALSEVSKTEKSAAVKEFV-KLLPRENYILLKTVIKFLTRVAENSKVNLMTANNLSVVFGPNLTW 413          
BLAST of Rho GTPase-activating protein vs. Ensembl Celegans
Match: rga-1 (Rho GTPase Activating protein [Source:UniProtKB/TrEMBL;Acc:Q23130])

HSP 1 Score: 116.316 bits (290), Expect = 3.194e-29
Identity = 70/187 (37.43%), Postives = 103/187 (55.08%), Query Frame = 3
Query:  906 SQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLS---EYGDPHL-----AACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIW 1442
            +Q + P T   + LP  QFGV L+ I   H   ++PP+++Q I YL +  L  EG+FR+SA+   +  +Q + +  E ID     EY D        A+ LLKTF RSL EPL T  L+ ++  L  +         ++ V  +LP  NY +LK +I+FL  VAE+S  N+MT  N++ VF P+L W
Sbjct:   30 TQSNRPETPPAQPLPTQQFGVPLEFILS-HCGGNIPPIVDQLIEYLEAHALTMEGVFRKSANIGSIKRLQDRINKGEKIDFENDPEYKDNEYVASLHASVLLKTFFRSLGEPLTTNRLYPKLAALSEVSKTEKSAAVKEFV-KLLPRENYILLKTVIKFLTRVAENSKVNLMTANNLSVVFGPNLTW 214          
BLAST of Rho GTPase-activating protein vs. Ensembl Celegans
Match: rga-1 (Rho GTPase Activating protein [Source:UniProtKB/TrEMBL;Acc:Q23130])

HSP 1 Score: 116.316 bits (290), Expect = 3.194e-29
Identity = 70/187 (37.43%), Postives = 103/187 (55.08%), Query Frame = 3
Query:  906 SQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLS---EYGDPHL-----AACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIW 1442
            +Q + P T   + LP  QFGV L+ I   H   ++PP+++Q I YL +  L  EG+FR+SA+   +  +Q + +  E ID     EY D        A+ LLKTF RSL EPL T  L+ ++  L  +         ++ V  +LP  NY +LK +I+FL  VAE+S  N+MT  N++ VF P+L W
Sbjct:   30 TQSNRPETPPAQPLPTQQFGVPLEFILS-HCGGNIPPIVDQLIEYLEAHALTMEGVFRKSANIGSIKRLQDRINKGEKIDFENDPEYKDNEYVASLHASVLLKTFFRSLGEPLTTNRLYPKLAALSEVSKTEKSAAVKEFV-KLLPRENYILLKTVIKFLTRVAENSKVNLMTANNLSVVFGPNLTW 214          
BLAST of Rho GTPase-activating protein vs. Ensembl Celegans
Match: rga-1 (Rho GTPase Activating protein [Source:UniProtKB/TrEMBL;Acc:Q23130])

HSP 1 Score: 116.316 bits (290), Expect = 3.194e-29
Identity = 70/187 (37.43%), Postives = 103/187 (55.08%), Query Frame = 3
Query:  906 SQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLS---EYGDPHL-----AACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIW 1442
            +Q + P T   + LP  QFGV L+ I   H   ++PP+++Q I YL +  L  EG+FR+SA+   +  +Q + +  E ID     EY D        A+ LLKTF RSL EPL T  L+ ++  L  +         ++ V  +LP  NY +LK +I+FL  VAE+S  N+MT  N++ VF P+L W
Sbjct:   30 TQSNRPETPPAQPLPTQQFGVPLEFILS-HCGGNIPPIVDQLIEYLEAHALTMEGVFRKSANIGSIKRLQDRINKGEKIDFENDPEYKDNEYVASLHASVLLKTFFRSLGEPLTTNRLYPKLAALSEVSKTEKSAAVKEFV-KLLPRENYILLKTVIKFLTRVAENSKVNLMTANNLSVVFGPNLTW 214          
BLAST of Rho GTPase-activating protein vs. Ensembl Celegans
Match: rga-1 (Rho GTPase Activating protein [Source:UniProtKB/TrEMBL;Acc:Q23130])

HSP 1 Score: 116.316 bits (290), Expect = 3.194e-29
Identity = 70/187 (37.43%), Postives = 103/187 (55.08%), Query Frame = 3
Query:  906 SQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLS---EYGDPHL-----AACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIW 1442
            +Q + P T   + LP  QFGV L+ I   H   ++PP+++Q I YL +  L  EG+FR+SA+   +  +Q + +  E ID     EY D        A+ LLKTF RSL EPL T  L+ ++  L  +         ++ V  +LP  NY +LK +I+FL  VAE+S  N+MT  N++ VF P+L W
Sbjct:   30 TQSNRPETPPAQPLPTQQFGVPLEFILS-HCGGNIPPIVDQLIEYLEAHALTMEGVFRKSANIGSIKRLQDRINKGEKIDFENDPEYKDNEYVASLHASVLLKTFFRSLGEPLTTNRLYPKLAALSEVSKTEKSAAVKEFV-KLLPRENYILLKTVIKFLTRVAENSKVNLMTANNLSVVFGPNLTW 214          
BLAST of Rho GTPase-activating protein vs. Ensembl Fly
Match: RhoGAP68F (gene:FBgn0036257 transcript:FBtr0334091)

HSP 1 Score: 198.749 bits (504), Expect = 2.457e-57
Identity = 125/364 (34.34%), Postives = 200/364 (54.95%), Query Frame = 3
Query:  366 GDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKC--HVPPVMEQCIMYLR-SECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            G D+ G+ +  IYA R P      L+ F    +K ++ FV NDY L+YFH GL + N P  +F+ N+YK++DR+F+KNLK LY+VHPT  ++ I N   PF S K + K++ +  L EL     L+++ +P+ I   D   + +  S++P T                    PSS  N   Q        +K     QFGV L+ I   +S C   +PP++ +C+  L  +  ++ EGIFRRS +  +++ ++++ +  E +DL    + H+ A LLK+FLR L EPL+TFEL++++    +   +       Q++ + LP+ NY + KY++EFL+ V +  D N MT  N+A VF P+ +WSR
Sbjct:   48 GTDKQGRHIFGIYASRFP--EKSQLEGFVREIIKEIEPFVENDYILVYFHQGLKEDNKPSAQFLWNSYKELDRNFRKNLKTLYVVHPTWFIRVIWNFFSPFISDKFRKKLVYISSLDELRQALGLNKLKLPDNICDLD---DKLNPSRKPST------------------PPPSSNINASRQQQ------HKMATTHQFGVPLKFIVM-NSPCLNSIPPIVRKCVDSLSITGVIDTEGIFRRSGNHSEIMALKERVNRGEDVDLKSV-NVHVIAGLLKSFLRDLAEPLLTFELYEDVTGFLDWPKEERSRNVTQLIREKLPEENYELFKYIVEFLVRVMDCEDLNKMTSSNLAIVFGPNFLWSR 380          
BLAST of Rho GTPase-activating protein vs. Ensembl Fly
Match: RhoGAP68F (gene:FBgn0036257 transcript:FBtr0334093)

HSP 1 Score: 198.364 bits (503), Expect = 1.203e-56
Identity = 125/364 (34.34%), Postives = 200/364 (54.95%), Query Frame = 3
Query:  366 GDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKC--HVPPVMEQCIMYLR-SECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            G D+ G+ +  IYA R P      L+ F    +K ++ FV NDY L+YFH GL + N P  +F+ N+YK++DR+F+KNLK LY+VHPT  ++ I N   PF S K + K++ +  L EL     L+++ +P+ I   D   + +  S++P T                    PSS  N   Q        +K     QFGV L+ I   +S C   +PP++ +C+  L  +  ++ EGIFRRS +  +++ ++++ +  E +DL    + H+ A LLK+FLR L EPL+TFEL++++    +   +       Q++ + LP+ NY + KY++EFL+ V +  D N MT  N+A VF P+ +WSR
Sbjct:  104 GTDKQGRHIFGIYASRFP--EKSQLEGFVREIIKEIEPFVENDYILVYFHQGLKEDNKPSAQFLWNSYKELDRNFRKNLKTLYVVHPTWFIRVIWNFFSPFISDKFRKKLVYISSLDELRQALGLNKLKLPDNICDLD---DKLNPSRKPST------------------PPPSSNINASRQQQ------HKMATTHQFGVPLKFIVM-NSPCLNSIPPIVRKCVDSLSITGVIDTEGIFRRSGNHSEIMALKERVNRGEDVDLKSV-NVHVIAGLLKSFLRDLAEPLLTFELYEDVTGFLDWPKEERSRNVTQLIREKLPEENYELFKYIVEFLVRVMDCEDLNKMTSSNLAIVFGPNFLWSR 436          
BLAST of Rho GTPase-activating protein vs. Ensembl Fly
Match: RhoGAP68F (gene:FBgn0036257 transcript:FBtr0075997)

HSP 1 Score: 198.364 bits (503), Expect = 1.295e-56
Identity = 125/364 (34.34%), Postives = 200/364 (54.95%), Query Frame = 3
Query:  366 GDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKC--HVPPVMEQCIMYLR-SECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            G D+ G+ +  IYA R P      L+ F    +K ++ FV NDY L+YFH GL + N P  +F+ N+YK++DR+F+KNLK LY+VHPT  ++ I N   PF S K + K++ +  L EL     L+++ +P+ I   D   + +  S++P T                    PSS  N   Q        +K     QFGV L+ I   +S C   +PP++ +C+  L  +  ++ EGIFRRS +  +++ ++++ +  E +DL    + H+ A LLK+FLR L EPL+TFEL++++    +   +       Q++ + LP+ NY + KY++EFL+ V +  D N MT  N+A VF P+ +WSR
Sbjct:  105 GTDKQGRHIFGIYASRFP--EKSQLEGFVREIIKEIEPFVENDYILVYFHQGLKEDNKPSAQFLWNSYKELDRNFRKNLKTLYVVHPTWFIRVIWNFFSPFISDKFRKKLVYISSLDELRQALGLNKLKLPDNICDLD---DKLNPSRKPST------------------PPPSSNINASRQQQ------HKMATTHQFGVPLKFI-VMNSPCLNSIPPIVRKCVDSLSITGVIDTEGIFRRSGNHSEIMALKERVNRGEDVDLKSV-NVHVIAGLLKSFLRDLAEPLLTFELYEDVTGFLDWPKEERSRNVTQLIREKLPEENYELFKYIVEFLVRVMDCEDLNKMTSSNLAIVFGPNFLWSR 437          
BLAST of Rho GTPase-activating protein vs. Ensembl Fly
Match: RhoGAP68F (gene:FBgn0036257 transcript:FBtr0334092)

HSP 1 Score: 198.364 bits (503), Expect = 1.295e-56
Identity = 125/364 (34.34%), Postives = 200/364 (54.95%), Query Frame = 3
Query:  366 GDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKC--HVPPVMEQCIMYLR-SECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            G D+ G+ +  IYA R P      L+ F    +K ++ FV NDY L+YFH GL + N P  +F+ N+YK++DR+F+KNLK LY+VHPT  ++ I N   PF S K + K++ +  L EL     L+++ +P+ I   D   + +  S++P T                    PSS  N   Q        +K     QFGV L+ I   +S C   +PP++ +C+  L  +  ++ EGIFRRS +  +++ ++++ +  E +DL    + H+ A LLK+FLR L EPL+TFEL++++    +   +       Q++ + LP+ NY + KY++EFL+ V +  D N MT  N+A VF P+ +WSR
Sbjct:  105 GTDKQGRHIFGIYASRFP--EKSQLEGFVREIIKEIEPFVENDYILVYFHQGLKEDNKPSAQFLWNSYKELDRNFRKNLKTLYVVHPTWFIRVIWNFFSPFISDKFRKKLVYISSLDELRQALGLNKLKLPDNICDLD---DKLNPSRKPST------------------PPPSSNINASRQQQ------HKMATTHQFGVPLKFI-VMNSPCLNSIPPIVRKCVDSLSITGVIDTEGIFRRSGNHSEIMALKERVNRGEDVDLKSV-NVHVIAGLLKSFLRDLAEPLLTFELYEDVTGFLDWPKEERSRNVTQLIREKLPEENYELFKYIVEFLVRVMDCEDLNKMTSSNLAIVFGPNFLWSR 437          
BLAST of Rho GTPase-activating protein vs. Ensembl Fly
Match: RhoGAP92B (gene:FBgn0038747 transcript:FBtr0344352)

HSP 1 Score: 84.3445 bits (207), Expect = 7.086e-17
Identity = 51/170 (30.00%), Postives = 89/170 (52.35%), Query Frame = 3
Query:  951 ESQFGVTL-QHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLS---EYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            +S+FG +L +H+   + +     ++E C   L    LE EG+ R   +  KL  ++   +  +H+      +Y DPH+   +LK +LR L EPL+T+ L+ + I++    ++       + +   LP  NY  L+YL  FL  V + S  N M+ QN+A V +P+++W R
Sbjct:   49 KSRFGTSLKEHLTSTNREISY--IVELCCCCLLEHGLEEEGLLRVGCASTKLRRMKHALEA-QHVKTPLPLDYQDPHVIGSILKLYLRELPEPLLTYNLYKDFIRIAERHSEAERKTEIKAILTKLPKENYANLRYLTRFLSIVQQRSALNKMSSQNLAIVMSPNMLWPR 215          
BLAST of Rho GTPase-activating protein vs. Ensembl Zebrafish
Match: arhgap1 (Rho GTPase activating protein 1 [Source:ZFIN;Acc:ZDB-GENE-050417-305])

