Nesprin-1

Overview
NameNesprin-1
Smed IDSMED30021613
Uniprot Best hitNesprin-1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=4 (E=1.49862e-66)
Length (bp)14045
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nesprin-1 (SMED30021613) t-SNE clustered cells

Violin plots show distribution of expression levels for Nesprin-1 (SMED30021613) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nesprin-1 (SMED30021613) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nesprin-1 (SMED30021613) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021613

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 34

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30021613SMESG000077685.1 SmedASXL_003005SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30021613SMESG000077685.1 SmedASXL_016623SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30021613SMESG000077685.1 SmedASXL_014121SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30021613SMESG000077685.1 SmedASXL_000441SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30021613SMESG000077685.1 SmedASXL_001434SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30021613SMESG000077685.1 SmedASXL_005997SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30021613SMESG000077685.1 SmedASXL_016624SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30021613SMESG000077685.1 SmedASXL_000980SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30021613SMESG000077685.1 SmedASXL_014120SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
gutSMED30021613SMESG000077685.1 SMESG000072345.1 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021613SMESG000077685.1 SMESG000072345.1 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30021613SMESG000077685.1 SMESG000072345.1 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30021613SMESG000077685.1 dd_Smed_v4_10214_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30021613SMESG000077685.1 dd_Smed_v4_10214_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021613SMESG000077685.1 dd_Smed_v4_10214_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30021613SMESG000077685.1 dd_Smed_v4_10214_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30021613SMESG000077685.1 dd_Smed_v4_15904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30021613SMESG000077685.1 dd_Smed_v4_15904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021613SMESG000077685.1 dd_Smed_v4_15904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30021613SMESG000077685.1 dd_Smed_v4_15904_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30021613SMESG000077685.1 SMESG000072345.1 dd_Smed_v6_11466_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30021613SMESG000077685.1 dd_Smed_v6_10214_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30021613SMESG000077685.1 SMESG000072345.1 dd_Smed_v6_10214_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30021613SMESG000077685.1 SMESG000072345.1 dd_Smed_v6_10214_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021613SMESG000077685.1 SMESG000072345.1 dd_Smed_v6_10214_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30021613SMESG000077685.1 dd_Smed_v6_15904_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30021613SMESG000077685.1 dd_Smed_v6_15904_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021613SMESG000077685.1 SMESG000072345.1 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30021613SMESG000077685.1 SMESG000072345.1 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30021613SMESG000077685.1 SMESG000072345.1 dd_Smed_v4_11466_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021613SMESG000077685.1 dd_Smed_v4_10214_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30021613SMESG000077685.1 dd_Smed_v4_10214_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30021613SMESG000077685.1 dd_Smed_v4_10214_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30021613SMESG000077685.1 dd_Smed_v4_15904_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nesprin-1 vs. Ensembl Human
Match: SYNE1 (spectrin repeat containing nuclear envelope protein 1 [Source:HGNC Symbol;Acc:HGNC:17089])

HSP 1 Score: 258.07 bits (658), Expect = 2.813e-72
Identity = 202/594 (34.01%), Postives = 315/594 (53.03%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXX------------XXXXALGMANDPN--------AKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFP--NVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPAN---ISPKQLEAMKTRMENVCKAEGPVREKLNIFGIQANLKNKAQKWAVDLNSWDSPIQSKQDLLDKIEQFNISMENGTSMDKFTSQLDELVKRKVKFCKENPVLD--EDLLNFINKAINECEEENDILPEKFESTLMKLENLSSEWD 1873
            L+DEQE +QK+TFTKW+NS+L ++KPP+++ DL +D+ DG+ LL LLE+L+   L  E+ + M++IH ++NI TAL+F+E  +KIKLVNIN +D+ DG+P+IVLGL+WT IL+FQIEE                 + ++  +  P+         K++G AKK L+ W       + G+ +KDFG+SW  G AF++++H I P LV++E ++  +N+E LE+AF IAE ELGIP+LLD EDVDV+KPDEKSIMTYVAQFLK YP+        +E   E       M     ++ I +   D         N ++ Y  F     Q    R  ++ L+  +  D  L LD   V+Q    +D+   +L +W   LDK LP  LG+ IG+WL  AE +L E      VH++T N  + +KL++H+ +    +     F E+ +    N   + P QLE M  R   V         K+    ++  L +        L SW      ++ +   ++ +   +EN    +++      L +    + K +  ++  E+++ F+N+   +       L  +  S    LE + S WD
Sbjct:   21 LQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEG-RKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNASTDGQEDDREDRVIFKEM-----KVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEMKRKQIEHLIQPLHRDGKLSLDQALVKQ---SWDRVTSRLFDWHIQLDKSLPAPLGT-IGAWLYRAEVALREEITVQQVHEETANT-IQRKLEQHKDLLQNTDAHKRAFHEIYRTRSVNGIPVPPDQLEDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGRRESVEQLLQNYVSFIENSKFFEQYEVTYQILKQTAEMYVKADGSVEEAENVMKFMNETTAQWRN----LSVEVRSVRSMLEEVISNWD 599          
BLAST of Nesprin-1 vs. Ensembl Human
Match: SYNE1 (spectrin repeat containing nuclear envelope protein 1 [Source:HGNC Symbol;Acc:HGNC:17089])

HSP 1 Score: 257.684 bits (657), Expect = 6.240e-71
Identity = 207/625 (33.12%), Postives = 324/625 (51.84%), Query Frame = 2
Query:  161 TVVKKGVLLKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKK------IKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXX------------XXXXALGMANDPN--------AKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELD-----IVKDFNDKVDKNFENL--------NSKNNYDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFP--NVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPAN---ISPKQLEAMKTRMENVCKAEGPVREKLNIFGIQANLKNKAQKWAVDLNSWDSPIQSKQDLLDKIEQFNISMENGTSMDKFTSQLDELVKRKVKFCKENPVLD--EDLLNFINKAINECEEENDILPEKFESTLMKLENLSSEWDEISD 1885
            T+ K   ++KDEQE +QK+TFTKW+NS+L ++KPP+++ DL +D+ DG+ LL LLE+L+   L  E+ + M++IH ++NI TAL+F+E  K       IKLVNIN +D+ DG+P+IVLGL+WT IL+FQIEE                 + ++  +  P+         K++G AKK L+ W       + G+ +KDFG+SW  G AF++++H I P LV++E ++  +N+E LE+AF IAE ELGIP+LLD EDVDV+KPDEKSIMTYVAQFLK YP+        +E   EI  G  S              I K+    +++   +L        N ++ Y  F     Q    R  ++ L+  +  D  L LD   V+Q    +D+   +L +W   LDK LP  LG+ IG+WL  AE +L E      VH++T N  + +KL++H+ +    +     F E+ +    N   + P QLE M  R   V         K+    ++  L +        L SW      ++ +   ++ +   +EN    +++      L +    + K +  ++  E+++ F+N+   +       L  +  S    LE + S WD   +
Sbjct:    4 TIYKTPGMIKDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKSMHRGSPIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNASTDGQE-DDEILPGFPSFANSVQNFKREDRVIFKEMKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEMKRKQIEHLIQPLHRDGKLSLDQALVKQ---SWDRVTSRLFDWHIQLDKSLPAPLGT-IGAWLYRAEVALREEITVQQVHEETANT-IQRKLEQHKDLLQNTDAHKRAFHEIYRTRSVNGIPVPPDQLEDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGRRESVEQLLQNYVSFIENSKFFEQYEVTYQILKQTAEMYVKADGSVEEAENVMKFMNETTAQWRN----LSVEVRSVRSMLEEVISNWDRYGN 618          
BLAST of Nesprin-1 vs. Ensembl Human
Match: SYNE1 (spectrin repeat containing nuclear envelope protein 1 [Source:HGNC Symbol;Acc:HGNC:17089])