HSP 1 Score: 236.884 bits (603), Expect = 1.844e-71
Identity = 142/385 (36.88%), Postives = 219/385 (56.88%), Query Frame = 3
Query:  300 TSQDMIDHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKT-QDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCH-VPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            TS    D  F DIA+  +V+VAGDD FG+KVI+  ACR+PP + ++  +   Y  +TL ++V +DY+LIYFH+GLT +N P + ++ +AY++ DR +KKN+K LYIVHPT  ++ I+    P  S K   KI  +  L ELE     DQ+VIP  ++   D+ R S+  S  P                                +S P +     LP  QFGV+L  +K   +    +P VM   I +L    L+ EGIFRRSA+   + +++ KY+  E ++ S+  D HLAA +LK FLR L EPL+T++L+++I+  HN+  +   +  + ++   LPD NY  L++L++FL +V+  S+ N MT  N+A VF P+L+W++
Sbjct:   55 TSHLPWDDPFYDIARHQIVEVAGDDNFGRKVIVFNACRMPPQHQLDHHKLLMYLKQTLDKYVESDYTLIYFHHGLTSENKPSLSWLRDAYREFDRKYKKNIKALYIVHPTMFIRTILILFKPIISFKFGRKINYINYLSELEEIVKCDQLVIPNRVREYDDKIRLSLKPSVVP------------------------------GPISPPRSP---PLPFQQFGVSLTTLKHRAADSEGIPLVMRDTIGFLLENGLQTEGIFRRSANVSLVKDVKAKYNSGEEVNFSQLEDVHLAAVILKMFLRELPEPLLTYQLYNDIVNFHNVDIESQAERIQNMLMS-LPDENYASLRFLVQFLAQVSAESEINKMTNANLAVVFGPNLLWAQ 405          
BLAST of Rho GTPase-activating protein vs. Ensembl Zebrafish
Match: arhgap1 (Rho GTPase activating protein 1 [Source:ZFIN;Acc:ZDB-GENE-050417-305])

HSP 1 Score: 236.884 bits (603), Expect = 1.844e-71
Identity = 142/385 (36.88%), Postives = 219/385 (56.88%), Query Frame = 3
Query:  300 TSQDMIDHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKT-QDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCH-VPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            TS    D  F DIA+  +V+VAGDD FG+KVI+  ACR+PP + ++  +   Y  +TL ++V +DY+LIYFH+GLT +N P + ++ +AY++ DR +KKN+K LYIVHPT  ++ I+    P  S K   KI  +  L ELE     DQ+VIP  ++   D+ R S+  S  P                                +S P +     LP  QFGV+L  +K   +    +P VM   I +L    L+ EGIFRRSA+   + +++ KY+  E ++ S+  D HLAA +LK FLR L EPL+T++L+++I+  HN+  +   +  + ++   LPD NY  L++L++FL +V+  S+ N MT  N+A VF P+L+W++
Sbjct:   55 TSHLPWDDPFYDIARHQIVEVAGDDNFGRKVIVFNACRMPPQHQLDHHKLLMYLKQTLDKYVESDYTLIYFHHGLTSENKPSLSWLRDAYREFDRKYKKNIKALYIVHPTMFIRTILILFKPIISFKFGRKINYINYLSELEEIVKCDQLVIPNRVREYDDKIRLSLKPSVVP------------------------------GPISPPRSP---PLPFQQFGVSLTTLKHRAADSEGIPLVMRDTIGFLLENGLQTEGIFRRSANVSLVKDVKAKYNSGEEVNFSQLEDVHLAAVILKMFLRELPEPLLTYQLYNDIVNFHNVDIESQAERIQNMLMS-LPDENYASLRFLVQFLAQVSAESEINKMTNANLAVVFGPNLLWAQ 405          
BLAST of Rho GTPase-activating protein vs. Ensembl Zebrafish
Match: arhgap17b (Rho GTPase activating protein 17b [Source:ZFIN;Acc:ZDB-GENE-080220-26])

HSP 1 Score: 113.235 bits (282), Expect = 8.453e-26
Identity = 61/166 (36.75%), Postives = 95/166 (57.23%), Query Frame = 3
Query:  960 FGVTLQ-HIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHE 1454
            FG  L+ H+K+   +  +P  +E C+M L    ++ EG+FR +A   KL +++   D +       Y DPH  A  LK++LR L EPLM+++L++E I+  N+           +VCDMLP  N    +YL++FL ++A  SD N MT  NIA V  P+L+W++ E
Sbjct:  254 FGTALEEHLKRTGREVALP--IEACVMMLLETGMQEEGLFRIAAGASKLKKLKAALDCSTSQLEEFYSDPHAVAGALKSYLRELPEPLMSYQLYEEWIQASNISDPDKRLQALWVVCDMLPKANKTNFRYLVKFLAKLALESDVNKMTASNIAIVLGPNLLWAKTE 417          
BLAST of Rho GTPase-activating protein vs. Ensembl Zebrafish
Match: arhgap17a (Rho GTPase activating protein 17a [Source:ZFIN;Acc:ZDB-GENE-050417-56])

HSP 1 Score: 112.849 bits (281), Expect = 1.376e-25
Identity = 61/166 (36.75%), Postives = 94/166 (56.63%), Query Frame = 3
Query:  960 FGVTL-QHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHE 1454
            FG  L +H+K+   +  +P  +E C+M L    ++ EG+FR +A   KL +++   D +       Y DPH  A  LK++LR L EPLMT++L+DE I+  N+           + CD LP  N    +YL++FL ++A+ SD N MT  NIA V  P+L+W++ E
Sbjct:  253 FGTALDEHLKRSSREIALP--IEACVMMLLETGMKEEGLFRIAAGASKLKKLKAALDCSTSQLEEFYSDPHAVAGALKSYLRELPEPLMTYQLYDEWIQASNVPDPDKRLQALWVTCDQLPKNNKANFRYLVKFLAKLAQESDVNKMTPSNIAIVLGPNLLWAKTE 416          
BLAST of Rho GTPase-activating protein vs. Ensembl Zebrafish
Match: arhgap17a (Rho GTPase activating protein 17a [Source:ZFIN;Acc:ZDB-GENE-050417-56])

HSP 1 Score: 112.464 bits (280), Expect = 1.682e-25
Identity = 61/166 (36.75%), Postives = 94/166 (56.63%), Query Frame = 3
Query:  960 FGVTL-QHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHE 1454
            FG  L +H+K+   +  +P  +E C+M L    ++ EG+FR +A   KL +++   D +       Y DPH  A  LK++LR L EPLMT++L+DE I+  N+           + CD LP  N    +YL++FL ++A+ SD N MT  NIA V  P+L+W++ E
Sbjct:  233 FGTALDEHLKRSSREIALP--IEACVMMLLETGMKEEGLFRIAAGASKLKKLKAALDCSTSQLEEFYSDPHAVAGALKSYLRELPEPLMTYQLYDEWIQASNVPDPDKRLQALWVTCDQLPKNNKANFRYLVKFLAKLAQESDVNKMTPSNIAIVLGPNLLWAKTE 396          
BLAST of Rho GTPase-activating protein vs. Ensembl Xenopus
Match: ublcp1 (ubiquitin like domain containing CTD phosphatase 1 [Source:Xenbase;Acc:XB-GENE-5892709])

HSP 1 Score: 226.098 bits (575), Expect = 3.506e-67
Identity = 130/380 (34.21%), Postives = 210/380 (55.26%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIP-EIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKC-HVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHN-LKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            D  + DIA   +V+VAGDD++G+K+++  ACR+PP + I+  +   Y   TL Q+V +DY+L+Y H+GLT +N P + ++ +AY++ DR +KKN+K LYIVHPT  +K ++    P  S K   KI     L +LE    ++Q+ IP +++K  D  R+++  S              N+                                  QFG++L H+K+ H +   +P V+   + +L+   L  EGIFRRSA    + E+Q+KY++   +   +Y D HL A +LKTFLR L EPL+T+ L+  ++   + L  +  ++   QI+   LP  NY VL++L  FL+EV+ H+++N MT  N+A VF P+L+W +
Sbjct:   62 DDPYYDIAWRQIVEVAGDDKYGRKIVVFSACRLPPCHEIDHVKLLQYLKHTLDQYVESDYTLVYLHHGLTSENKPSLGWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPIISFKFGRKIFYANYLSDLEEHMKVEQLGIPKQVLKYDDLIRSNLKTSAATQKPGPPRPPLPNQ----------------------------------QFGISLLHLKEKHPENDKIPLVVRDTVAFLQENALSTEGIFRRSARTQIVREVQQKYNMGVQVTFQQYDDVHLPAVILKTFLRELPEPLLTYNLYSFVVDFSSKLAQEQKIESTLQIL-QTLPKENYDVLQFLTAFLVEVSSHNEQNKMTTTNLAVVFGPNLLWVK 406          
BLAST of Rho GTPase-activating protein vs. Ensembl Xenopus
Match: ublcp1 (ubiquitin like domain containing CTD phosphatase 1 [Source:Xenbase;Acc:XB-GENE-5892709])

HSP 1 Score: 226.098 bits (575), Expect = 4.116e-67
Identity = 130/379 (34.30%), Postives = 209/379 (55.15%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIP-EIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKC-HVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            D  + DIA   +V+VAGDD++G+K+++  ACR+PP + I+  +   Y   TL Q+V +DY+L+Y H+GLT +N P + ++ +AY++ DR +KKN+K LYIVHPT  +K ++    P  S K   KI     L +LE    ++Q+ IP +++K  D  R+++  S              N+                                  QFG++L H+K+ H +   +P V+   + +L+   L  EGIFRRSA    + E+Q+KY++   +   +Y D HL A +LKTFLR L EPL+T+ L+  ++     K +  ++   QI+   LP  NY VL++L  FL+EV+ H+++N MT  N+A VF P+L+W +
Sbjct:   70 DDPYYDIAWRQIVEVAGDDKYGRKIVVFSACRLPPCHEIDHVKLLQYLKHTLDQYVESDYTLVYLHHGLTSENKPSLGWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPIISFKFGRKIFYANYLSDLEEHMKVEQLGIPKQVLKYDDLIRSNLKTSAATQKPGPPRPPLPNQ----------------------------------QFGISLLHLKEKHPENDKIPLVVRDTVAFLQENALSTEGIFRRSARTQIVREVQQKYNMGVQVTFQQYDDVHLPAVILKTFLRELPEPLLTYNLYSFVVDFS--KQEQKIESTLQIL-QTLPKENYDVLQFLTAFLVEVSSHNEQNKMTTTNLAVVFGPNLLWVK 411          
BLAST of Rho GTPase-activating protein vs. Ensembl Xenopus
Match: ublcp1 (ubiquitin like domain containing CTD phosphatase 1 [Source:Xenbase;Acc:XB-GENE-5892709])

HSP 1 Score: 225.713 bits (574), Expect = 4.725e-67
Identity = 130/379 (34.30%), Postives = 209/379 (55.15%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIP-EIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKC-HVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            D  + DIA   +V+VAGDD++G+K+++  ACR+PP + I+  +   Y   TL Q+V +DY+L+Y H+GLT +N P + ++ +AY++ DR +KKN+K LYIVHPT  +K ++    P  S K   KI     L +LE    ++Q+ IP +++K  D  R+++  S              N+                                  QFG++L H+K+ H +   +P V+   + +L+   L  EGIFRRSA    + E+Q+KY++   +   +Y D HL A +LKTFLR L EPL+T+ L+  ++     K +  ++   QI+   LP  NY VL++L  FL+EV+ H+++N MT  N+A VF P+L+W +
Sbjct:   62 DDPYYDIAWRQIVEVAGDDKYGRKIVVFSACRLPPCHEIDHVKLLQYLKHTLDQYVESDYTLVYLHHGLTSENKPSLGWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPIISFKFGRKIFYANYLSDLEEHMKVEQLGIPKQVLKYDDLIRSNLKTSAATQKPGPPRPPLPNQ----------------------------------QFGISLLHLKEKHPENDKIPLVVRDTVAFLQENALSTEGIFRRSARTQIVREVQQKYNMGVQVTFQQYDDVHLPAVILKTFLRELPEPLLTYNLYSFVVDFS--KQEQKIESTLQIL-QTLPKENYDVLQFLTAFLVEVSSHNEQNKMTTTNLAVVFGPNLLWVK 403          
BLAST of Rho GTPase-activating protein vs. Ensembl Xenopus
Match: ublcp1 (ubiquitin like domain containing CTD phosphatase 1 [Source:Xenbase;Acc:XB-GENE-5892709])

HSP 1 Score: 218.009 bits (554), Expect = 5.038e-64
Identity = 129/383 (33.68%), Postives = 209/383 (54.57%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVA----GDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIP-EIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKC-HVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            D  + DIA   +V+VA     DD++G+K+++  ACR+PP + I+  +   Y   TL Q+V +DY+L+Y H+GLT +N P + ++ +AY++ DR +KKN+K LYIVHPT  +K ++    P  S K   KI     L +LE    ++Q+ IP +++K  D  R+++  S              N+                                  QFG++L H+K+ H +   +P V+   + +L+   L  EGIFRRSA    + E+Q+KY++   +   +Y D HL A +LKTFLR L EPL+T+ L+  ++   + K +  ++   QI+   LP  NY VL++L  FL+EV+ H+++N MT  N+A VF P+L+W +
Sbjct:   62 DDPYYDIAWRQIVEVARNLPSDDKYGRKIVVFSACRLPPCHEIDHVKLLQYLKHTLDQYVESDYTLVYLHHGLTSENKPSLGWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPIISFKFGRKIFYANYLSDLEEHMKVEQLGIPKQVLKYDDLIRSNLKTSAATQKPGPPRPPLPNQ----------------------------------QFGISLLHLKEKHPENDKIPLVVRDTVAFLQENALSTEGIFRRSARTQIVREVQQKYNMGVQVTFQQYDDVHLPAVILKTFLRELPEPLLTYNLYSFVVDFSS-KLEQKIESTLQIL-QTLPKENYDVLQFLTAFLVEVSSHNEQNKMTTTNLAVVFGPNLLWVK 408          
BLAST of Rho GTPase-activating protein vs. Ensembl Xenopus
Match: ARHGAP17 (Rho GTPase activating protein 17 [Source:NCBI gene;Acc:549590])