HSP 1 Score: 257.684 bits (657), Expect = 6.423e-71
Identity = 205/611 (33.55%), Postives = 321/611 (52.54%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXX------------XXXXALGMANDPN--------AKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELD-----IVKDFNDKVDKNFENL--------NSKNNYDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFP--NVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPAN---ISPKQLEAMKTRMENVCKAEGPVREKLNIFGIQANLKNKAQKWAVDLNSWDSPIQSKQDLLDKIEQFNISMENGTSMDKFTSQLDELVKRKVKFCKENPVLD--EDLLNFINKAINECEEENDILPEKFESTLMKLENLSSEWDEISD 1885
            L+DEQE +QK+TFTKW+NS+L ++KPP+++ DL +D+ DG+ LL LLE+L+   L  E+ + M++IH ++NI TAL+F+E  +KIKLVNIN +D+ DG+P+IVLGL+WT IL+FQIEE                 + ++  +  P+         K++G AKK L+ W       + G+ +KDFG+SW  G AF++++H I P LV++E ++  +N+E LE+AF IAE ELGIP+LLD EDVDV+KPDEKSIMTYVAQFLK YP+        +E   EI  G  S              I K+    +++   +L        N ++ Y  F     Q    R  ++ L+  +  D  L LD   V+Q    +D+   +L +W   LDK LP  LG+ IG+WL  AE +L E      VH++T N  + +KL++H+ +    +     F E+ +    N   + P QLE M  R   V         K+    ++  L +        L SW      ++ +   ++ +   +EN    +++      L +    + K +  ++  E+++ F+N+   +       L  +  S    LE + S WD   +
Sbjct:   21 LQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEG-RKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNASTDGQE-DDEILPGFPSFANSVQNFKREDRVIFKEMKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEMKRKQIEHLIQPLHRDGKLSLDQALVKQ---SWDRVTSRLFDWHIQLDKSLPAPLGT-IGAWLYRAEVALREEITVQQVHEETANT-IQRKLEQHKDLLQNTDAHKRAFHEIYRTRSVNGIPVPPDQLEDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGRRESVEQLLQNYVSFIENSKFFEQYEVTYQILKQTAEMYVKADGSVEEAENVMKFMNETTAQWRN----LSVEVRSVRSMLEEVISNWDRYGN 620          
BLAST of Nesprin-1 vs. Ensembl Human
Match: SYNE1 (spectrin repeat containing nuclear envelope protein 1 [Source:HGNC Symbol;Acc:HGNC:17089])

HSP 1 Score: 243.047 bits (619), Expect = 1.424e-68
Identity = 177/445 (39.78%), Postives = 259/445 (58.20%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKK------IKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXX------------XXXXALGMANDPN--------AKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELD-----IVKDFNDKVDKNFENL--------NSKNNYDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFP--NVHDKTFNDKVLQKLKEHESI 1384
            L+DEQE +QK+TFTKW+NS+L ++KPP+++ DL +D+ DG+ LL LLE+L+   L  E+ + M++IH ++NI TAL+F+E  K       IKLVNIN +D+ DG+P+IVLGL+WT IL+FQIEE                 + ++  +  P+         K++G AKK L+ W       + G+ +KDFG+SW  G AF++++H I P LV++E ++  +N+E LE+AF IAE ELGIP+LLD EDVDV+KPDEKSIMTYVAQFLK YP+        +E   EI  G  S              I K+    +++   +L        N ++ Y  F     Q    R  ++ L+  +  D  L LD   V+Q    +D+   +L +W   LDK LP  LG+ IG+WL  AE +L E      VH++T N  + +KL++H+ I
Sbjct:    4 LQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKSMHRGSPIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNASTDGQE-DDEILPGFPSFANSVQNFKREDRVIFKEMKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEMKRKQIEHLIQPLHRDGKLSLDQALVKQ---SWDRVTSRLFDWHIQLDKSLPAPLGT-IGAWLYRAEVALREEITVQQVHEETANT-IQRKLEQHKKI 442          
BLAST of Nesprin-1 vs. Ensembl Human
Match: SYNE1 (spectrin repeat containing nuclear envelope protein 1 [Source:HGNC Symbol;Acc:HGNC:17089])

HSP 1 Score: 257.684 bits (657), Expect = 6.609e-68
Identity = 204/608 (33.55%), Postives = 318/608 (52.30%), Query Frame = 2
Query:  161 TVVKKGVLLKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKK------IKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXX------------XXXXALGMANDPN--------AKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFP--NVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPAN---ISPKQLEAMKTRMENVCKAEGPVREKLNIFGIQANLKNKAQKWAVDLNSWDSPIQSKQDLLDKIEQFNISMENGTSMDKFTSQLDELVKRKVKFCKENPVLD--EDLLNFINKAINECEEENDILPEKFESTLMKLENLSSEWD 1873
            T+ K   ++KDEQE +QK+TFTKW+NS+L ++KPP+++ DL +D+ DG+ LL LLE+L+   L  E+ + M++IH ++NI TAL+F+E  K       IKLVNIN +D+ DG+P+IVLGL+WT IL+FQIEE                 + ++  +  P+         K++G AKK L+ W       + G+ +KDFG+SW  G AF++++H I P LV++E ++  +N+E LE+AF IAE ELGIP+LLD EDVDV+KPDEKSIMTYVAQFLK YP+        +E   E       M     ++ I +   D         N ++ Y  F     Q    R  ++ L+  +  D  L LD   V+Q    +D+   +L +W   LDK LP  LG+ IG+WL  AE +L E      VH++T N  + +KL++H+ +    +     F E+ +    N   + P QLE M  R   V         K+    ++  L +        L SW      ++ +   ++ +   +EN    +++      L +    + K +  ++  E+++ F+N+   +       L  +  S    LE + S WD
Sbjct:    4 TIYKTPGMIKDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEGRKSMHRGSPIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNASTDGQEDDREDRVIFKEM-----KVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEMKRKQIEHLIQPLHRDGKLSLDQALVKQ---SWDRVTSRLFDWHIQLDKSLPAPLGT-IGAWLYRAEVALREEITVQQVHEETANT-IQRKLEQHKDLLQNTDAHKRAFHEIYRTRSVNGIPVPPDQLEDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGRRESVEQLLQNYVSFIENSKFFEQYEVTYQILKQTAEMYVKADGSVEEAENVMKFMNETTAQWRN----LSVEVRSVRSMLEEVISNWD 597          
BLAST of Nesprin-1 vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 142.124 bits (357), Expect = 8.890e-33
Identity = 99/293 (33.79%), Postives = 156/293 (53.24%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNS 1063
            L+DE+E +QKKTFTKW+NS+L +    +     +        +L  L  +       +      +IHCL N+   L+F+ N + + L N+   D+VDG   + LGL+WT IL FQI++        +   +  N + +  AK+ L+ W     +    +N+K+F  SW DG AFNAL+H   P LV+ + ++K      L++AF+ AEN+LG+ K LD+EDV+V++PDEKSI+TYV  +   Y    K +NI  +   ++ + LM               NDK+   +E L+S
Sbjct:  103 LRDERELVQKKTFTKWVNSHLVRVSCKV---QDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRN-QHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQD--------ITFEDADNHETRS-AKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYY-HYFNKLKQDNIQGKRIGKVINELME--------------NDKMINRYETLSS 367          
BLAST of Nesprin-1 vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 140.969 bits (354), Expect = 1.870e-32
Identity = 99/293 (33.79%), Postives = 155/293 (52.90%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNS 1063
            L DE+E +QKKTFTKW+NS+L +    +     +        +L  L  +       +      +IHCL N+   L+F+ N + + L N+   D+VDG   + LGL+WT IL FQI++        +   +  N + +  AK+ L+ W     +    +N+K+F  SW DG AFNAL+H   P LV+ + ++K      L++AF+ AEN+LG+ K LD+EDV+V++PDEKSI+TYV  +   Y    K +NI  +   ++ + LM               NDK+   +E L+S
Sbjct:   34 LADERELVQKKTFTKWVNSHLVRVSCKV---QDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRN-QHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQD--------ITFEDADNHETRS-AKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYY-HYFNKLKQDNIQGKRIGKVINELME--------------NDKMINRYETLSS 298          
BLAST of Nesprin-1 vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 140.584 bits (353), Expect = 2.318e-32
Identity = 99/293 (33.79%), Postives = 155/293 (52.90%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNS 1063
            L DE+E +QKKTFTKW+NS+L +    +     +        +L  L  +       +      +IHCL N+   L+F+ N + + L N+   D+VDG   + LGL+WT IL FQI++        +   +  N + +  AK+ L+ W     +    +N+K+F  SW DG AFNAL+H   P LV+ + ++K      L++AF+ AEN+LG+ K LD+EDV+V++PDEKSI+TYV  +   Y    K +NI  +   ++ + LM               NDK+   +E L+S
Sbjct:   34 LADERELVQKKTFTKWVNSHLVRVSCKV---QDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRN-QHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQD--------ITFEDADNHETRS-AKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYY-HYFNKLKQDNIQGKRIGKVINELME--------------NDKMINRYETLSS 298          
BLAST of Nesprin-1 vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 140.584 bits (353), Expect = 2.364e-32
Identity = 99/293 (33.79%), Postives = 155/293 (52.90%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNS 1063
            L DE+E +QKKTFTKW+NS+L +    +     +        +L  L  +       +      +IHCL N+   L+F+ N + + L N+   D+VDG   + LGL+WT IL FQI++        +   +  N + +  AK+ L+ W     +    +N+K+F  SW DG AFNAL+H   P LV+ + ++K      L++AF+ AEN+LG+ K LD+EDV+V++PDEKSI+TYV  +   Y    K +NI  +   ++ + LM               NDK+   +E L+S
Sbjct:   34 LADERELVQKKTFTKWVNSHLVRVSCKV---QDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRN-QHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQD--------ITFEDADNHETRS-AKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYY-HYFNKLKQDNIQGKRIGKVINELME--------------NDKMINRYETLSS 298          
BLAST of Nesprin-1 vs. Ensembl Celegans
Match: vab-10 (VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EFM4])

HSP 1 Score: 125.561 bits (314), Expect = 9.841e-28
Identity = 85/275 (30.91%), Postives = 134/275 (48.73%), Query Frame = 2
Query:  191 DEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTA---------XXXXXXXXXXXXXXXALGMANDPNAKVKGQ----AKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGT--NKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQF---LKSYPEGKKPENISEEITAE 961
            DE++ +QKKTFTKW+N +L +    I        +        +  +   T  + +K     + H + N++  L+F++  K IKLVNI P D+V+G   + LGL+WT               +E  +   + A     +    + G     A+  L+ W     +    +N+ +F  SW DG AFNA++H    + ++  +I   +  N ERL NAF  A+ E G+ +LLD+EDVD   PDEKSI+TYV+     L   PE  + + + EE   E
Sbjct:   35 DERDNVQKKTFTKWVNKHLSKTDHKI----DDLFVDLRDGYALIALLEALTGERIQKENGYTRFHRIQNVQYCLDFLKK-KNIKLVNIRPEDIVEGNGKLTLGLIWTIILNFQVSVIRQRLLLESSQHEQMSAKHTTTNSQVSLHGSDATSARDALLQWARRVTAGYPRVNVNNFSSSWRDGLAFNAILHRYRSSAIDWNKISSDSVSNTERLNNAFAAADREFGVERLLDAEDVDTNNPDEKSIITYVSSLYNALPHEPEMSRLQKVQEEYIEE 304          
BLAST of Nesprin-1 vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0332404)

HSP 1 Score: 253.062 bits (645), Expect = 4.933e-66
Identity = 176/469 (37.53%), Postives = 268/469 (57.14%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAX---XXXXXXXXXXXXXXALG--------MANDPNAKVKGQ-----AKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLME-PFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISP-KQLEAMKTRMENVCKAEGPVREKLNIF 1537
            L++EQE++QKKTFT W+NSYL ++ PP+ I DL+ DL DG  L+ LLE+L+   L  EK + +++ H LSN  TAL+F+ + K+IKLVNINP+D+VDG+P +VLGL+WT I      +     E+L   +G        + N  +  +K +     A+K L+ W  NAL    G+ +KDFG SW DG AF AL+  I   LVN+ E++K +N++RLE AF++AE++LGI KLLD+EDVDV KPDEKSIMTYVAQFL  YPE K        +  E +     +V+   E + +   +       E L +++  D     ++  + +K L++  S   +L +      ++   + + + ++  W W LD  LPG  G+ +G WL +AE+ LM+   PN  ++     + +KL+EH+  F     +LA F    ++P A   P +QL  M+ R++ V       R +L   
Sbjct:  265 LQEEQERVQKKTFTNWINSYLLKRVPPLRIDDLINDLRDGTKLIALLEVLSGERLPVEKGRVLRRPHFLSNANTALQFLAS-KRIKLVNINPADLVDGRPPVVLGLIWTIILYFQIEENSRNLEYLGHGIGGSVSSLDSVGNQKHGDLKAEKWKQGARKTLLNWVTNALPKDSGVEVKDFGASWRDGVAFLALIDAIKANLVNLAELKKTSNRQRLETAFDVAESKLGIAKLLDAEDVDVPKPDEKSIMTYVAQFLHKYPEPKGASRDQSHVQQEADELRRFLVEKTTEYEPMVMMSSFPRDFGEYLLARSEVDAH---LAAYNRLKQLIESQS--GFLQVSRQSWEEINELWQRLQYQMMYWLWLLDSELPGDFGT-VGKWLAEAEKLLMDNDIPNAMNEETAAVISRKLEEHKLFFADLPRILAMFDNAKRSPVAQQIPLEQLRNMERRLQEVGPKAAERRIRLKFL 726          

HSP 2 Score: 53.9138 bits (128), Expect = 6.514e-6
Identity = 84/374 (22.46%), Postives = 162/374 (43.32%), Query Frame = 2
Query: 11141 YNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCS---DYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQ-IVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATELANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENA---EQGKTTNNTIQEIETLIKHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQDFLQS 12241
            Y  L    Q    K +  +   T++   + ++  WIE + Q L  CS   D  +    +  KL  +++L   L   GQ   +  +QD       +     Q  +++ M  ++ DW  +   + Q  S+L+   +R   F    ++L  WL++ E T       ++   E   E     +  +R KTL  EL     +  QL + A +L     D  N ++Q+R  +L N+    I  L ++  DY+   Q ++++EKW+ Q S +++  N+      + T   I++ E L+    +   N+     ++   GQA    I    +        ++  L  + +++N+L  +S+  ++ L +S+ K+  Y+D L S
Sbjct: 5834 YTKLLTSAQGLVAKIEKNLSDHTEFLNYKKEMDAWIEKAQQVLDDCSTDGDAAI----IAQKLDTVNSLASRLPE-GQ-HLLALVQDAYSKASNITPEDKQEKLRELMTKVREDWDALGLAVKQKLSDLKQAQNRWNDFAANKDKLEKWLNETETT-------LKVAPETKGELSEMKTLLERYKTLSNELKLKGNELEQLQSEARDLGT-EVDAVN-RLQSRCDKLKNDCSAHITALEQEMFDYNAYHQSLQDVEKWLLQISFQLMAHNSLFISNREQTQEQIKQHEALLVEIQKYQTNL----DDLNAKGQAQ---IKRYESSTPAIRPTVESQLKNIQDSYNSLLQTSVQIKNRLLESLAKFQEYEDTLDS 6185          
BLAST of Nesprin-1 vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0303388)