HSP 1 Score: 114.775 bits (286), Expect = 4.692e-26
Identity = 68/187 (36.36%), Postives = 99/187 (52.94%), Query Frame = 3
Query:  930 SFYKALPESQ-----------FGVTLQ-HIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHE 1454
            +  KALPE Q           FG  L+ H+K+   +  +P  +E C+M L    ++ EG+FR +A   KL +++   D +       Y DPH  A  LK++LR L EPLMTF L++E     N+           +VC  LP  N    +YL++FL +++ HSD N MT  NIA V  P+L+W+RHE
Sbjct:  236 ALEKALPEIQAQQDKWTEKPAFGTPLEEHLKRSGREIALP--IEACVMMLLETGMKEEGLFRIAAGASKLKKLKAALDCSTSQLEEFYSDPHAVAGALKSYLRELPEPLMTFNLYEEWNHAGNIPDQNTKLQALWVVCQKLPKPNLENFRYLVKFLAKLSHHSDINKMTPSNIAIVLGPNLLWARHE 420          
BLAST of Rho GTPase-activating protein vs. Ensembl Mouse
Match: Arhgap8 (Rho GTPase activating protein 8 [Source:MGI Symbol;Acc:MGI:1920417])

HSP 1 Score: 245.358 bits (625), Expect = 1.133e-74
Identity = 138/375 (36.80%), Postives = 213/375 (56.80%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIW 1442
             H F D+A+  ++QVAGDDR G+++     CR+PP++ +N  R   Y   TL Q V NDY+++YFHYGL+ +N P + ++ N YK+ DR +KKNLK LY+VHPT+L+K + N   P  S K   K+     L+EL      DQ++IP                  P   ++D+           KL +   G       +         LP  QFGV+LQ+++  +    +PPV+   + YLR + L  EG+FRRSAS   + ++Q+ YD  + ++  +YGD HL A +LKTFLR L +PL+TF+ +++I+ + ++++ + V  CR ++   LP++NY VL+YL+ FL EV+  S  N M   N+A VF  +LIW
Sbjct:   11 SHPFYDVARHGILQVAGDDRQGRRIFTFSCCRLPPLHQLNHQRLLEYLKYTLDQHVENDYTIVYFHYGLSSQNKPSLGWLQNTYKEFDRKYKKNLKALYVVHPTSLIKALWNIFKPLISHKFGKKVTYCSNLRELREHLQCDQLLIP------------------PEVVRYDE-----------KLQNLHKGQPPPPTKT---PPPRPPLPTQQFGVSLQYLRDKNQGELIPPVLRWTVTYLREKGLRTEGLFRRSASAQTVRQVQRLYDQGKPVNFDDYGDMHLPAVILKTFLRELPQPLLTFQAYEQILGITSVESSLRVTHCR-LILRSLPEHNYAVLRYLMGFLHEVSLESISNKMNSSNLACVFGLNLIW 352          
BLAST of Rho GTPase-activating protein vs. Ensembl Mouse
Match: Arhgap8 (Rho GTPase activating protein 8 [Source:MGI Symbol;Acc:MGI:1920417])

HSP 1 Score: 245.358 bits (625), Expect = 1.133e-74
Identity = 138/375 (36.80%), Postives = 213/375 (56.80%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIW 1442
             H F D+A+  ++QVAGDDR G+++     CR+PP++ +N  R   Y   TL Q V NDY+++YFHYGL+ +N P + ++ N YK+ DR +KKNLK LY+VHPT+L+K + N   P  S K   K+     L+EL      DQ++IP                  P   ++D+           KL +   G       +         LP  QFGV+LQ+++  +    +PPV+   + YLR + L  EG+FRRSAS   + ++Q+ YD  + ++  +YGD HL A +LKTFLR L +PL+TF+ +++I+ + ++++ + V  CR ++   LP++NY VL+YL+ FL EV+  S  N M   N+A VF  +LIW
Sbjct:   11 SHPFYDVARHGILQVAGDDRQGRRIFTFSCCRLPPLHQLNHQRLLEYLKYTLDQHVENDYTIVYFHYGLSSQNKPSLGWLQNTYKEFDRKYKKNLKALYVVHPTSLIKALWNIFKPLISHKFGKKVTYCSNLRELREHLQCDQLLIP------------------PEVVRYDE-----------KLQNLHKGQPPPPTKT---PPPRPPLPTQQFGVSLQYLRDKNQGELIPPVLRWTVTYLREKGLRTEGLFRRSASAQTVRQVQRLYDQGKPVNFDDYGDMHLPAVILKTFLRELPQPLLTFQAYEQILGITSVESSLRVTHCR-LILRSLPEHNYAVLRYLMGFLHEVSLESISNKMNSSNLACVFGLNLIW 352          
BLAST of Rho GTPase-activating protein vs. Ensembl Mouse
Match: Arhgap8 (Rho GTPase activating protein 8 [Source:MGI Symbol;Acc:MGI:1920417])

HSP 1 Score: 245.358 bits (625), Expect = 1.133e-74
Identity = 138/375 (36.80%), Postives = 213/375 (56.80%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIW 1442
             H F D+A+  ++QVAGDDR G+++     CR+PP++ +N  R   Y   TL Q V NDY+++YFHYGL+ +N P + ++ N YK+ DR +KKNLK LY+VHPT+L+K + N   P  S K   K+     L+EL      DQ++IP                  P   ++D+           KL +   G       +         LP  QFGV+LQ+++  +    +PPV+   + YLR + L  EG+FRRSAS   + ++Q+ YD  + ++  +YGD HL A +LKTFLR L +PL+TF+ +++I+ + ++++ + V  CR ++   LP++NY VL+YL+ FL EV+  S  N M   N+A VF  +LIW
Sbjct:   11 SHPFYDVARHGILQVAGDDRQGRRIFTFSCCRLPPLHQLNHQRLLEYLKYTLDQHVENDYTIVYFHYGLSSQNKPSLGWLQNTYKEFDRKYKKNLKALYVVHPTSLIKALWNIFKPLISHKFGKKVTYCSNLRELREHLQCDQLLIP------------------PEVVRYDE-----------KLQNLHKGQPPPPTKT---PPPRPPLPTQQFGVSLQYLRDKNQGELIPPVLRWTVTYLREKGLRTEGLFRRSASAQTVRQVQRLYDQGKPVNFDDYGDMHLPAVILKTFLRELPQPLLTFQAYEQILGITSVESSLRVTHCR-LILRSLPEHNYAVLRYLMGFLHEVSLESISNKMNSSNLACVFGLNLIW 352          
BLAST of Rho GTPase-activating protein vs. Ensembl Mouse
Match: Arhgap1 (Rho GTPase activating protein 1 [Source:MGI Symbol;Acc:MGI:2445003])

HSP 1 Score: 244.202 bits (622), Expect = 3.786e-74
Identity = 138/378 (36.51%), Postives = 217/378 (57.41%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYH-SKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            D  + DIA+  +V+VAGDD++G+K+I+  ACR+PP + ++  +   Y   TL Q+V +DY+L+Y H+GLT  N P + ++ +AY++ DR +KKN+K LYIVHPT  +K ++    P  S K   KI  V  L EL     L+Q+ IP  +                   K+DDF    +K       SP++                  LP  QFGV+LQH+++    +  +P V+ + + YL++  L  EGIFRRSA+   + E+Q+KY++   +D  +Y + HL A +LKTFLR L EPL+TF+L+  ++   N+     V++ +Q V   LP+ NY VL +L  FL++++ H D+N MT  N+A VF P+L+W++
Sbjct:   61 DDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLSWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPLISFKFGRKIFYVNYLSELSEHVKLEQLGIPRQV------------------LKYDDFLKSTQK-------SPATAPKPMPPRP--------PLPNQQFGVSLQHLQEKSPGQDPIPIVLRETVAYLQAHALTTEGIFRRSANTQVVREVQQKYNMGLPVDFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVEVTQQ-VLQTLPEENYQVLHFLTAFLVQISAHCDQNKMTNTNLAVVFGPNLLWAK 404          
BLAST of Rho GTPase-activating protein vs. Ensembl Mouse
Match: Arhgap1 (Rho GTPase activating protein 1 [Source:MGI Symbol;Acc:MGI:2445003])

HSP 1 Score: 244.202 bits (622), Expect = 3.786e-74
Identity = 138/378 (36.51%), Postives = 217/378 (57.41%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYH-SKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            D  + DIA+  +V+VAGDD++G+K+I+  ACR+PP + ++  +   Y   TL Q+V +DY+L+Y H+GLT  N P + ++ +AY++ DR +KKN+K LYIVHPT  +K ++    P  S K   KI  V  L EL     L+Q+ IP  +                   K+DDF    +K       SP++                  LP  QFGV+LQH+++    +  +P V+ + + YL++  L  EGIFRRSA+   + E+Q+KY++   +D  +Y + HL A +LKTFLR L EPL+TF+L+  ++   N+     V++ +Q V   LP+ NY VL +L  FL++++ H D+N MT  N+A VF P+L+W++
Sbjct:   61 DDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLSWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPLISFKFGRKIFYVNYLSELSEHVKLEQLGIPRQV------------------LKYDDFLKSTQK-------SPATAPKPMPPRP--------PLPNQQFGVSLQHLQEKSPGQDPIPIVLRETVAYLQAHALTTEGIFRRSANTQVVREVQQKYNMGLPVDFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVEVTQQ-VLQTLPEENYQVLHFLTAFLVQISAHCDQNKMTNTNLAVVFGPNLLWAK 404          
BLAST of Rho GTPase-activating protein vs. UniProt/SwissProt
Match: sp|Q9CXP4|RHG08_MOUSE (Rho GTPase-activating protein 8 OS=Mus musculus OX=10090 GN=Arhgap8 PE=2 SV=3)

HSP 1 Score: 245.358 bits (625), Expect = 7.928e-74
Identity = 138/375 (36.80%), Postives = 213/375 (56.80%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIW 1442
             H F D+A+  ++QVAGDDR G+++     CR+PP++ +N  R   Y   TL Q V NDY+++YFHYGL+ +N P + ++ N YK+ DR +KKNLK LY+VHPT+L+K + N   P  S K   K+     L+EL      DQ++IP                  P   ++D+           KL +   G       +         LP  QFGV+LQ+++  +    +PPV+   + YLR + L  EG+FRRSAS   + ++Q+ YD  + ++  +YGD HL A +LKTFLR L +PL+TF+ +++I+ + ++++ + V  CR ++   LP++NY VL+YL+ FL EV+  S  N M   N+A VF  +LIW
Sbjct:   11 SHPFYDVARHGILQVAGDDRQGRRIFTFSCCRLPPLHQLNHQRLLEYLKYTLDQHVENDYTIVYFHYGLSSQNKPSLGWLQNTYKEFDRKYKKNLKALYVVHPTSLIKALWNIFKPLISHKFGKKVTYCSNLRELREHLQCDQLLIP------------------PEVVRYDE-----------KLQNLHKGQPPPPTKT---PPPRPPLPTQQFGVSLQYLRDKNQGELIPPVLRWTVTYLREKGLRTEGLFRRSASAQTVRQVQRLYDQGKPVNFDDYGDMHLPAVILKTFLRELPQPLLTFQAYEQILGITSVESSLRVTHCR-LILRSLPEHNYAVLRYLMGFLHEVSLESISNKMNSSNLACVFGLNLIW 352          
BLAST of Rho GTPase-activating protein vs. UniProt/SwissProt
Match: sp|Q07960|RHG01_HUMAN (Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARHGAP1 PE=1 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 9.118e-74
Identity = 139/378 (36.77%), Postives = 216/378 (57.14%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCH-VPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            D  + DIA+  +V+VAGDD++G+K+I+  ACR+PP + ++  +   Y   TL Q+V +DY+L+Y H+GLT  N P + ++ +AY++ DR +KKN+K LYIVHPT  +K ++    P  S K   KI  V  L EL     L+Q+ IP                      K+DDF    +K       SP++                  LP  QFGV+LQH+++ + +   +P V+ + + YL++  L  EGIFRRSA+   + E+Q+KY++   +D  +Y + HL A +LKTFLR L EPL+TF+L+  ++   N+     V    Q V   LP+ NY VL++L  FL++++ HSD+N MT  N+A VF P+L+W++
Sbjct:   61 DDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLSWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPLISFKFGQKIFYVNYLSELSEHVKLEQLGIPR------------------QVLKYDDFLKSTQK-------SPATAPKPMPPRP--------PLPNQQFGVSLQHLQEKNPEQEPIPIVLRETVAYLQAHALTTEGIFRRSANTQVVREVQQKYNMGLPVDFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVPATLQ-VLQTLPEENYQVLRFLTAFLVQISAHSDQNKMTNTNLAVVFGPNLLWAK 404          
BLAST of Rho GTPase-activating protein vs. UniProt/SwissProt
Match: sp|Q5FWK3|RHG01_MOUSE (Rho GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Arhgap1 PE=1 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 2.648e-73
Identity = 138/378 (36.51%), Postives = 217/378 (57.41%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYH-SKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            D  + DIA+  +V+VAGDD++G+K+I+  ACR+PP + ++  +   Y   TL Q+V +DY+L+Y H+GLT  N P + ++ +AY++ DR +KKN+K LYIVHPT  +K ++    P  S K   KI  V  L EL     L+Q+ IP  +                   K+DDF    +K       SP++                  LP  QFGV+LQH+++    +  +P V+ + + YL++  L  EGIFRRSA+   + E+Q+KY++   +D  +Y + HL A +LKTFLR L EPL+TF+L+  ++   N+     V++ +Q V   LP+ NY VL +L  FL++++ H D+N MT  N+A VF P+L+W++
Sbjct:   61 DDPYYDIARHQIVEVAGDDKYGRKIIVFSACRMPPSHQLDHSKLLGYLKHTLDQYVESDYTLLYLHHGLTSDNKPSLSWLRDAYREFDRKYKKNIKALYIVHPTMFIKTLLILFKPLISFKFGRKIFYVNYLSELSEHVKLEQLGIPRQV------------------LKYDDFLKSTQK-------SPATAPKPMPPRP--------PLPNQQFGVSLQHLQEKSPGQDPIPIVLRETVAYLQAHALTTEGIFRRSANTQVVREVQQKYNMGLPVDFDQYNELHLPAVILKTFLRELPEPLLTFDLYPHVVGFLNIDESQRVEVTQQ-VLQTLPEENYQVLHFLTAFLVQISAHCDQNKMTNTNLAVVFGPNLLWAK 404          
BLAST of Rho GTPase-activating protein vs. UniProt/SwissProt
Match: sp|P85298|RHG08_HUMAN (Rho GTPase-activating protein 8 OS=Homo sapiens OX=9606 GN=ARHGAP8 PE=1 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 4.222e-69
Identity = 144/406 (35.47%), Postives = 214/406 (52.71%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRD-------------------------------FKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIW 1442
             H F D+A+  ++QVAGDDRFG++V+    CR+PP + ++  R   Y   TL Q+V NDY+++YFHYGL  +N P + ++ +AYK+ DR                                +KKNLK LY+VHPT+ +K + N L P  S K   K+I    L EL      DQ+VIP                  P   ++D+           KL S   G       +         LP  QFGV+LQ++K  +    +PPV+   + YLR + L  EG+FRRSAS   + EIQ+ Y+  + ++  +YGD H+ A +LKTFLR L +PL+TF+ +++I+ +  +++ + V  CRQI+   LP++NY VL+YL+ FL  V+  S  N M   N+A VF  +LIW
Sbjct:   11 SHPFYDVARHGILQVAGDDRFGRRVVTFSCCRMPPSHELDHQRLLEYLKYTLDQYVENDYTIVYFHYGLNSRNKPSLGWLQSAYKEFDRKDGDLTMWPRLVSNSKLKRSSHLSLPKYWDYRYKKNLKALYVVHPTSFIKVLWNILKPLISHKFGKKVIYFNYLSELHEHLKYDQLVIP------------------PEVLRYDE-----------KLQSLHEGRTPPPTKT---PPPRPPLPTQQFGVSLQYLKDKNQGELIPPVLRFTVTYLREKGLRTEGLFRRSASVQTVREIQRLYNQGKPVNFDDYGDIHIPAVILKTFLRELPQPLLTFQAYEQILGITCVESSLRVTGCRQILRS-LPEHNYVVLRYLMGFLHAVSRESIFNKMNSSNLACVFGLNLIW 383          
BLAST of Rho GTPase-activating protein vs. UniProt/SwissProt
Match: sp|Q9VTU3|RG68F_DROME (Rho GTPase-activating protein 68F OS=Drosophila melanogaster OX=7227 GN=RhoGAP68F PE=1 SV=1)

HSP 1 Score: 198.364 bits (503), Expect = 1.298e-55
Identity = 125/364 (34.34%), Postives = 200/364 (54.95%), Query Frame = 3
Query:  366 GDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKC--HVPPVMEQCIMYLR-SECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            G D+ G+ +  IYA R P      L+ F    +K ++ FV NDY L+YFH GL + N P  +F+ N+YK++DR+F+KNLK LY+VHPT  ++ I N   PF S K + K++ +  L EL     L+++ +P+ I   D   + +  S++P T                    PSS  N   Q        +K     QFGV L+ I   +S C   +PP++ +C+  L  +  ++ EGIFRRS +  +++ ++++ +  E +DL    + H+ A LLK+FLR L EPL+TFEL++++    +   +       Q++ + LP+ NY + KY++EFL+ V +  D N MT  N+A VF P+ +WSR
Sbjct:  105 GTDKQGRHIFGIYASRFP--EKSQLEGFVREIIKEIEPFVENDYILVYFHQGLKEDNKPSAQFLWNSYKELDRNFRKNLKTLYVVHPTWFIRVIWNFFSPFISDKFRKKLVYISSLDELRQALGLNKLKLPDNICDLD---DKLNPSRKPST------------------PPPSSNINASRQQQ------HKMATTHQFGVPLKFI-VMNSPCLNSIPPIVRKCVDSLSITGVIDTEGIFRRSGNHSEIMALKERVNRGEDVDLKSV-NVHVIAGLLKSFLRDLAEPLLTFELYEDVTGFLDWPKEERSRNVTQLIREKLPEENYELFKYIVEFLVRVMDCEDLNKMTSSNLAIVFGPNFLWSR 437          
BLAST of Rho GTPase-activating protein vs. TrEMBL
Match: A0A267EB39 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig029893g3 PE=4 SV=1)

HSP 1 Score: 322.398 bits (825), Expect = 4.420e-100
Identity = 183/458 (39.96%), Postives = 254/458 (55.46%), Query Frame = 3
Query:  165 FVGTQLTCKMAEENESEFSVGPDTSTLELF-DANFEKELGSSNKIFTSQDMIDHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAX-XXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHEXXXXXXXXXXXXXXXXXXNYEEIFAR 1532
            F  T  T   ++EN +  +      T E F D +FE  LGS      +QD++D EF DI+KL V+QV GDDR G+KVII  ACR+PP NT++  R   Y + TL Q+V NDY L+YFH+GL  KN P   ++  AY + DR +KKNLK   IVHPT L+K +     P  S K  +         +      +LDQM IP+ ++  D    S  ++   H    ++                       S            LP +QFGV+LQHIK Y++   + PV+E  + YLR  CL+ EGIFRRS S   + E+Q+KY+  E ++  +  DPHLAA LLKTFLR L EPL+TFEL+D +I+ H+L     V    ++V + LPD NY +L Y++ FL EVAE++ KN MT  N+  VF P+LIWSR + S +++     F  LL+ +Y +IF R
Sbjct:   57 FSKTGTTDDQSDENFAAAAAAGGRITPEGFIDEDFEDTLGSPATEVNTQDLVDTEFKDISKLGVIQVVGDDRLGRKVIIFSACRLPPSNTLDHQRLLKYIINTLNQYVENDYVLVYFHHGLNSKNKPSFAWLKQAYSEFDRKYKKNLKAFLIVHPTKLIKALYYLFRPLLSVKFGRKLAYVNYLSELKSHNLFLDQMPIPQRVREYDDSLRSGSRTGSSHYASSEEL-------------------GCASGGLGVGGLAANPLPTTQFGVSLQHIKHYNAGSVICPVVEHTVTYLRDCCLDVEGIFRRSCSVTLVREVQEKYNKGESVEFRDLADPHLAAVLLKTFLRELAEPLLTFELYDAVIENHSLPAKQKVGHAAELVSNQLPDDNYDLLNYIVHFLSEVAENASKNKMTAVNLGIVFGPNLIWSRQQASLTVMKPINCFAQLLISDYAQIFLR 495          
BLAST of Rho GTPase-activating protein vs. TrEMBL
Match: A0A267FHB0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig002115g2 PE=4 SV=1)

HSP 1 Score: 321.627 bits (823), Expect = 7.835e-100
Identity = 175/428 (40.89%), Postives = 242/428 (56.54%), Query Frame = 3
Query:  252 FDANFEKELGSSNKIFTSQDMIDHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAX-XXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHEXXXXXXXXXXXXXXXXXXNYEEIFAR 1532
             D +FE  LGS      +QD++D EF DI+KL V+QV GDDR G+KVII  ACR+PP NT++  R   Y + TL Q+V NDY L+YFH+GL  KN P   ++  AY + DR +KKNLK   IVHPT L+K +     P  S K  +         +      +LDQM IP+ ++  D    S  ++   H    ++                       S            LP +QFGV+LQHIK Y++   + PV+E  + YLR  CL+ EGIFRRS S   + E+Q+KY+  E ++  +  DPHLAA LLKTFLR L EPL+TFEL+D +I+ H+L     V    ++V + LPD NY +L Y++ FL EVAE++ KN MT  N+  VF P+LIWSR + S +++     F  LL+ +Y +IF R
Sbjct:   93 IDEDFEDTLGSPATEVNTQDLVDTEFKDISKLGVIQVVGDDRLGRKVIIFSACRLPPSNTLDHQRLLKYIINTLNQYVENDYVLVYFHHGLNSKNKPSFAWLKQAYSEFDRKYKKNLKAFLIVHPTKLIKALYYLFRPLLSVKFGRKLAYVNYLSELKSHNLFLDQMPIPQRVREYDDSLRSGSRTGSSHYASSEEL-------------------GCASGGLGVGGLAANPLPTTQFGVSLQHIKHYNAGSVICPVVEHTVTYLRDCCLDVEGIFRRSCSVTLVREVQEKYNKGESVEFRDLADPHLAAVLLKTFLRELAEPLLTFELYDAVIENHSLPAKQKVGHAAELVSNQLPDDNYDLLNYIVHFLSEVAENASKNKMTAVNLGIVFGPNLIWSRQQASLTVMKPINCFAQLLISDYAQIFLR 501          
BLAST of Rho GTPase-activating protein vs. TrEMBL
Match: A0A267FCW5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015581g2 PE=4 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 1.930e-99
Identity = 192/468 (41.03%), Postives = 271/468 (57.91%), Query Frame = 3
Query:  141 TFDDYEDDFVGTQL--TCKMAEENESEFSVGPDTSTLELF-DANFEKELGSSNKIFTSQDMIDHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQ-FYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHEXXXXXXXXXXXXXXXXXXNYEEIFAR 1532
            TF+DY+   V  QL       E++ S+ ++G    T E + D +FE  LGS      +QD++D EF +I++L ++QV GDDR G+KVII  ACR+PP   ++  R   Y + TL Q+V NDY L+YFH+GL  KN P   ++  AY + DR +KKNLK   IVHPT L+K +     PF S K   K+  V  L +L+SQ  Y DQ+ IP+ ++  D        ++   T ++                   S D  Y Q    N      LP +QFGV+LQHIK Y+    + PV+E  I YLR  CL+ EG+FRRS S  ++ ++Q+KY+  E++D  + G+PHLAA LLKTFLR L EPL+TFEL++ +I+ H L     V   R ++   LPD NY +L Y+ +FL EVA++S +N MT  N+  VF PSLIWSR + S +++     FT LL+L+Y  IF R
Sbjct:   76 TFEDYDAIPVEDQLYFMANNPEDDPSDENLGAGRITPEGYIDEDFEDTLGSPATEVNTQDLVDTEFKEISRLGIIQVVGDDRLGRKVIIFSACRLPPAENLDHQRLLKYIINTLSQYVENDYVLVYFHHGLNSKNKPSFAWLKQAYSEFDRKYKKNLKAFLIVHPTKLIKALYFLFKPFISVKFGRKLTYVNYLADLKSQNLYFDQLPIPQRVREYDDSIQPASGNRAALTSQYS-----------------RSEDFAYGQQLVAN-----PLPTTQFGVSLQHIKHYNGGSVICPVVEHTIKYLRECCLDVEGLFRRSCSVAQVQDVQEKYNRGEYVDFRDLGNPHLAAVLLKTFLRELAEPLLTFELYEAVIENHALPAKTKVSHARSLISQQLPDDNYDLLNYVAQFLSEVADNSTRNKMTALNLGIVFGPSLIWSRQQASLTVMKPINCFTQLLILHYNHIFVR 521          
BLAST of Rho GTPase-activating protein vs. TrEMBL
Match: A0A1I8HPU5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 5.365e-99
Identity = 188/465 (40.43%), Postives = 266/465 (57.20%), Query Frame = 3
Query:  141 TFDDYEDDFVGTQLTCKMAEENESEFSVGPDTSTLELFDANFEKELGSSNKIFTSQDMIDHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQ-FYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHEXXXXXXXXXXXXXXXXXXNYEEIFAR 1532
            TF+DY++D          ++EN     + P+       D +FE  LGS      +QD++D EF +I++L ++QV GDDR G+KVII  ACR+PP   ++  R   Y + TL Q+V NDY L+YFH+GL  KN P   ++  AY + DR +KKNLK   IVHPT L+K +     PF S K   K+  V  L +L+SQ  Y DQ+ IP+ ++  D        ++   T ++                   S D  Y Q    N      LP +QFGV+LQHIK Y+    + PV+E  I YLR  CL+ EG+FRRS S  ++ ++Q+KY+  E++D  + G+PHLAA LLKTFLR L EPL+TFEL++ +I+ H L     V   R ++   LPD NY +L Y+ +FL EVA++S +N MT  N+  VF PSLIWSR + S +++     FT LL+L+Y  IF R
Sbjct:   61 TFEDYDED--------DPSDENLGAGRITPEG----YIDEDFEDTLGSPATEVNTQDLVDTEFKEISRLGIIQVVGDDRLGRKVIIFSACRLPPAENLDHQRLLKYIINTLSQYVENDYVLVYFHHGLNSKNKPSFAWLKQAYSEFDRKYKKNLKAFLIVHPTKLIKALYFLFKPFISVKFGRKLTYVNYLADLKSQNLYFDQLPIPQRVREYDDSIQPASGNRAALTSQYS-----------------RSEDFAYGQQLVAN-----PLPTTQFGVSLQHIKHYNGGSVICPVVEHTIKYLRECCLDVEGLFRRSCSVAQVQDVQEKYNRGEYVDFRDLGNPHLAAVLLKTFLRELAEPLLTFELYEAVIENHALPAKTKVSHARSLISQQLPDDNYDLLNYVAQFLSEVADNSTRNKMTALNLGIVFGPSLIWSRQQASLTVMKPINCFTQLLILHYNHIFVR 491          
BLAST of Rho GTPase-activating protein vs. TrEMBL
Match: A0A267DWH9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005901g2 PE=4 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 2.834e-98
Identity = 185/447 (41.39%), Postives = 262/447 (58.61%), Query Frame = 3
Query:  198 EENESEFSVGPDTSTLELF-DANFEKELGSSNKIFTSQDMIDHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQ-FYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHEXXXXXXXXXXXXXXXXXXNYEEIFAR 1532
            E++ S+ ++G    T E + D +FE  LGS      +QD++D EF +I++L ++QV GDDR G+KVII  ACR+PP   ++  R   Y + TL Q+V NDY L+YFH+GL  KN P   ++  AY + DR +KKNLK   IVHPT L+K +     PF S K   K+  V  L +L+SQ  Y DQ+ IP+ ++  D        ++   T ++                   S D  Y Q    N      LP +QFGV+LQHIK Y+    + PV+E  I YLR  CL+ EG+FRRS S  ++ ++Q+KY+  E++D  + G+PHLAA LLKTFLR L EPL+TFEL++ +I+ H L     V   R ++   LPD NY +L Y+ +FL EVA++S +N MT  N+  VF PSLIWSR + S +++     FT LL+L+Y  IF R
Sbjct:   73 EDDPSDENLGAGRITPEGYIDEDFEDTLGSPATEVNTQDLVDTEFKEISRLGIIQVVGDDRLGRKVIIFSACRLPPAENLDHQRLLKYIINTLSQYVENDYVLVYFHHGLNSKNKPSFAWLKQAYSEFDRKYKKNLKAFLIVHPTKLIKALYFLFKPFISVKFGRKLTYVNYLADLKSQNLYFDQLPIPQRVREYDDSIQPASGNRAALTSQYS-----------------RSEDFAYGQQLVAN-----PLPATQFGVSLQHIKHYNGGSVICPVVEHTIKYLRECCLDVEGLFRRSCSVAQVQDVQEKYNRGEYVDFRDLGNPHLAAVLLKTFLRELAEPLLTFELYEAVIENHALPAKTKVSHARSLISQQLPDDNYDLLNYVAQFLSEVADNSTRNKMTALNLGIVFGPSLIWSRQQASLTVMKPINCFTQLLILHYNHIFVR 497          
BLAST of Rho GTPase-activating protein vs. Ensembl Cavefish
Match: ARHGAP8 (Rho GTPase activating protein 8 [Source:NCBI gene;Acc:103027805])