HSP 1 Score: 252.677 bits (644), Expect = 5.643e-66
Identity = 176/469 (37.53%), Postives = 268/469 (57.14%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAX---XXXXXXXXXXXXXXALG--------MANDPNAKVKGQ-----AKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLME-PFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISP-KQLEAMKTRMENVCKAEGPVREKLNIF 1537
            L++EQE++QKKTFT W+NSYL ++ PP+ I DL+ DL DG  L+ LLE+L+   L  EK + +++ H LSN  TAL+F+ + K+IKLVNINP+D+VDG+P +VLGL+WT I      +     E+L   +G        + N  +  +K +     A+K L+ W  NAL    G+ +KDFG SW DG AF AL+  I   LVN+ E++K +N++RLE AF++AE++LGI KLLD+EDVDV KPDEKSIMTYVAQFL  YPE K        +  E +     +V+   E + +   +       E L +++  D     ++  + +K L++  S   +L +      ++   + + + ++  W W LD  LPG  G+ +G WL +AE+ LM+   PN  ++     + +KL+EH+  F     +LA F    ++P A   P +QL  M+ R++ V       R +L   
Sbjct:  265 LQEEQERVQKKTFTNWINSYLLKRVPPLRIDDLINDLRDGTKLIALLEVLSGERLPVEKGRVLRRPHFLSNANTALQFLAS-KRIKLVNINPADLVDGRPPVVLGLIWTIILYFQIEENSRNLEYLGHGIGGSVSSLDSVGNQKHGDLKAEKWKQGARKTLLNWVTNALPKDSGVEVKDFGASWRDGVAFLALIDAIKANLVNLAELKKTSNRQRLETAFDVAESKLGIAKLLDAEDVDVPKPDEKSIMTYVAQFLHKYPEPKGASRDQSHVQQEADELRRFLVEKTTEYEPMVMMSSFPRDFGEYLLARSEVDAH---LAAYNRLKQLIESQS--GFLQVSRQSWEEINELWQRLQYQMMYWLWLLDSELPGDFGT-VGKWLAEAEKLLMDNDIPNAMNEETAAVISRKLEEHKLFFADLPRILAMFDNAKRSPVAQQIPLEQLRNMERRLQEVGPKAAERRIRLKFL 726          

HSP 2 Score: 53.5286 bits (127), Expect = 7.324e-6
Identity = 84/374 (22.46%), Postives = 162/374 (43.32%), Query Frame = 2
Query: 11141 YNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCS---DYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQ-IVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATELANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENA---EQGKTTNNTIQEIETLIKHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQDFLQS 12241
            Y  L    Q    K +  +   T++   + ++  WIE + Q L  CS   D  +    +  KL  +++L   L   GQ   +  +QD       +     Q  +++ M  ++ DW  +   + Q  S+L+   +R   F    ++L  WL++ E T       ++   E   E     +  +R KTL  EL     +  QL + A +L     D  N ++Q+R  +L N+    I  L ++  DY+   Q ++++EKW+ Q S +++  N+      + T   I++ E L+    +   N+     ++   GQA    I    +        ++  L  + +++N+L  +S+  ++ L +S+ K+  Y+D L S
Sbjct: 5834 YTKLLTSAQGLVAKIEKNLSDHTEFLNYKKEMDAWIEKAQQVLDDCSTDGDAAI----IAQKLDTVNSLASRLPE-GQ-HLLALVQDAYSKASNITPEDKQEKLRELMTKVREDWDALGLAVKQKLSDLKQAQNRWNDFAANKDKLEKWLNETETT-------LKVAPETKGELSEMKTLLERYKTLSNELKLKGNELEQLQSEARDLGT-EVDAVN-RLQSRCDKLKNDCSAHITALEQEMFDYNAYHQSLQDVEKWLLQISFQLMAHNSLFISNREQTQEQIKQHEALLVEIQKYQTNL----DDLNAKGQAQ---IKRYESSTPAIRPTVESQLKNIQDSYNSLLQTSVQIKNRLLESLAKFQEYEDTLDS 6185          
BLAST of Nesprin-1 vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0303389)

HSP 1 Score: 252.677 bits (644), Expect = 5.644e-66
Identity = 176/469 (37.53%), Postives = 268/469 (57.14%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAX---XXXXXXXXXXXXXXALG--------MANDPNAKVKGQ-----AKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLME-PFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISP-KQLEAMKTRMENVCKAEGPVREKLNIF 1537
            L++EQE++QKKTFT W+NSYL ++ PP+ I DL+ DL DG  L+ LLE+L+   L  EK + +++ H LSN  TAL+F+ + K+IKLVNINP+D+VDG+P +VLGL+WT I      +     E+L   +G        + N  +  +K +     A+K L+ W  NAL    G+ +KDFG SW DG AF AL+  I   LVN+ E++K +N++RLE AF++AE++LGI KLLD+EDVDV KPDEKSIMTYVAQFL  YPE K        +  E +     +V+   E + +   +       E L +++  D     ++  + +K L++  S   +L +      ++   + + + ++  W W LD  LPG  G+ +G WL +AE+ LM+   PN  ++     + +KL+EH+  F     +LA F    ++P A   P +QL  M+ R++ V       R +L   
Sbjct:  265 LQEEQERVQKKTFTNWINSYLLKRVPPLRIDDLINDLRDGTKLIALLEVLSGERLPVEKGRVLRRPHFLSNANTALQFLAS-KRIKLVNINPADLVDGRPPVVLGLIWTIILYFQIEENSRNLEYLGHGIGGSVSSLDSVGNQKHGDLKAEKWKQGARKTLLNWVTNALPKDSGVEVKDFGASWRDGVAFLALIDAIKANLVNLAELKKTSNRQRLETAFDVAESKLGIAKLLDAEDVDVPKPDEKSIMTYVAQFLHKYPEPKGASRDQSHVQQEADELRRFLVEKTTEYEPMVMMSSFPRDFGEYLLARSEVDAH---LAAYNRLKQLIESQS--GFLQVSRQSWEEINELWQRLQYQMMYWLWLLDSELPGDFGT-VGKWLAEAEKLLMDNDIPNAMNEETAAVISRKLEEHKLFFADLPRILAMFDNAKRSPVAQQIPLEQLRNMERRLQEVGPKAAERRIRLKFL 726          

HSP 2 Score: 53.5286 bits (127), Expect = 7.700e-6
Identity = 84/374 (22.46%), Postives = 162/374 (43.32%), Query Frame = 2
Query: 11141 YNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCS---DYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQ-IVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATELANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENA---EQGKTTNNTIQEIETLIKHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQDFLQS 12241
            Y  L    Q    K +  +   T++   + ++  WIE + Q L  CS   D  +    +  KL  +++L   L   GQ   +  +QD       +     Q  +++ M  ++ DW  +   + Q  S+L+   +R   F    ++L  WL++ E T       ++   E   E     +  +R KTL  EL     +  QL + A +L     D  N ++Q+R  +L N+    I  L ++  DY+   Q ++++EKW+ Q S +++  N+      + T   I++ E L+    +   N+     ++   GQA    I    +        ++  L  + +++N+L  +S+  ++ L +S+ K+  Y+D L S
Sbjct: 5834 YTKLLTSAQGLVAKIEKNLSDHTEFLNYKKEMDAWIEKAQQVLDDCSTDGDAAI----IAQKLDTVNSLASRLPE-GQ-HLLALVQDAYSKASNITPEDKQEKLRELMTKVREDWDALGLAVKQKLSDLKQAQNRWNDFAANKDKLEKWLNETETT-------LKVAPETKGELSEMKTLLERYKTLSNELKLKGNELEQLQSEARDLGT-EVDAVN-RLQSRCDKLKNDCSAHITALEQEMFDYNAYHQSLQDVEKWLLQISFQLMAHNSLFISNREQTQEQIKQHEALLVEIQKYQTNL----DDLNAKGQAQ---IKRYESSTPAIRPTVESQLKNIQDSYNSLLQTSVQIKNRLLESLAKFQEYEDTLDS 6185          
BLAST of Nesprin-1 vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0303383)