HSP 1 Score: 234.958 bits (598), Expect = 6.824e-71
Identity = 134/375 (35.73%), Postives = 212/375 (56.53%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIW 1442
             H + D+A+  ++QV GDD++G+K+II  +C +PP + +N  R   Y   TL Q+V +DY+++YFHYGL   N P ++++ +AY++ DR +KKNLK LY+VHPTN +K I N   P  S K   K+  V  L EL      DQ++IP  +                               HD +L +   G         P           QFGV+LQ+I++ ++   +PPVM Q + YL+ + L+ EGIFRRSA    + +IQK Y+  + +   +Y D H+ A +LKTFLR L EP++TF ++++I +L  +++ + V  C++I+ + LP++N+ V+KYL+ FL  V++ S  N M+  N+A VF  +L W
Sbjct:   42 SHPYYDVARHGILQVTGDDKYGRKLIIFSSCCMPPSHQLNHHRLLEYLKYTLDQYVESDYTVVYFHYGLRSINKPSLRWLRDAYREFDRKYKKNLKTLYVVHPTNFIKVIWNIFKPVISHKFGKKLTYVNYLAELREHLNYDQLIIPPAVLR-----------------------------HDEELRAAQKGGPPPPAKVPPPRPPLPT---QQFGVSLQYIREKNNNTLIPPVMFQTVSYLKLKGLKTEGIFRRSARVQLIKDIQKLYNQGKPVIFDQYSDVHVPAVILKTFLRELPEPVLTFTVYNQIQELTKVESSLRVSRCKRIM-ESLPEHNFIVVKYLVCFLHMVSQESISNKMSSSNLACVFGVNLAW 383          
BLAST of Rho GTPase-activating protein vs. Ensembl Cavefish
Match: arhgap1 (Rho GTPase activating protein 1 [Source:NCBI gene;Acc:103040311])

HSP 1 Score: 225.713 bits (574), Expect = 2.535e-67
Identity = 139/378 (36.77%), Postives = 215/378 (56.88%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKC-HVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            D  F DIAK  +V+VAGDD FG+KVI+  ACR+PP + ++  +   Y  +TL ++V +DY+LIYFH+G+T +N   + ++ +AY++ +R +KKN+K  YIVHPT  ++ ++    P  S K   KI  V  L ELE     DQ+VIP  ++                   +DD   +N K        PS    +   +S P +     LP  QFGV L  ++   +    +P V+   I +L+ + L+ EGIFRRSA+   +  IQ KY+  E ++  +  D HLAA +LKTFLR L EPL+TF L+++++   N+ ++  V +  Q +   LP+ NY  L++LI+FL +V+  S+ N MT  N+A VF P+L+W +
Sbjct:   61 DDPFYDIAKHQIVEVAGDDNFGRKVIVFSACRMPPHSQLDHHKLLMYLKQTLDKYVESDYTLIYFHHGMTSENKLSLSWLRDAYREFERKYKKNIKAFYIVHPTIFIRTVLIFFKPLISFKFGRKIHYVNYLSELEEIVKCDQLVIPSRVRA------------------YDDKIRLNLK--------PSV---VPGPISPPRSP---PLPFQQFGVPLSVLRDRGADADGIPLVIRDTISFLQEQGLQTEGIFRRSANVSLVKNIQLKYNSGEEVNFFQIEDVHLAAVILKTFLRELPEPLLTFRLYNDVVNFQNVDSESQV-VTIQNMLRSLPEENYATLRFLIQFLAQVSAESEANKMTNTNLAVVFGPNLLWGQ 405          
BLAST of Rho GTPase-activating protein vs. Ensembl Cavefish
Match: arhgap1 (Rho GTPase activating protein 1 [Source:NCBI gene;Acc:103040311])

HSP 1 Score: 208.764 bits (530), Expect = 8.537e-61
Identity = 138/385 (35.84%), Postives = 210/385 (54.55%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRS--------ECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            D  F DIAK  +V+VAGDD FG+KVI+  ACR+PP + ++  +   Y  +TL ++V +DY+LIYFH+G+T +N   + ++ +AY++ +R +KKN+K  YIVHPT  ++ ++    P  S K   KI  V  L ELE     DQ+VIP  ++                   +DD   +N K        PS    +   +S P +     LP  QFGV L  I         P  +   + ++ S          L+ EGIFRRSA+   +  IQ KY+  E ++  +  D HLAA +LKTFLR L EPL+TF L+++++   N ++D +  +  Q +   LP+ NY  L++LI+FL +V+  S+ N MT  N+A VF P+L+W +
Sbjct:   59 DDPFYDIAKHQIVEVAGDDNFGRKVIVFSACRMPPHSQLDHHKLLMYLKQTLDKYVESDYTLIYFHHGMTSENKLSLSWLRDAYREFERKYKKNIKAFYIVHPTIFIRTVLIFFKPLISFKFGRKIHYVNYLSELEEIVKCDQLVIPSRVRA------------------YDDKIRLNLK--------PSV---VPGPISPPRS---PPLPFQQFGVPLSVIVLCSDAVLFPHDISIYLFFVFSCSQFSLLHSGLQTEGIFRRSANVSLVKNIQLKYNSGEEVNFFQIEDVHLAAVILKTFLRELPEPLLTFRLYNDVV---NFQSDESQVVTIQNMLRSLPEENYATLRFLIQFLAQVSAESEANKMTNTNLAVVFGPNLLWGQ 408          
BLAST of Rho GTPase-activating protein vs. Ensembl Cavefish
Match: arhgap1 (Rho GTPase activating protein 1 [Source:NCBI gene;Acc:103040311])

HSP 1 Score: 202.216 bits (513), Expect = 8.749e-59
Identity = 124/378 (32.80%), Postives = 200/378 (52.91%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKC-HVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            D  F DIAK  +V+VAGDD FG+KVI+  ACR+PP + ++  +   Y  +TL ++V +DY+LIYFH+G+T +N   + ++ +AY++ +R+FK   K  Y+ + + L + +                               DQ+VIP  ++                   +DD   +N K        PS    +   +S P +     LP  QFGV L  ++   +    +P V+   I +L+ + L+ EGIFRRSA+   +  IQ KY+  E ++  +  D HLAA +LKTFLR L EPL+TF L+++++   N+ ++  V +  Q +   LP+ NY  L++LI+FL +V+  S+ N MT  N+A VF P+L+W +
Sbjct:   61 DDPFYDIAKHQIVEVAGDDNFGRKVIVFSACRMPPHSQLDHHKLLMYLKQTLDKYVESDYTLIYFHHGMTSENKLSLSWLRDAYREFERNFKFGRKIHYVNYLSELEEIV-----------------------------KCDQLVIPSRVRA------------------YDDKIRLNLK--------PSV---VPGPISPPRS---PPLPFQQFGVPLSVLRDRGADADGIPLVIRDTISFLQEQGLQTEGIFRRSANVSLVKNIQLKYNSGEEVNFFQIEDVHLAAVILKTFLRELPEPLLTFRLYNDVVNFQNVDSESQV-VTIQNMLRSLPEENYATLRFLIQFLAQVSAESEANKMTNTNLAVVFGPNLLWGQ 376          
BLAST of Rho GTPase-activating protein vs. Ensembl Cavefish
Match: ARHGAP17 (Rho GTPase activating protein 17 [Source:NCBI gene;Acc:103031684])

HSP 1 Score: 115.546 bits (288), Expect = 1.405e-26
Identity = 62/166 (37.35%), Postives = 97/166 (58.43%), Query Frame = 3
Query:  960 FGVTLQ-HIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHE 1454
            FG  L+ H+K+ + +  +P  +E C+M L    ++ EG+FR +A   KL +++   D +       Y DPH  A  LK++LR L EPLMTF+L+DE I+  N+           ++CD LP  N   L+YL++FL ++A+ S+ N MT  NIA V  P+L+W++ E
Sbjct:  253 FGTALEEHLKRTNREIALP--IEACVMMLLETGMKEEGLFRIAAGASKLKKLKAALDCSTSQLEEFYSDPHAVAGALKSYLRELPEPLMTFQLYDEWIQASNISDSDKRLQALWVICDSLPKANKANLRYLVKFLAKLAQESEVNKMTPSNIAIVLGPNLLWAKTE 416          
BLAST of Rho GTPase-activating protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002340.1 (pep scaffold:Pmarinus_7.0:GL481985:13400:22843:-1 gene:ENSPMAG00000002118.1 transcript:ENSPMAT00000002340.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 242.276 bits (617), Expect = 9.659e-75
Identity = 144/378 (38.10%), Postives = 213/378 (56.35%), Query Frame = 3
Query:  321 HEFSDIAKLNVVQV--AGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            H + D+A+  +V+V   G+D  G+KVII   CR+PP + +N  +   Y   TL Q+V +DY+LIYFHYGLT +N P  +++LNAY++ DR +KKNLK LY+VHPTN ++ + + L PF S K   K++    L EL  Q     ++IP                  P   +FD+     EK+   K+ +P++     + V  P T         QFGV L+ + + +S   +P V+   + YL+   L+ EGIFRRSAS   L E Q++Y+  + +D    GD HLAA +LKTFLR L EPL+TF L   I+ +  L+ D       ++V   LP+ N  VL +L++FL  V+ HS  N M+ +N+A VF P+L+W R
Sbjct:   13 HPYYDVARHGIVEVVGTGEDNLGRKVIIFSCCRMPPTHQLNHHKLLEYLRYTLDQYVESDYTLIYFHYGLTSENKPSFQWLLNAYREFDRKYKKNLKALYVVHPTNFIRVLWSFLKPFISYKFGRKVMYFNYLSELHQQMKDPMLIIP------------------PEVVRFDE-----EKNKRSKVMAPTAAQASVA-VDVPAT--------QQFGVGLKRLAE-NSGQLIPLVVRDTVAYLKEHGLQTEGIFRRSASTQALRETQERYNRGQPVDFQALGDVHLAAVILKTFLRELPEPLLTFSLFPYIVSVQGLEKDARGAAVVEMV-KKLPEENRAVLHHLLDFLKLVSPHSGVNKMSGENLAIVFGPNLVWER 356          
BLAST of Rho GTPase-activating protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006125.1 (pep scaffold:Pmarinus_7.0:GL477389:161447:166370:-1 gene:ENSPMAG00000005526.1 transcript:ENSPMAT00000006125.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 5.416e-28
Identity = 57/158 (36.08%), Postives = 98/158 (62.03%), Query Frame = 3
Query:  981 IKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYG--DPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            +K+  +   +P VM + + YL+   L+ EG+F+RS +   + E+Q+KY+L + +   EY   D  +AA  LKTFLR L EPL+T +L+ +I+ LH ++T + +   ++++   +P  NY+VLK+L+ FL  V + S  N  + +N+  VF P+L+W R
Sbjct:    1 LKEKSNGEDLPLVMRETVAYLKENGLKTEGLFQRSVNVQLIKEVQQKYNLGKPVRFDEYNKEDVRVAAVTLKTFLRELPEPLLTLQLYHKILALHRVETSLRITRIKEML-QTIPALNYNVLKFLMCFLNTVLDESIHNKTSARNLGFVFGPNLVWPR 157          
BLAST of Rho GTPase-activating protein vs. Ensembl Sea Lamprey
Match: ralbp1 (ralA binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2098])

HSP 1 Score: 90.1225 bits (222), Expect = 3.270e-19
Identity = 58/163 (35.58%), Postives = 88/163 (53.99%), Query Frame = 3
Query:  960 FGVTLQ---HIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKL--HNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPS 1433
            FG TL+   H    +    +P V  +CI Y+    L+CEGI+R S  K K+ E++  YD  E  +L +Y DPH  A +LK +LR L E L+T ELH +I +     L  D   + C++++ + LP +N H+L +L+  +  V  H   N M  Q I+ V  P+
Sbjct:  198 FGATLEEAVHRTALYDGVPLPAVCRECIDYIERNGLKCEGIYRVSGIKSKVDELKAIYDREESPNLEDY-DPHTVASVLKQYLRELPESLLTRELHPKIEEACSRPLVEDRLAE-CKRLLAE-LPKFNRHLLSWLMVHMDHVVLHESDNKMNVQGISIVLHPT 357          
BLAST of Rho GTPase-activating protein vs. Ensembl Sea Lamprey
Match: si:ch211-247j9.1 (si:ch211-247j9.1 [Source:ZFIN;Acc:ZDB-GENE-091204-212])