HSP 1 Score: 252.677 bits (644), Expect = 6.044e-66
Identity = 175/468 (37.39%), Postives = 267/468 (57.05%), Query Frame = 2
Query:  188 KDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAX---XXXXXXXXXXXXXXALG--------MANDPNAKVKGQ-----AKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLME-PFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISP-KQLEAMKTRMENVCKAEGPVREKLNIF 1537
            ++EQE++QKKTFT W+NSYL ++ PP+ I DL+ DL DG  L+ LLE+L+   L  EK + +++ H LSN  TAL+F+ + K+IKLVNINP+D+VDG+P +VLGL+WT I      +     E+L   +G        + N  +  +K +     A+K L+ W  NAL    G+ +KDFG SW DG AF AL+  I   LVN+ E++K +N++RLE AF++AE++LGI KLLD+EDVDV KPDEKSIMTYVAQFL  YPE K        +  E +     +V+   E + +   +       E L +++  D     ++  + +K L++  S   +L +      ++   + + + ++  W W LD  LPG  G+ +G WL +AE+ LM+   PN  ++     + +KL+EH+  F     +LA F    ++P A   P +QL  M+ R++ V       R +L   
Sbjct:  625 REEQERVQKKTFTNWINSYLLKRVPPLRIDDLINDLRDGTKLIALLEVLSGERLPVEKGRVLRRPHFLSNANTALQFLAS-KRIKLVNINPADLVDGRPPVVLGLIWTIILYFQIEENSRNLEYLGHGIGGSVSSLDSVGNQKHGDLKAEKWKQGARKTLLNWVTNALPKDSGVEVKDFGASWRDGVAFLALIDAIKANLVNLAELKKTSNRQRLETAFDVAESKLGIAKLLDAEDVDVPKPDEKSIMTYVAQFLHKYPEPKGASRDQSHVQQEADELRRFLVEKTTEYEPMVMMSSFPRDFGEYLLARSEVDAH---LAAYNRLKQLIESQS--GFLQVSRQSWEEINELWQRLQYQMMYWLWLLDSELPGDFGT-VGKWLAEAEKLLMDNDIPNAMNEETAAVISRKLEEHKLFFADLPRILAMFDNAKRSPVAQQIPLEQLRNMERRLQEVGPKAAERRIRLKFL 1085          

HSP 2 Score: 54.299 bits (129), Expect = 3.880e-6
Identity = 84/374 (22.46%), Postives = 162/374 (43.32%), Query Frame = 2
Query: 11141 YNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCS---DYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQ-IVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATELANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENA---EQGKTTNNTIQEIETLIKHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQDFLQS 12241
            Y  L    Q    K +  +   T++   + ++  WIE + Q L  CS   D  +    +  KL  +++L   L   GQ   +  +QD       +     Q  +++ M  ++ DW  +   + Q  S+L+   +R   F    ++L  WL++ E T       ++   E   E     +  +R KTL  EL     +  QL + A +L     D  N ++Q+R  +L N+    I  L ++  DY+   Q ++++EKW+ Q S +++  N+      + T   I++ E L+    +   N+     ++   GQA    I    +        ++  L  + +++N+L  +S+  ++ L +S+ K+  Y+D L S
Sbjct: 6193 YTKLLTSAQGLVAKIEKNLSDHTEFLNYKKEMDAWIEKAQQVLDDCSTDGDAAI----IAQKLDTVNSLASRLPE-GQH-LLALVQDAYSKASNITPEDKQEKLRELMTKVREDWDALGLAVKQKLSDLKQAQNRWNDFAANKDKLEKWLNETETT-------LKVAPETKGELSEMKTLLERYKTLSNELKLKGNELEQLQSEARDLGT-EVDAVN-RLQSRCDKLKNDCSAHITALEQEMFDYNAYHQSLQDVEKWLLQISFQLMAHNSLFISNREQTQEQIKQHEALLVEIQKYQTNL----DDLNAKGQAQ---IKRYESSTPAIRPTVESQLKNIQDSYNSLLQTSVQIKNRLLESLAKFQEYEDTLDS 6544          
BLAST of Nesprin-1 vs. Ensembl Fly
Match: Msp300 (gene:FBgn0261836 transcript:FBtr0303385)

HSP 1 Score: 252.292 bits (643), Expect = 8.820e-66
Identity = 175/468 (37.39%), Postives = 267/468 (57.05%), Query Frame = 2
Query:  188 KDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAX---XXXXXXXXXXXXXXALG--------MANDPNAKVKGQ-----AKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLME-PFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISP-KQLEAMKTRMENVCKAEGPVREKLNIF 1537
            ++EQE++QKKTFT W+NSYL ++ PP+ I DL+ DL DG  L+ LLE+L+   L  EK + +++ H LSN  TAL+F+ + K+IKLVNINP+D+VDG+P +VLGL+WT I      +     E+L   +G        + N  +  +K +     A+K L+ W  NAL    G+ +KDFG SW DG AF AL+  I   LVN+ E++K +N++RLE AF++AE++LGI KLLD+EDVDV KPDEKSIMTYVAQFL  YPE K        +  E +     +V+   E + +   +       E L +++  D     ++  + +K L++  S   +L +      ++   + + + ++  W W LD  LPG  G+ +G WL +AE+ LM+   PN  ++     + +KL+EH+  F     +LA F    ++P A   P +QL  M+ R++ V       R +L   
Sbjct:  625 REEQERVQKKTFTNWINSYLLKRVPPLRIDDLINDLRDGTKLIALLEVLSGERLPVEKGRVLRRPHFLSNANTALQFLAS-KRIKLVNINPADLVDGRPPVVLGLIWTIILYFQIEENSRNLEYLGHGIGGSVSSLDSVGNQKHGDLKAEKWKQGARKTLLNWVTNALPKDSGVEVKDFGASWRDGVAFLALIDAIKANLVNLAELKKTSNRQRLETAFDVAESKLGIAKLLDAEDVDVPKPDEKSIMTYVAQFLHKYPEPKGASRDQSHVQQEADELRRFLVEKTTEYEPMVMMSSFPRDFGEYLLARSEVDAH---LAAYNRLKQLIESQS--GFLQVSRQSWEEINELWQRLQYQMMYWLWLLDSELPGDFGT-VGKWLAEAEKLLMDNDIPNAMNEETAAVISRKLEEHKLFFADLPRILAMFDNAKRSPVAQQIPLEQLRNMERRLQEVGPKAAERRIRLKFL 1085          

HSP 2 Score: 53.5286 bits (127), Expect = 6.796e-6
Identity = 109/487 (22.38%), Postives = 207/487 (42.51%), Query Frame = 2
Query: 10802 AENELETLKANWSKLSKRINELNNLKMDLDKALEHFNIWLNNSCKWFVNITETRKKVFESNETLQMKNNLQALKDDITEHKVDLSRLQTFVDSLMKICNDETFQKTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCS---DYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQ-IVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATELANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENA---EQGKTTNNTIQEIETLIKHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQDFLQS 12241
            A + LE+  A W    ++ N++N     ++K +       N + +  VN     KK+ E  E L  K+N++ L D+      +L   Q+    +     D+T      E    Y  L    Q    K +  +   T++   + ++  WIE + Q L  CS   D  +    +  KL  +++L   L   GQ   +  +QD       +     Q  +++ M  ++ DW  +   + Q  S+L+   +R   F    ++L  WL++ E T       ++   E   E     +  +R KTL  EL     +  QL + A +L     D  N ++Q+R  +L N+    I  L ++  DY+   Q ++++EKW+ Q S +++  N+      + T   I++ E L+    +   N+     ++   GQA    I    +        ++  L  + +++N+L  +S+  ++ L +S+ K+  Y+D L S
Sbjct: 6100 ARSSLESCLAAWQTFLQKFNKINLWIETMNKRVTKSQEGENKTPEDLVNA----KKLLE--EVLAEKDNVEDLNDN-----CELLMEQSACTRI----RDQTI-----ETQANYTKLLTSAQGLVAKIEKNLSDHTEFLNYKKEMDAWIEKAQQVLDDCSTDGDAAI----IAQKLDTVNSLASRLPE-GQ-HLLALVQDAYSKASNITPEDKQEKLRELMTKVREDWDALGLAVKQKLSDLKQAQNRWNDFAANKDKLEKWLNETETT-------LKVAPETKGELSEMKTLLERYKTLSNELKLKGNELEQLQSEARDLGT-EVDAVN-RLQSRCDKLKNDCSAHITALEQEMFDYNAYHQSLQDVEKWLLQISFQLMAHNSLFISNREQTQEQIKQHEALLVEIQKYQTNL----DDLNAKGQA---QIKRYESSTPAIRPTVESQLKNIQDSYNSLLQTSVQIKNRLLESLAKFQEYEDTLDS 6544          
BLAST of Nesprin-1 vs. Ensembl Zebrafish
Match: syne1b (spectrin repeat containing, nuclear envelope 1b [Source:ZFIN;Acc:ZDB-GENE-071218-4])

HSP 1 Score: 263.462 bits (672), Expect = 4.436e-69
Identity = 179/470 (38.09%), Postives = 268/470 (57.02%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWT---------------AXXXXXXXXXXXXXXXALGMANDPN-----AKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYP-------EGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLME--PFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPAN---ISPKQLEAMKTRM 1486
            L+DEQE +QK+TFTKW+NS+L + KPP  + DL +D+ DG+ LL LLE+L+   L  E+ + +++IH +SNI TAL+F+E  +KIKLVNIN +D+ DG+P+IVLGL+WT               A+            + +    + P       K +G AK+ L+ W  N  + + G+ +KDFG SW  G AF++++H I P LV+M+ + K +N+E LE AF++AENELGIP+LLD EDVDV+KPDEKSIMTYVAQFLK YP       +G++ E    ++  E+   L  +     E D++     +   + E+L  K  Y  F     Q    +  ++ LL  +  D  L +D   V+Q    +D   ++L +W   LDK LPG LG  IG+WL  AE SL E  P    H++T N  + +KL++H+ +          F+++ ++   N   + P+QL+ M  R 
Sbjct:   21 LQDEQESVQKRTFTKWINSHLAKHKPPFEVNDLFEDIKDGVKLLALLEVLSGQRLPCEQGRQLKRIHWVSNIGTALKFLEG-RKIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPALQALSSSASSVDSMASSETGSPPMKRKVVTKFQGNAKRALLRWVQNTATKRLGIEVKDFGASWRSGVAFHSVIHAIRPELVDMDVVRKRSNRENLEEAFSVAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDPHQSETDGQQEEREERKVLREVKIWLDQL-----ERDVL-----RAQGSEESLTDK--YQAFKSFRVQYEMRKKQIESLLQPVHRDGKLSVDQAVVKQ---SWDHVSVRLLDWHIHLDKSLPGPLGV-IGAWLHRAELSLREDVPIQQAHEETAN-IIHRKLEQHKEVLKNLEGHRQTFQQIHRDRSVNGVPVPPEQLQDMAERF 472          

HSP 2 Score: 65.0846 bits (157), Expect = 3.566e-9
Identity = 104/477 (21.80%), Postives = 207/477 (43.40%), Query Frame = 2
Query: 10862 ELNNLKMDLDKALEHFNIWLNNSCKWFVNITETRKKVFESNETLQ----MKNNLQALKDDITEHKVDLSRLQTFVDSLMKICNDETFQ-KTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEH------TGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATEL-----ANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRI---INENAEQGKTTNNTIQEIETLI--KHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQD 12229
            E N+L   L++ L+ F+  L    +W + + +  +++    E +Q     K+ L+AL++   E   D   L+  ++ L +   D   Q + +  + KEYN L  +   EC   + L++   ++  +  D   W+  +     KC D     ++  S L  I     + E  GQ K       GE L+   A   ++ V+ ++   + DW  +   L+Q  + L+N  ++   F+     L +WL+D E       + L DL+  + +               R ++LL EL   +   L+L   A +L     A   F    SQ+  +Y+ LSN  K+K  ++ +  +++    Q ++E++ WV  TS  +       A++    +  I+ +E L+  +   EI   +L    E            ++  N ++D    ++  +  L ++++ L S+SI  +  L+ ++ +W +YQ+
Sbjct: 2937 EFNSLAAQLEQDLQEFSSKLQ---EWRIKLQQV-EEMSAGEEAVQGWQIAKDTLEALQN--VEPMSD--NLKCQLNDLCRFSRDLGAQSERVSALIKEYNSLSLQASRECQGKEKLLE--QRFRAAFRDFQQWLVNAKINTAKCFDVPQNLAEASSSLQKIQEFLSDREQ-GQGKLNTVAASGELLMSIAAKDRVESVRAKINSAREDWKTLMTNLHQRENALQNLQAQMRDFETSVEPLQDWLNDTEEAVQESSSRLQDLTAKKQELH-------------RLQSLLEELASKEPQLLRLREKAQQLWDGHTAGKGFVHRVSQLSAQYLALSNLTKEKASRIERVVSEHQLFSQGLKELQNWVSDTSHMLQTYCTPTADKNVLDSRMIK-LEALLTARQEKEIQLKMLLTRGE------------SVQRNTSADGVPLVRQQIEDLKDSWDGLLSASIQCKSQLEGALSQWTSYQE 3376          
BLAST of Nesprin-1 vs. Ensembl Zebrafish
Match: syne1b (spectrin repeat containing, nuclear envelope 1b [Source:ZFIN;Acc:ZDB-GENE-071218-4])

HSP 1 Score: 263.462 bits (672), Expect = 4.436e-69
Identity = 179/470 (38.09%), Postives = 268/470 (57.02%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWT---------------AXXXXXXXXXXXXXXXALGMANDPN-----AKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYP-------EGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLME--PFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPAN---ISPKQLEAMKTRM 1486
            L+DEQE +QK+TFTKW+NS+L + KPP  + DL +D+ DG+ LL LLE+L+   L  E+ + +++IH +SNI TAL+F+E  +KIKLVNIN +D+ DG+P+IVLGL+WT               A+            + +    + P       K +G AK+ L+ W  N  + + G+ +KDFG SW  G AF++++H I P LV+M+ + K +N+E LE AF++AENELGIP+LLD EDVDV+KPDEKSIMTYVAQFLK YP       +G++ E    ++  E+   L  +     E D++     +   + E+L  K  Y  F     Q    +  ++ LL  +  D  L +D   V+Q    +D   ++L +W   LDK LPG LG  IG+WL  AE SL E  P    H++T N  + +KL++H+ +          F+++ ++   N   + P+QL+ M  R 
Sbjct:   21 LQDEQESVQKRTFTKWINSHLAKHKPPFEVNDLFEDIKDGVKLLALLEVLSGQRLPCEQGRQLKRIHWVSNIGTALKFLEG-RKIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPALQALSSSASSVDSMASSETGSPPMKRKVVTKFQGNAKRALLRWVQNTATKRLGIEVKDFGASWRSGVAFHSVIHAIRPELVDMDVVRKRSNRENLEEAFSVAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDPHQSETDGQQEEREERKVLREVKIWLDQL-----ERDVL-----RAQGSEESLTDK--YQAFKSFRVQYEMRKKQIESLLQPVHRDGKLSVDQAVVKQ---SWDHVSVRLLDWHIHLDKSLPGPLGV-IGAWLHRAELSLREDVPIQQAHEETAN-IIHRKLEQHKEVLKNLEGHRQTFQQIHRDRSVNGVPVPPEQLQDMAERF 472          