HSP 1 Score: 85.8853 bits (211), Expect = 5.705e-18
Identity = 45/143 (31.47%), Postives = 79/143 (55.24%), Query Frame = 3
Query: 1017 VMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQI--VCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLI 1439
            ++ QC+ ++R + L  EG+FR       + E+Q+ +D  E        D H  A L+K +LR L EP++ F L+ E +   +L      +  +++  + + LP  N+++LKY+  FL EV  H+  N M+ QN+A VF P+++
Sbjct:    1 LVTQCVNFIRCQGLAEEGLFRLPGQTNLVRELQEAFDCGERPIFDGDTDVHTVASLVKLYLRELPEPVVPFSLYSEFLSCASLLAKNQSEGVKELTQLVNSLPLANFNLLKYICSFLYEVQSHASINKMSIQNLATVFGPNIL 143          
BLAST of Rho GTPase-activating protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005293.1 (pep scaffold:Pmarinus_7.0:GL478264:159922:165142:-1 gene:ENSPMAG00000004822.1 transcript:ENSPMAT00000005293.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.2554 bits (186), Expect = 6.291e-16
Identity = 48/142 (33.80%), Postives = 75/142 (52.82%), Query Frame = 3
Query: 1017 VMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEH-IDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLI 1439
            V+E C  YL+   L+ EGIFR+  S  ++ E++ + +  E  +  +   D    A LLK  LR   EPL+  ELH  + +   L T         ++C ++P    H L++L+ FL  VAE ++ N MT  N+A VF P+L+
Sbjct:    2 VLEAC-RYLQDH-LDTEGIFRKPGSLSRMRELKARLERGEACLAGATVND---VAGLLKQHLREAAEPLVPRELHSSLRRAQQLATAEERTRATLLLCLLMPPATAHTLRFLMTFLHSVAERAEDNKMTATNLAVVFTPTLM 138          
BLAST of Rho GTPase-activating protein vs. Ensembl Yeast
Match: RGA1 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; RGA1 has a paralog, RGA2, that arose from the whole genome duplication [Source:SGD;Acc:S000005653])

HSP 1 Score: 68.9366 bits (167), Expect = 1.278e-12
Identity = 49/174 (28.16%), Postives = 86/174 (49.43%), Query Frame = 3
Query: 1005 HVPPVMEQCIMYLRS--ECLECEGIFRRSASKLKLLEIQKKYDL------NEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKL---------------------HNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLI 1439
             +P ++  CI ++ S  E +  EGI+R+S S+L + EI+K++         E  ++    D ++   +LK +LR L  P+ TF++++ +++L                      N  T M+     + + + LP  +Y VL+ L E + +V  +S  N MT  N+A VFAP LI
Sbjct:  803 EIPMILSVCIDFIESDEENMRSEGIYRKSGSQLVIEEIEKQFSAWKVQQNTETPNILTEQDLNVVTGVLKRYLRKLPNPIFTFQIYEPLMRLVKSKKMMENLPFVGGKLSLEAKNSDTYMSSKSALKNILEDLPREHYRVLRVLSEHIEKVTRYSHWNRMTLYNLALVFAPGLI 976          
BLAST of Rho GTPase-activating protein vs. Ensembl Yeast
Match: BAG7 (Rho GTPase activating protein (RhoGAP); stimulates the intrinsic GTPase activity of Rho1p, which plays a bud growth by regulating actin cytoskeleton organization and cell wall biosynthesis, resulting in the downregulation of Rho1p; structurally and functionally related to Sac7p; BAG7 has a paralog, SAC7, that arose from the whole genome duplication [Source:SGD;Acc:S000005660])

HSP 1 Score: 65.0846 bits (157), Expect = 1.057e-11
Identity = 54/187 (28.88%), Postives = 87/187 (46.52%), Query Frame = 3
Query:  924 NTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYG---------DPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCD------MLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLI 1439
              S  ++L  +Q  V +Q  K  +    +P V+ +   YL+   L+  GIFR + S  ++ E+Q  +         +YG         + H  A LLK +L SL EPL+   L+D I +   L+     +   QI+ D      +LP  N H++ YL   L   A +  KN+M+  N+A +  PSL+
Sbjct:   49 GVSLEESLKVAQEEVIIQ--KSTNEIGSIPVVIAKSGKYLKENALDTTGIFRIAGSNKRVRELQAVFS-----KPPDYGRKFEGWCDFNVHDIATLLKRYLNSLSEPLVPLALYD-IFRNPILENPKINEHKEQIIKDYEDIYMLLPQQNRHLILYLAALLNLFARNEKKNLMSASNLAAIVQPSLL 227          
BLAST of Rho GTPase-activating protein vs. Ensembl Yeast
Match: LRG1 (GTPase-activating protein (GAP); contains Rho1p-specific GAP activity, interacting with activated forms of Rho1p; functions along with Sac7p as a negative regulator of the Pkc1p-mediated cell wall integrity signaling pathway; negative regulator of cell wall 1,3-beta-glucan biosynthesis; required for efficient cell fusion; contains a RhoGAP domain and three Lin-11-Isl1-Mec-3 (LIM) domains [Source:SGD;Acc:S000002399])

HSP 1 Score: 65.0846 bits (157), Expect = 1.981e-11
Identity = 44/159 (27.67%), Postives = 83/159 (52.20%), Query Frame = 3
Query:  999 KCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLN--EHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFL-----IEVAEHSDKNMMTFQNIANVFAPSLIWSRHE 1454
            K  +P ++++ I  LR   +  EGIFR++ +  +L E+    D N  E  D S+     L+A LLK F+R L +P+++ +L++  IK   +  +        ++  +LP YN ++L+ L+ FL         E+   + M   N++ V  P++++ RH+
Sbjct:  751 KIRIPIIIDELISSLRQMDMSVEGIFRKNGNIRRLRELTANIDSNPTEAPDFSKENAIQLSA-LLKKFIRELPQPILSTDLYELWIKAAKIDLEDEKQRVILLIYSLLPTYNRNLLEALLSFLHWTSSFSYIENEMGSKMDIHNLSTVITPNILYLRHK 908          
BLAST of Rho GTPase-activating protein vs. Ensembl Yeast
Match: RGD1 (GTPase-activating protein (RhoGAP) for Rho3p and Rho4p; possibly involved in control of actin cytoskeleton organization [Source:SGD;Acc:S000000464])

HSP 1 Score: 56.9954 bits (136), Expect = 5.947e-9
Identity = 44/166 (26.51%), Postives = 79/166 (47.59%), Query Frame = 3
Query:  960 FGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLN-EHIDLSEYGDPH------LAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSL 1436
            FGV L+ + ++     VP ++ QCI  +    L+ EGI+R+SA+ L + +++++ D +  +I +     PH      L   LLKTF  SL + ++   L  EI     ++           +   LPD  Y  L+ L+  L  V  H  +N M  + +  ++ P++
Sbjct:  470 FGVPLESLIEFEQDM-VPAIVRQCIYVIDKFGLDQEGIYRKSANVLDVSKLKEEIDKDPANISMILPSKPHSDSDIYLVGSLLKTFFASLPDSVLPKALSSEIKVCLQIEDPTTRKNFMHGLIYNLPDAQYWTLRALVFHLKRVLAHEAQNRMNLRALCIIWGPTI 634          
BLAST of Rho GTPase-activating protein vs. Ensembl Yeast
Match: BEM3 (Rho GTPase activating protein (RhoGAP); involved in control of the cytoskeleton organization; targets the essential Rho-GTPase Cdc42p, which controls establishment and maintenance of cell polarity, including bud-site assembly [Source:SGD;Acc:S000006036])

HSP 1 Score: 56.9954 bits (136), Expect = 5.949e-9
Identity = 47/174 (27.01%), Postives = 84/174 (48.28%), Query Frame = 3
Query:  987 QYHSKCHVPPVMEQCIMYL-RSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGD----------PHL------AACLLKTFLRSLK------EPLMTFE-LHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSL 1436
            +Y +   +P V+ +C+ YL ++  ++ EGIFR S S   +  +Q+++D    +DL  Y +          P L       + LLK +LR L       E  ++F+ + DE    HN    +++     I   ++P  N  ++  L E L+ + E+S  N M  +N+  VF+P+L
Sbjct:  919 KYQNVYDLPSVVYRCLEYLYKNRGIQEEGIFRLSGSSTVIKTLQERFDKEYDVDLCRYNESIEAKDDEASPSLYIGVNTVSGLLKLYLRKLPHLLFGDEQFLSFKRVVDEN---HNNPVQISLGFKELIESGLVPHANLSLMYALFELLVRINENSKFNKMNLRNLCIVFSPTL 1089          
BLAST of Rho GTPase-activating protein vs. Ensembl Nematostella
Match: EDO47995 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKJ0])

HSP 1 Score: 99.3673 bits (246), Expect = 2.847e-22
Identity = 64/170 (37.65%), Postives = 101/170 (59.41%), Query Frame = 3
Query:  954 SQFGVTLQ-HIK-QYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYG-DPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHE 1454
            S FG  L+ H+K Q  S   +  V+E+C+ YL  E L+ +G+FR + S  K+ +++  +D    +DL+E+  D H    +LK +LR L EPLMTF L+D+ I+  +++   A       + D LP  N   L+YLI FL ++A++S+ N MT  NIA V AP++I+S  +
Sbjct:  251 SVFGCPLEEHLKVQRRS---IAFVLEECLTYLHEEALQEQGLFRMAGSSGKIRKLKAAFDAG-MVDLTEFDCDVHAITGVLKQYLRELPEPLMTFALYDDWIQAASIQDSGARLQAYWGLVDKLPKANKDNLRYLICFLGKLADYSEVNKMTASNIAIVIAPNIIYSEQD 416          
BLAST of Rho GTPase-activating protein vs. Ensembl Nematostella
Match: EDO42235 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S270])

HSP 1 Score: 92.4337 bits (228), Expect = 8.431e-20
Identity = 54/149 (36.24%), Postives = 79/149 (53.02%), Query Frame = 3
Query: 1002 CHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSE---YGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLI 1439
            C VP  +     +LR + +  EG+FR+S S      +Q++  L E I+L E      PH  A L+K F R L+EPL+T   HD  IK   ++ D         +C +LP  +   LKY ++FL E A HS+K+ M F N+A V  P+L+
Sbjct:   65 CSVPKFLVDSAKFLR-QHMNTEGLFRKSGS------VQRQKLLKERIELGEEISTAQPHDVAGLMKQFFRQLQEPLLTNTYHDSFIKTMRIEDDNTRTKAMLYICLLLPLAHLQALKYTMKFLAEFASHSEKSKMGFSNLAIVLTPNLM 206          
BLAST of Rho GTPase-activating protein vs. Ensembl Nematostella
Match: EDO46865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNI7])

HSP 1 Score: 85.1149 bits (209), Expect = 2.258e-17
Identity = 53/186 (28.49%), Postives = 100/186 (53.76%), Query Frame = 3
Query:  909 QVSYPNTSFYKALPE-----SQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEH--IDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVC--DMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLI 1439
            +++  N +  K L E     + F ++++ I    +   +P V+E C+ +++   L+  GIFR S S   + ++++ ++        L+ + D +  A LL+ + R L++PL     + + I+     T+   D+ RQ+ C  + LPD    V+KYL +FL +V+EHS++N M   N+A VF P+L+
Sbjct:  407 RIAAENQTLVKTLGELVDTANSFQLSIKQI----TGREIPEVVESCVRFIKRFGLDHPGIFRLSGSSTDINDMKQLFECGRDPLAGLNHWKDINAVAGLLRVYFRELEDPLFPSSHYQQFIEASRFPTNE--DVIRQVTCVINELPDSVNRVMKYLFKFLKQVSEHSEQNKMDAHNLAVVFGPTLL 586          
BLAST of Rho GTPase-activating protein vs. Ensembl Nematostella
Match: EDO47842 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKY9])

HSP 1 Score: 84.3445 bits (207), Expect = 4.515e-17
Identity = 55/160 (34.38%), Postives = 84/160 (52.50%), Query Frame = 3
Query:  957 QFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQI--VCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAP 1430
            QFGV L+ + +      +P V+ + + YL    L+ EGIFR S +   +  ++  +D +   DL E  D    A LLK FLR L EP +   L  + IK+H +  D   D   ++  + D LP  NY +LK+L  FL+EV+ + + N M+   +A VF P
Sbjct:  102 QFGVPLEEVTKSRDGSPIPWVLAKIVHYLSQCGLKHEGIFRVSGNHKVVESLKATFDRDGDADLEEC-DVMAVAGLLKLFLRELPEPPVPQALTTDFIKVHEVYGDDNPDCLDELRALLDKLPYLNYELLKFLCHFLVEVSMNEENNKMSTMALAIVFGP 260          
BLAST of Rho GTPase-activating protein vs. Ensembl Nematostella
Match: EDO49778 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFT9])

HSP 1 Score: 80.4925 bits (197), Expect = 3.982e-16
Identity = 55/163 (33.74%), Postives = 86/163 (52.76%), Query Frame = 3
Query:  960 FGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLN-EHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDL---CRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSL 1436
            FGV +  + Q   +    P++   I YL+  C+E  GIFR+S  K ++  ++   + N EH D  E   P+  A +LK + R L +P++T +L +  I +H  K  +  +L     Q    ++PD N   L+ L+ FL EVAE+S  N M  +N+   FAPSL
Sbjct:   18 FGVPMSVVLQRSGQPLPRPIL-CAINYLQRTCVESVGIFRKSGGKQRINNLKDMMEDNPEHTDF-EGMSPYDLADMLKQYFRDLPDPILTSKLAETFITIHTCKYYIPAELRVEAMQAAILLMPDENREALQTLLLFLNEVAENSAVNQMNEKNLGVCFAPSL 178          
BLAST of Rho GTPase-activating protein vs. Ensembl Medaka
Match: ENSORLT00000024110.2 (Rho GTPase activating protein 1 [Source:NCBI gene;Acc:101165860])