HSP 2 Score: 65.0846 bits (157), Expect = 3.566e-9
Identity = 104/477 (21.80%), Postives = 207/477 (43.40%), Query Frame = 2
Query: 10862 ELNNLKMDLDKALEHFNIWLNNSCKWFVNITETRKKVFESNETLQ----MKNNLQALKDDITEHKVDLSRLQTFVDSLMKICNDETFQ-KTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEH------TGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATEL-----ANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRI---INENAEQGKTTNNTIQEIETLI--KHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQD 12229
            E N+L   L++ L+ F+  L    +W + + +  +++    E +Q     K+ L+AL++   E   D   L+  ++ L +   D   Q + +  + KEYN L  +   EC   + L++   ++  +  D   W+  +     KC D     ++  S L  I     + E  GQ K       GE L+   A   ++ V+ ++   + DW  +   L+Q  + L+N  ++   F+     L +WL+D E       + L DL+  + +               R ++LL EL   +   L+L   A +L     A   F    SQ+  +Y+ LSN  K+K  ++ +  +++    Q ++E++ WV  TS  +       A++    +  I+ +E L+  +   EI   +L    E            ++  N ++D    ++  +  L ++++ L S+SI  +  L+ ++ +W +YQ+
Sbjct: 2937 EFNSLAAQLEQDLQEFSSKLQ---EWRIKLQQV-EEMSAGEEAVQGWQIAKDTLEALQN--VEPMSD--NLKCQLNDLCRFSRDLGAQSERVSALIKEYNSLSLQASRECQGKEKLLE--QRFRAAFRDFQQWLVNAKINTAKCFDVPQNLAEASSSLQKIQEFLSDREQ-GQGKLNTVAASGELLMSIAAKDRVESVRAKINSAREDWKTLMTNLHQRENALQNLQAQMRDFETSVEPLQDWLNDTEEAVQESSSRLQDLTAKKQELH-------------RLQSLLEELASKEPQLLRLREKAQQLWDGHTAGKGFVHRVSQLSAQYLALSNLTKEKASRIERVVSEHQLFSQGLKELQNWVSDTSHMLQTYCTPTADKNVLDSRMIK-LEALLTARQEKEIQLKMLLTRGE------------SVQRNTSADGVPLVRQQIEDLKDSWDGLLSASIQCKSQLEGALSQWTSYQE 3376          
BLAST of Nesprin-1 vs. Ensembl Zebrafish
Match: syne1a (spectrin repeat containing, nuclear envelope 1a [Source:ZFIN;Acc:ZDB-GENE-030131-4172])

HSP 1 Score: 234.187 bits (596), Expect = 2.836e-60
Identity = 170/479 (35.49%), Postives = 259/479 (54.07%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDK------KIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALG---------------------MANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIF----ADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPF--PNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQ---------NPPANISPKQLEAMKTRMENV 1495
            L+DEQE +QK+TFTKW+NS+L ++ PP+++ DL +D+ DG++LL LLE+L+   L  E+ + +++IH ++N+  AL+F+E  +       IKLVNIN +DVVDG+P+IVLGL+WT I+ +   E+    L AL                      +   P    +G AK+ L+ W  N  + + GL++KDFG SW  G AF+A++  + P LVNME + +  N+E LE AF++AE ELGIP+LLD EDVDV+KPDEKSIMTYVAQFLK +P+ +  E   ++   E    L  +    ++++      D      +  +    Y  F         QR  ++  +     D  L  D   V+Q    +++   +L +W   LD  LP  LG E+G WL  AEE L E       HD+T      ++L++ E +      +L + ++ LQ         N P  I  +QL+ M  R+  +
Sbjct:   34 LRDEQEAVQKRTFTKWINSHLAKRNPPLVVSDLFEDVKDGVMLLALLEVLSGHKLPCEQGRKLRRIHWVANVGRALKFLEGRRVRQSIPTIKLVNINTTDVVDGRPSIVLGLIWT-IILYFQIEELTSHLPALQPQSSSNSSVESSNSTETSSPPVKRKPRLSFQGGAKRALLKWVQNTATKRMGLDVKDFGPSWRTGVAFHAVIFALRPHLVNMERVWRRGNRENLEEAFSLAERELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHHPDRQHTETGQQQEEKEQRKTLRELKAWADQME-----RDCAQAQRDGGSLTVRYQTFKRFRVQFEVQRRQVETCVQSTQKDGKLTADQALVKQA---WERLCKRLLDWHLQLDSSLPHPLG-EVGVWLHQAEEILREELIPQQAHDETAKAIHKKRLRDQEIL-----RLLERHKQTLQLIHRDRCVNNMP--IPTEQLQDMAERLHYI 495          

HSP 2 Score: 58.151 bits (139), Expect = 4.484e-7
Identity = 85/428 (19.86%), Postives = 181/428 (42.29%), Query Frame = 2
Query: 10964 KKVFESNETLQ-MKNNLQALKDDITEHKVDLSRLQTFVDSLMKICNDETFQKTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATEL-----ANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENAEQGKTTNNTIQEIETLIKHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQD 12229
            K V E  +T + M+  L+A  +++     DL      V +L+K+                +N L  +   EC   + L++   ++  S  D   W+  +  +  KC D           L  I     + E  GQ++    +  GE+L   LA   ++ ++ +    K DW  +   L +  + L+   S+ + F+     L +WL+  E   + + S   H  ++P +    S    + +TLL E+   + +   L   A  L     A  SF     Q+   Y+ LSN +K+K+ ++ +   ++    Q ++E++ WV        +E+ +  KT      +   LI    ++ A + + + + +++   +    ++  N +++    ++  +  L +++ +L S+SI  +  L+ ++  W +YQ+
Sbjct: 2910 KGVLEGLQTAEVMEEKLKAQLNELCGFSSDLGPQSDRVSALIKL----------------HNSLSLRASRECQNKEKLLE--QRFRSSLHDFRQWLVNANISTAKCFDSPHSIQDASIALQRIQEFMSDKEQ-GQTRLSAVLTYGEQLSSVLAAERVEAIRTKANTAKDDWKSLMDSLQRRETALQVLQSQMQDFEASIEPLQDWLNRTE-ISVQESSARLH--DLPAKRLELS----KLQTLLEEMRSRESELAGLRGRAHGLWDGQGAGKSFVHRVCQLAACYLALSNLIKEKVSRVERVVGEHQLFSQGLQELQNWV--------SESQQVLKTCRCPTSDKTVLITRMGQLEALLAACQGKEIQLKMLITRGESVQRNTSAEGVPVVRKQIQDLKDSWESLLSTSIQCKSQLEGALSHWTSYQE 3303          
BLAST of Nesprin-1 vs. Ensembl Zebrafish
Match: syne1a (spectrin repeat containing, nuclear envelope 1a [Source:ZFIN;Acc:ZDB-GENE-030131-4172])

HSP 1 Score: 233.417 bits (594), Expect = 5.361e-60
Identity = 170/479 (35.49%), Postives = 259/479 (54.07%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDK------KIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALG---------------------MANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIF----ADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPF--PNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQ---------NPPANISPKQLEAMKTRMENV 1495
            L+DEQE +QK+TFTKW+NS+L ++ PP+++ DL +D+ DG++LL LLE+L+   L  E+ + +++IH ++N+  AL+F+E  +       IKLVNIN +DVVDG+P+IVLGL+WT I+ +   E+    L AL                      +   P    +G AK+ L+ W  N  + + GL++KDFG SW  G AF+A++  + P LVNME + +  N+E LE AF++AE ELGIP+LLD EDVDV+KPDEKSIMTYVAQFLK +P+ +  E   ++   E    L  +    ++++      D      +  +    Y  F         QR  ++  +     D  L  D   V+Q    +++   +L +W   LD  LP  LG E+G WL  AEE L E       HD+T      ++L++ E +      +L + ++ LQ         N P  I  +QL+ M  R+  +
Sbjct:   34 LRDEQEAVQKRTFTKWINSHLAKRNPPLVVSDLFEDVKDGVMLLALLEVLSGHKLPCEQGRKLRRIHWVANVGRALKFLEGRRVRQSIPTIKLVNINTTDVVDGRPSIVLGLIWT-IILYFQIEELTSHLPALQPQSSSNSSVESSNSTETSSPPVKRKPRLSFQGGAKRALLKWVQNTATKRMGLDVKDFGPSWRTGVAFHAVIFALRPHLVNMERVWRRGNRENLEEAFSLAERELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHHPDRQHTETGQQQEEKEQRKTLRELKAWADQME-----RDCAQAQRDGGSLTVRYQTFKRFRVQFEVQRRQVETCVQSTQKDGKLTADQALVKQA---WERLCKRLLDWHLQLDSGLPHPLG-EVGVWLHQAEEILREELIPQQAHDETAKAIHKKRLRDQEIL-----RLLERHKQTLQLIHRDRCVNNMP--IPTEQLQDMAERLHYI 495          