HSP 1 Score: 238.424 bits (607), Expect = 3.364e-72
Identity = 145/378 (38.36%), Postives = 219/378 (57.94%), Query Frame = 3
Query:  318 DHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCH-VPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSR 1448
            DH F DIA+ ++++VAGDD FG+KVI+  ACR+PP + ++  +   Y   TL Q+V +DY+LIYFH+GLT  N P + ++ +AYK+ DR +KKN+K LYIVHPT  +K ++    P  S K   KI  V  L ELE     +Q++IP+ ++                  ++DD    + K       SP     + +QV               FGV L  ++Q       VP VM+  I +L  + +E EGIFRRSA+   + E+Q KY+  E ++  +  D HLAA +LKTFLR L EPL+TF+L+++I+   +L +D  V++ + ++ + LP+ NY  L+YLI FL +V+ +S+ N MT  N+A VF P+L+W R
Sbjct:   59 DHPFYDIARHHIIEVAGDDNFGRKVIVFSACRMPPQHELDHHKLLMYLKATLDQYVESDYTLIYFHHGLTSLNKPSLGWLRDAYKEFDRKYKKNIKALYIVHPTLFIKTLLVLFKPIISLKFGRKINYVSYLSELEDVVKCEQLLIPQRVQ------------------EYDDKLRASAKPSSPPPMSPPRSPPLPNQV---------------FGVPLSQLRQRSPDGDPVPMVMKDTINFLSEQGVEIEGIFRRSANVTLVKEVQAKYNSGEPVNFRDMEDVHLAAVILKTFLRELPEPLLTFQLYNDIVNFGSLSSDCRVEVMKTML-ESLPEENYASLRYLITFLAQVSNNSEVNKMTTSNLAVVFGPNLLWGR 402          
BLAST of Rho GTPase-activating protein vs. Ensembl Medaka
Match: ARHGAP8 (Rho GTPase activating protein 8 [Source:NCBI gene;Acc:101163873])

HSP 1 Score: 199.904 bits (507), Expect = 7.637e-58
Identity = 130/387 (33.59%), Postives = 202/387 (52.20%), Query Frame = 3
Query:  291 KIFTSQDMIDHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRH 1451
            K+  + D   + F D+A+  ++QV+GDD FG+K I+  +CR+PP + ++  R   +   TL Q+V  DY L+YFH GL   N P +K++  AY + DR +KKNLK LY+VHPTN ++ + N   P  S K   K+  V  L EL      +Q+ IP      D  R                        HD KL +  S     +  +         LP  QFGVTL     Y + C    ++   +  L    L  EGIFRRS     + ++QK Y+  + +D   Y + H+ A +LK+FLR L EPL+TF +++++ ++  +++ + V  C+Q+V + LP++N+ VLK+L+ FL  V +    N M+  N+A VF  +L+W RH
Sbjct:   20 KVPITADDPSNPFYDVARHGIIQVSGDDLFGRKQIVFSSCRLPPSHQLDHRRLLQFLKFTLDQYVEMDYILVYFHCGLRSSNKPSVKWLREAYGEFDRKYKKNLKALYVVHPTNFIRIVWNIFKPLISRKFGKKLKYVNYLDELREHLNYEQLFIPA-----DVLR------------------------HDEKLRAAQSDAPPPAART---PPPRPPLPTQQFGVTL----HYSAPCAWETLVR--LQRLLLAGLRTEGIFRRSVQVQIIKDVQKLYNQGKPVDFDVYQNVHVPAVILKSFLRELPEPLLTFRVYNQVQEILGVESSLRVSRCKQVV-EGLPEHNFTVLKFLLGFLHTVTQEIIFNKMSASNLACVFGVNLVWPRH 367          
BLAST of Rho GTPase-activating protein vs. Ensembl Medaka
Match: arhgap17a (Rho GTPase activating protein 17 [Source:NCBI gene;Acc:101165596])

HSP 1 Score: 112.464 bits (280), Expect = 1.702e-25
Identity = 62/166 (37.35%), Postives = 96/166 (57.83%), Query Frame = 3
Query:  960 FGVTL-QHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHE 1454
            FG  L +H+K+   +  +P  ME C+M L    ++ EG+FR +A   KL +++   D +       Y DPH  A  LK++LR L EPLMT +L+DE I+  ++           +VCD LP  N + L+YL++FL ++A+ S+ N MT  NIA V  P+L+W++ E
Sbjct:  264 FGTALDEHLKRSAREIALP--MEACVMMLLETGMKEEGLFRIAAGASKLKKLKAALDCSTSQLEEFYSDPHAVAGALKSYLRELPEPLMTHQLYDEWIQASSVSDPDKRLQALWVVCDKLPKNNRNNLRYLVKFLAKLAQDSEANKMTPSNIAIVLGPNLLWAKTE 427          
BLAST of Rho GTPase-activating protein vs. Ensembl Medaka
Match: arhgap17a (Rho GTPase activating protein 17 [Source:NCBI gene;Acc:101165596])

HSP 1 Score: 112.079 bits (279), Expect = 1.878e-25
Identity = 62/166 (37.35%), Postives = 96/166 (57.83%), Query Frame = 3
Query:  960 FGVTL-QHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHE 1454
            FG  L +H+K+   +  +P  ME C+M L    ++ EG+FR +A   KL +++   D +       Y DPH  A  LK++LR L EPLMT +L+DE I+  ++           +VCD LP  N + L+YL++FL ++A+ S+ N MT  NIA V  P+L+W++ E
Sbjct:  264 FGTALDEHLKRSAREIALP--MEACVMMLLETGMKEEGLFRIAAGASKLKKLKAALDCSTSQLEEFYSDPHAVAGALKSYLRELPEPLMTHQLYDEWIQASSVSDPDKRLQALWVVCDKLPKNNRNNLRYLVKFLAKLAQDSEANKMTPSNIAIVLGPNLLWAKTE 427          
BLAST of Rho GTPase-activating protein vs. Ensembl Medaka
Match: arhgap17a (Rho GTPase activating protein 17 [Source:NCBI gene;Acc:101165596])

HSP 1 Score: 112.079 bits (279), Expect = 1.924e-25
Identity = 62/166 (37.35%), Postives = 96/166 (57.83%), Query Frame = 3
Query:  960 FGVTL-QHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHE 1454
            FG  L +H+K+   +  +P  ME C+M L    ++ EG+FR +A   KL +++   D +       Y DPH  A  LK++LR L EPLMT +L+DE I+  ++           +VCD LP  N + L+YL++FL ++A+ S+ N MT  NIA V  P+L+W++ E
Sbjct:  264 FGTALDEHLKRSAREIALP--MEACVMMLLETGMKEEGLFRIAAGASKLKKLKAALDCSTSQLEEFYSDPHAVAGALKSYLRELPEPLMTHQLYDEWIQASSVSDPDKRLQALWVVCDKLPKNNRNNLRYLVKFLAKLAQDSEANKMTPSNIAIVLGPNLLWAKTE 427          
BLAST of Rho GTPase-activating protein vs. Planmine SMEST
Match: SMESG000060252.1 (SMESG000060252.1)

HSP 1 Score: 906.746 bits (2342), Expect = 0.000e+0
Identity = 476/477 (99.79%), Postives = 477/477 (100.00%), Query Frame = 3
Query:  120 MTDLEGSTFDDYEDDFVGTQLTCKMAEENESEFSVGPDTSTLELFDANFEKELGSSNKIFTSQDMIDHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHEXXXXXXXXXXXXXXXXXXNYEEIFARESMGFM 1550
            MTDLEGSTFDDYEDDFVGTQLTCKMAEENESEFSVGPDTSTLELFDANFEKELGSSNKIFTSQDMIDHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAKVKSKIIKVKKLKELESQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKF+DFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHETSFSLIHIFIFFTHLLLLNYEEIFARESMGFM
Sbjct:    1 MTDLEGSTFDDYEDDFVGTQLTCKMAEENESEFSVGPDTSTLELFDANFEKELGSSNKIFTSQDMIDHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAKVKSKIIKVKKLKELESQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFNDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHETSFSLIHIFIFFTHLLLLNYEEIFARESMGFM 477          
BLAST of Rho GTPase-activating protein vs. Planmine SMEST
Match: SMESG000060252.1 (SMESG000060252.1)

HSP 1 Score: 830.476 bits (2144), Expect = 0.000e+0
Identity = 448/477 (93.92%), Postives = 448/477 (93.92%), Query Frame = 3
Query:  120 MTDLEGSTFDDYEDDFVGTQLTCKMAEENESEFSVGPDTSTLELFDANFEKELGSSNKIFTSQDMIDHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHEXXXXXXXXXXXXXXXXXXNYEEIFARESMGFM 1550
            MTDLEGSTFDDYEDDFVGTQLTCKMAEENESEFSVGPDTSTLELFDANFEKELGSSNKIFTSQDMIDHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAKVKSKIIKVKKLKELESQFYLDQMVIPEIIKT                             HDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHETSFSLIHIFIFFTHLLLLNYEEIFARESMGFM
Sbjct:    1 MTDLEGSTFDDYEDDFVGTQLTCKMAEENESEFSVGPDTSTLELFDANFEKELGSSNKIFTSQDMIDHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAKVKSKIIKVKKLKELESQFYLDQMVIPEIIKT-----------------------------HDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHETSFSLIHIFIFFTHLLLLNYEEIFARESMGFM 448          
BLAST of Rho GTPase-activating protein vs. Planmine SMEST
Match: SMESG000060252.1 (SMESG000060252.1)

HSP 1 Score: 698.738 bits (1802), Expect = 0.000e+0
Identity = 384/413 (92.98%), Postives = 384/413 (92.98%), Query Frame = 3
Query:  312 MIDHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHEXXXXXXXXXXXXXXXXXXNYEEIFARESMGFM 1550
            MIDHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAKVKSKIIKVKKLKELESQFYLDQMVIPEIIKT                             HDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHETSFSLIHIFIFFTHLLLLNYEEIFARESMGFM
Sbjct:    1 MIDHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAKVKSKIIKVKKLKELESQFYLDQMVIPEIIKT-----------------------------HDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHETSFSLIHIFIFFTHLLLLNYEEIFARESMGFM 384          
BLAST of Rho GTPase-activating protein vs. Planmine SMEST
Match: SMESG000032128.1 (SMESG000032128.1)

HSP 1 Score: 309.301 bits (791), Expect = 6.493e-99
Identity = 181/464 (39.01%), Postives = 275/464 (59.27%), Query Frame = 3
Query:  144 FDDYEDDFVGTQLTCKMAEENESEFSVGPDTSTLELFDANFEKELGSSNKIFTSQDMIDHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIPPINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAYKQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAXXXXXXXXXXXXXXXXXQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPES-QFGVTLQHIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPHLAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHEXXXXXXXXXXXXXXXXXXNYEEIFAR 1532
            FD+Y  D  G        ++    F  G  T    L + +FE+ELG + +  + Q++ID +F +I++L ++QVAGDD+ G+KVI+  ACR+P I  IN  R   Y  KTL+Q+V+NDY+L+YFHYG + +N P +K+ML AYK  DR+FKKNLK L++VHP+  +KF+ N   P  SAK   K++ V +L EL+  FY+DQ+ IP+ +K  D              +   +F+N N+  H              S+ ++  +S  K + ++ QF V L +I  ++    +P V+++ + YL+   LE EGIF RS S   +  +++K+D  E ++  +YGDPH+ A +LK FLR L EPL+TFEL+DEI+K+HNL     +   ++++ D LPD NY VL YLI FL EVA HS +N MT  ++  VF  +LIWS+   S + +     F   L+ NY++IF +
Sbjct:   36 FDEYGMDLGGNGEVYYDDDDEFGNFCQGRMTPD-GLIEDDFEEELGCAAQELSVQEVIDSDFPEISRLGILQVAGDDKLGRKVIVFSACRLPFIEQINHQRLLEYIKKTLEQYVTNDYALVYFHYGFSSRNKPSMKWMLQAYKDFDRNFKKNLKALHLVHPSGFIKFMWNLFRPVISAKFGRKVMYVNQLMELDDHFYIDQLPIPQRVKDYD-------TDIMMRKFNIQEFEN-NKPTHS-------------SKTTFMRSSISKEISKTQQFEVPLSYILAHNGGGSLPFVIQKTVTYLQIFGLEVEGIFLRSVSPDTVKRVKEKFDKGEDVNFEDYGDPHVPAVILKIFLRQLTEPLLTFELYDEIVKIHNLPPKNKIIAIKRMIMDYLPDENYEVLNYLITFLTEVAAHSSQNHMTAISLGVVFGANLIWSKQLVSLTTMSFINNFVQHLITNYDDIFVK 477          
BLAST of Rho GTPase-activating protein vs. Planmine SMEST
Match: SMESG000036427.1 (SMESG000036427.1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.953e-16
Identity = 61/205 (29.76%), Postives = 110/205 (53.66%), Query Frame = 3
Query:  846 INEKDHDMKLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQ----HIKQYHSKCHVPPVMEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDP--HLAACLLKTFLRSLKEPLMTFELHDEIIKL-HNLKTDMAVDLCRQIVCDMLPDYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLI 1439
            INE +H+    S +  D     + Y   S Y       FG  L+    H+K+ ++  +VP ++ +C  Y+R   L+ EGIFR++     ++++++  D   +    E+ +P  H    LLK +LR L EPL+ F  +D +  + + +  +  +DL ++ +  +LP  N+ +LKYL  FL EVA HS+ N M   ++A +F+P+++
Sbjct:   94 INE-NHNKYFLSTNDKDEAQKWIFYLKQSMYLDRGGGLFGTPLRLVLPHLKEEYN--YVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMRELVDRANY----EWDNPDVHTVCSLLKLYLRELPEPLIPFSNYDSLKAVGYRIDANENLDLVKEKL-RLLPVPNHQLLKYLCTFLTEVASHSE-NRMEISSLAKIFSPNIL 289          
The following BLAST results are available for this feature:
BLAST of Rho GTPase-activating protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGAP83.062e-7638.40Rho GTPase activating protein 8 [Source:HGNC Symbo... [more]
PRR5-ARHGAP82.357e-7538.40PRR5-ARHGAP8 readthrough [Source:HGNC Symbol;Acc:H... [more]
ARHGAP11.899e-7436.77Rho GTPase activating protein 1 [Source:HGNC Symbo... [more]
PRR5-ARHGAP81.457e-7236.99PRR5-ARHGAP8 readthrough [Source:HGNC Symbol;Acc:H... [more]
ARHGAP88.792e-7035.47Rho GTPase activating protein 8 [Source:HGNC Symbo... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rga-11.170e-5833.86Rho GTPase Activating protein [Source:UniProtKB/T... [more]
rga-13.194e-2937.43Rho GTPase Activating protein [Source:UniProtKB/T... [more]
rga-13.194e-2937.43Rho GTPase Activating protein [Source:UniProtKB/T... [more]
rga-13.194e-2937.43Rho GTPase Activating protein [Source:UniProtKB/T... [more]
rga-13.194e-2937.43Rho GTPase Activating protein [Source:UniProtKB/T... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RhoGAP68F2.457e-5734.34gene:FBgn0036257 transcript:FBtr0334091[more]
RhoGAP68F1.203e-5634.34gene:FBgn0036257 transcript:FBtr0334093[more]
RhoGAP68F1.295e-5634.34gene:FBgn0036257 transcript:FBtr0075997[more]
RhoGAP68F1.295e-5634.34gene:FBgn0036257 transcript:FBtr0334092[more]
RhoGAP92B7.086e-1730.00gene:FBgn0038747 transcript:FBtr0344352[more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arhgap11.844e-7136.88Rho GTPase activating protein 1 [Source:ZFIN;Acc:Z... [more]
arhgap11.844e-7136.88Rho GTPase activating protein 1 [Source:ZFIN;Acc:Z... [more]
arhgap17b8.453e-2636.75Rho GTPase activating protein 17b [Source:ZFIN;Acc... [more]
arhgap17a1.376e-2536.75Rho GTPase activating protein 17a [Source:ZFIN;Acc... [more]
arhgap17a1.682e-2536.75Rho GTPase activating protein 17a [Source:ZFIN;Acc... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ublcp13.506e-6734.21ubiquitin like domain containing CTD phosphatase 1... [more]
ublcp14.116e-6734.30ubiquitin like domain containing CTD phosphatase 1... [more]
ublcp14.725e-6734.30ubiquitin like domain containing CTD phosphatase 1... [more]
ublcp15.038e-6433.68ubiquitin like domain containing CTD phosphatase 1... [more]
ARHGAP174.692e-2636.36Rho GTPase activating protein 17 [Source:NCBI gene... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arhgap81.133e-7436.80Rho GTPase activating protein 8 [Source:MGI Symbol... [more]
Arhgap81.133e-7436.80Rho GTPase activating protein 8 [Source:MGI Symbol... [more]
Arhgap81.133e-7436.80Rho GTPase activating protein 8 [Source:MGI Symbol... [more]
Arhgap13.786e-7436.51Rho GTPase activating protein 1 [Source:MGI Symbol... [more]
Arhgap13.786e-7436.51Rho GTPase activating protein 1 [Source:MGI Symbol... [more]
back to top
BLAST of Rho GTPase-activating protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CXP4|RHG08_MOUSE7.928e-7436.80Rho GTPase-activating protein 8 OS=Mus musculus OX... [more]
sp|Q07960|RHG01_HUMAN9.118e-7436.77Rho GTPase-activating protein 1 OS=Homo sapiens OX... [more]
sp|Q5FWK3|RHG01_MOUSE2.648e-7336.51Rho GTPase-activating protein 1 OS=Mus musculus OX... [more]
sp|P85298|RHG08_HUMAN4.222e-6935.47Rho GTPase-activating protein 8 OS=Homo sapiens OX... [more]
sp|Q9VTU3|RG68F_DROME1.298e-5534.34Rho GTPase-activating protein 68F OS=Drosophila me... [more]
back to top
BLAST of Rho GTPase-activating protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EB394.420e-10039.96Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FHB07.835e-10040.89Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FCW51.930e-9941.03Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HPU55.365e-9940.43Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DWH92.834e-9841.39Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGAP86.824e-7135.73Rho GTPase activating protein 8 [Source:NCBI gene;... [more]
arhgap12.535e-6736.77Rho GTPase activating protein 1 [Source:NCBI gene;... [more]
arhgap18.537e-6135.84Rho GTPase activating protein 1 [Source:NCBI gene;... [more]
arhgap18.749e-5932.80Rho GTPase activating protein 1 [Source:NCBI gene;... [more]
ARHGAP171.405e-2637.35Rho GTPase activating protein 17 [Source:NCBI gene... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002340.19.659e-7538.10pep scaffold:Pmarinus_7.0:GL481985:13400:22843:-1 ... [more]
ENSPMAT00000006125.15.416e-2836.08pep scaffold:Pmarinus_7.0:GL477389:161447:166370:-... [more]
ralbp13.270e-1935.58ralA binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
si:ch211-247j9.15.705e-1831.47si:ch211-247j9.1 [Source:ZFIN;Acc:ZDB-GENE-091204-... [more]
ENSPMAT00000005293.16.291e-1633.80pep scaffold:Pmarinus_7.0:GL478264:159922:165142:-... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RGA11.278e-1228.16GTPase-activating protein for polarity-establishme... [more]
BAG71.057e-1128.88Rho GTPase activating protein (RhoGAP); stimulates... [more]
LRG11.981e-1127.67GTPase-activating protein (GAP); contains Rho1p-sp... [more]
RGD15.947e-926.51GTPase-activating protein (RhoGAP) for Rho3p and R... [more]
BEM35.949e-927.01Rho GTPase activating protein (RhoGAP); involved i... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO479952.847e-2237.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422358.431e-2036.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468652.258e-1728.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478424.515e-1734.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497783.982e-1633.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000024110.23.364e-7238.36Rho GTPase activating protein 1 [Source:NCBI gene;... [more]
ARHGAP87.637e-5833.59Rho GTPase activating protein 8 [Source:NCBI gene;... [more]
arhgap17a1.702e-2537.35Rho GTPase activating protein 17 [Source:NCBI gene... [more]
arhgap17a1.878e-2537.35Rho GTPase activating protein 17 [Source:NCBI gene... [more]
arhgap17a1.924e-2537.35Rho GTPase activating protein 17 [Source:NCBI gene... [more]
back to top
BLAST of Rho GTPase-activating protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060252.10.000e+099.79SMESG000060252.1[more]
SMESG000060252.10.000e+093.92SMESG000060252.1[more]
SMESG000060252.10.000e+092.98SMESG000060252.1[more]
SMESG000032128.16.493e-9939.01SMESG000032128.1[more]
SMESG000036427.11.953e-1629.76SMESG000036427.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021616 ID=SMED30021616|Name=Rho GTPase-activating protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1749bp
GTTGTTTGATAATTTAACTTAGTAATTTGTGATTATTCAAACATTGTTAC
TTAATAGTGTTTATTGTACTTTATTAGTATTTGTATGTACTGTAATTGAA
ATTTCGAAAAAAAAATTAAATGACTGACCTCGAGGGATCAACATTTGATG
ATTATGAAGATGATTTTGTTGGAACACAATTAACTTGTAAAATGGCAGAA
GAAAATGAATCAGAATTCTCAGTTGGTCCAGATACAAGCACTTTAGAATT
ATTCGACGCAAATTTTGAAAAAGAATTAGGATCATCTAATAAGATATTCA
CATCTCAAGATATGATCGACCATGAATTCAGTGACATTGCAAAGCTTAAT
GTGGTTCAAGTGGCTGGAGATGACAGATTTGGAAAGAAAGTCATAATAAT
CTATGCCTGCAGAATACCCCCCATTAATACTATTAATCTCGATAGATTTT
GGGCGTACACTGTCAAAACTCTGAAGCAATTCGTATCAAATGATTACTCT
TTGATTTATTTCCATTACGGATTGACGGATAAAAATAATCCTGGCATCAA
ATTCATGCTTAACGCCTACAAGCAAATTGACAGAGATTTCAAAAAGAATT
TGAAAAATCTTTATATAGTTCATCCAACCAATCTATTGAAATTTATTATT
AATGCACTATTGCCATTCTTCAGTGCAAAAGTTAAAAGCAAAATTATCAA
AGTGAAGAAACTGAAAGAACTTGAAAGTCAATTCTATTTAGATCAAATGG
TTATTCCAGAAATTATTAAAACACAAGACAGATTCAGGAATTCAGTTGGT
CAATCTCAGCGGCCTCATACATGGAAATTCGATGACTTTAAAAATATCAA
TGAAAAGGATCATGATATGAAACTCGACTCCCCCAGTTCTGGCGATAATA
TCTATTCACAGGTTTCTTATCCAAATACTTCCTTTTACAAAGCTTTACCA
GAATCACAATTTGGAGTTACTTTGCAGCACATTAAACAATATCACTCCAA
ATGTCACGTGCCGCCGGTGATGGAACAGTGTATCATGTACTTGAGAAGCG
AATGTCTTGAATGCGAAGGAATCTTTCGCCGGAGTGCTTCTAAACTTAAA
TTATTAGAAATTCAAAAAAAATATGATTTGAATGAACACATAGATTTATC
AGAATATGGCGATCCTCATTTAGCAGCTTGTTTATTGAAAACATTCCTTA
GGTCACTCAAAGAGCCATTGATGACTTTTGAATTACACGATGAAATTATC
AAACTTCACAACCTGAAGACTGATATGGCTGTGGATTTATGTCGTCAAAT
TGTATGTGACATGCTCCCAGATTACAATTATCATGTTCTGAAATATCTGA
TTGAATTTCTTATTGAGGTCGCTGAGCATTCCGACAAAAATATGATGACA
TTCCAAAATATAGCCAATGTATTCGCCCCCAGCTTGATATGGTCGAGGCA
TGAGACTTCATTTTCACTTATTCACATTTTCATTTTCTTCACCCATCTTT
TATTGTTAAATTATGAAGAGATATTCGCAAGAGAATCAATGGGTTTCATG
TGATGAAATATAATTAATTTTCACTTTTTGCAGTGACCTAACAGCAATTG
TTCACATTTTCTATTTTTGAATAACTATTTTGTTATACTTATACTTTGTT
TATAAGTAATTTTCTTACAGCTTATTCAAAAGTTGGCTGATTAAGATTTT
CATCTATTTATTGTTTTGTGTTGTTTAAATATAGCCAGCTTTAATCTTG
back to top

protein sequence of SMED30021616-orf-1

>SMED30021616-orf-1 ID=SMED30021616-orf-1|Name=SMED30021616-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=478bp
MTDLEGSTFDDYEDDFVGTQLTCKMAEENESEFSVGPDTSTLELFDANFE
KELGSSNKIFTSQDMIDHEFSDIAKLNVVQVAGDDRFGKKVIIIYACRIP
PINTINLDRFWAYTVKTLKQFVSNDYSLIYFHYGLTDKNNPGIKFMLNAY
KQIDRDFKKNLKNLYIVHPTNLLKFIINALLPFFSAKVKSKIIKVKKLKE
LESQFYLDQMVIPEIIKTQDRFRNSVGQSQRPHTWKFDDFKNINEKDHDM
KLDSPSSGDNIYSQVSYPNTSFYKALPESQFGVTLQHIKQYHSKCHVPPV
MEQCIMYLRSECLECEGIFRRSASKLKLLEIQKKYDLNEHIDLSEYGDPH
LAACLLKTFLRSLKEPLMTFELHDEIIKLHNLKTDMAVDLCRQIVCDMLP
DYNYHVLKYLIEFLIEVAEHSDKNMMTFQNIANVFAPSLIWSRHETSFSL
IHIFIFFTHLLLLNYEEIFARESMGFM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036865CRAL-TRIO_dom_sf
IPR000198RhoGAP_dom
IPR001251CRAL-TRIO_dom
IPR008936Rho_GTPase_activation_prot
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000198Rho GTPase-activating protein domainSMARTSM00324RhoGAP_3coord: 295..466
e-value: 3.0E-47
score: 172.9
IPR000198Rho GTPase-activating protein domainPFAMPF00620RhoGAPcoord: 298..445
e-value: 2.0E-39
score: 134.8
IPR000198Rho GTPase-activating protein domainPROSITEPS50238RHOGAPcoord: 283..469
score: 36.812
IPR001251CRAL-TRIO lipid binding domainSMARTSM00516sec14_4coord: 72..221
e-value: 2.6E-7
score: 40.3
IPR001251CRAL-TRIO lipid binding domainPFAMPF13716CRAL_TRIO_2coord: 88..216
e-value: 4.8E-26
score: 91.6
IPR001251CRAL-TRIO lipid binding domainPROSITEPS50191CRAL_TRIOcoord: 69..224
score: 8.76
IPR001251CRAL-TRIO lipid binding domainCDDcd00170SEC14coord: 67..185
e-value: 7.06902E-13
score: 64.3286
IPR036865CRAL-TRIO lipid binding domain superfamilyGENE3DG3DSA:3.40.525.10coord: 67..210
e-value: 8.4E-37
score: 128.1
IPR036865CRAL-TRIO lipid binding domain superfamilySUPERFAMILYSSF52087CRAL/TRIO domaincoord: 69..210
IPR008936Rho GTPase activation proteinGENE3DG3DSA:1.10.555.10coord: 211..474
e-value: 4.1E-54
score: 185.4
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 277..469
NoneNo IPR availablePANTHERPTHR45808:SF4PRR5-ARHGAP8 READTHROUGH-RELATEDcoord: 248..472
coord: 65..232
NoneNo IPR availablePANTHERPTHR45808FAMILY NOT NAMEDcoord: 248..472
coord: 65..232