HSP 2 Score: 57.7658 bits (138), Expect = 4.677e-7
Identity = 94/485 (19.38%), Postives = 206/485 (42.47%), Query Frame = 2
Query: 10964 KKVFESNETLQ-MKNNLQALKDDITEHKVDLSRLQTFVDSLMKICNDETFQKTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATEL-----ANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENAEQGKTTNNTIQEIETLIKHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQDFLQSTKLFLDN---ELPNWWRERNQDQMKSAYSNFNNEPIL-KEILDMDNKLNGLKT 12388
            K V E  +T + M+  L+A  +++     DL      V +L+K+                +N L  +   EC   + L++   ++  S  D   W+  +  +  KC D           L  I     + E  GQ++    +  GE+L   LA   ++ ++ +    K DW  +   L +  + L+   S+ + F+     L +WL+  E   + + S   H  ++P +    S    + +TLL E+   + +   L   A  L     A  SF     Q+   Y+ LSN +K+K+ ++ +   ++    Q ++E++ WV        +E+ +  KT      +   LI    ++ A + + + + +++   +    ++  N +++    ++  +  L +++ +L S+SI  +  L+ ++  W +YQ+ +   + +++     L N   +++  +M+   +N     +L +E+L   + L  + T
Sbjct: 2910 KGVLEGLQTAEVMEEKLKAQLNELCGFSSDLGPQSDRVSALIKL----------------HNSLSLRASRECQNKEKLLE--QRFRSSLHDFRQWLVNANISTAKCFDSPHSIQDASIALQRIQEFMSDKEQ-GQTRLSAVLTYGEQLSSVLAAERVEAIRTKANTAKDDWKSLMDSLQRRETALQVLQSQMQDFEASIEPLQDWLNRTE-ISVQESSARLH--DLPAKRLELS----KLQTLLEEMRSRESELAGLRGRAHGLWDGQGAGKSFVHRVCQLAACYLALSNLIKEKVSRVERVVGEHQLFSQGLQELQNWV--------SESQQVLKTCRCPTSDKTVLITRMGQLEALLAACQGKEIQLKMLITRGESVQRNTSAEGVPVVRKQIQDLKDSWESLLSTSIQCKSQLEGALSHWTSYQEDVSQFECWMERVEESLGN--SDKHYAEMRDKTANLGRAKLLYEEVLSHSSPLETIAT 3358          
BLAST of Nesprin-1 vs. Ensembl Zebrafish
Match: syne2b (spectrin repeat containing, nuclear envelope 2b [Source:ZFIN;Acc:ZDB-GENE-071218-5])

HSP 1 Score: 157.532 bits (397), Expect = 9.903e-42
Identity = 108/266 (40.60%), Postives = 149/266 (56.02%), Query Frame = 2
Query:  194 EQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWT--------------------------AXXXXXXXXXXXXXXXALGMANDPNAKVKGQAKKGLMAWTNNALSDKYG--LNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLK 907
            EQE++QK+TFT W+N+ L ++ PP+ + DL  +  DG  LLDLLE+++   + K++    Q     SNI  AL F++  K IKLVNIN SD++DGKP+I+LGLVWT                          A L  +               +  +A+ +  AKK L+ W       + G  LN+KDF  SW  G  F A++H + P +V++      TN++ LE AF+IAE EL IP+LLD  DVDV  PDEKSIMTYVAQFL+
Sbjct:    2 EQEQIQKRTFTNWINAQLSKRSPPVTVVDLFNEFRDGSRLLDLLEVMSGQRIVKKRRGTFQH---RSNIEKALAFLKK-KSIKLVNINVSDIMDGKPSIILGLVWTIIMHIHIEELASTLSFSSRQSSLESLASLDTRSTNSSARSSPVPPRGSPLHARFRVSAKKALLLWVREQ-CQRAGCTLNVKDFKVSWRSGVVFLAILHALRPNIVDLTRARTRTNRQNLEEAFHIAERELHIPRLLDPADVDVRDPDEKSIMTYVAQFLQ 262          
BLAST of Nesprin-1 vs. Ensembl Xenopus
Match: SYNE1 (spectrin repeat containing, nuclear envelope 1 [Source:NCBI gene;Acc:100145637])

HSP 1 Score: 238.81 bits (608), Expect = 1.537e-61
Identity = 207/631 (32.81%), Postives = 322/631 (51.03%), Query Frame = 2
Query:  152 RKDTVVKKGVLLKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDK-------KIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGM--------------ANDPNAK------VKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNM--EEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENIS-------------------EEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPF--PNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISP---KQLEAMKTRMENVCKAEGPVREKLNIFGIQANLKNKAQKWAVDLNSWDSPIQSKQDLLDKIEQFNISMENGTSMDKFTSQLDELVKRKVKFCKENPVLDEDLLNFINKAINECEEENDILPEKFESTLMKLENLSSEWDEISD 1885
            +K T  K      DEQE +QK+TFTKW+NS+L ++ PP++I +L +D+ DG  L+ LLE+L+   L  E+ + +++IH ++NI  AL+F+E  +       +IKLVNIN +D+ DG+P+IVLGL+WT IL+FQIEE    L Q   M              A  P  K      ++G AKK L+ W     + + G+ +KDFG SW +G AF+++++ I P LV+M  E++++ TN+E LE AF+IAENELGIP+LLD EDVDV+KPDEKSIMTY+AQFLK YP+   P + S                   E+   +I+   M    P +     K +             +  Y++      +R  ++ L+  +  D  L LD   V+Q    ++K   ++ +W   LDK LP  LG+ I SWL  AE ++ E       H++T N  + +KL++H+         +  F+E+ ++   N  P   +QLE M  R   V  +      KL    ++  L          L SW      ++D ++ + Q  I+  +G   ++F  Q  E   + +K   E  V  +     + K +NE   +   L  +  S    LE + + WD+ S+
Sbjct:   18 QKKTFNKMFFFFSDEQEAVQKRTFTKWINSHLAKRHPPMVINELFEDIKDGTKLIALLEVLSGQKLPCEQGRQLKRIHWVANIGAALKFLEGRRVMTFLIFQIKLVNINSTDIADGRPSIVLGLIWTIILYFQIEELTSNLPQLHAMSSSTSSVDSVVSSEAASPPIKRKIVNKIQGSAKKALLRWVQYTAAKRLGIEVKDFGPSWRNGIAFHSVIYAIRPDLVDMDIEKLKRRTNRENLEEAFSIAENELGIPRLLDPEDVDVDKPDEKSIMTYIAQFLKHYPD---PHHTSLDGQEDKDRIVLRDMKVWLEQFEKDISRAQMVESSPQDRYQSFKQY-------------RVQYEV------KRKQVEALIHPLGKDGKLSLDQTMVKQA---WEKVSSRIFDWHLQLDKSLPAPLGT-IASWLYRAEVAMREEIVVQQSHEETAN-IMHRKLEQHK---------VTSFQEIHRSRSVNGIPVPIEQLEDMAERFSYVASSSHLHMIKLEFMELKYRLLALLVLAESKLKSWIIKY-GRRDSVELLLQNYIAFIDG---NRFFEQY-EFTSQSLKQAAEMYVKADGSAENVTKFLNETTVQWKNLSVEVRSVRSMLEEVITNWDKYSN 607          

HSP 2 Score: 89.7373 bits (221), Expect = 1.654e-16
Identity = 118/512 (23.05%), Postives = 222/512 (43.36%), Query Frame = 2
Query: 10796 ETAENELETLKANWSKLSKRI------------------NELNNLKMDLDKALEHFNIWLNNSCKWFVNITE-----TRKKVFESNETLQMKNNLQALKDDITEHKVDLSRLQTFVDSLMKICND-ETFQKTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATEL-----ANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENAEQGK---TTNNTIQEIET--LIKHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQD 12229
            E  +NE+ +L+A+W +    I                   E +N    L+ A++ F+ +L    KW   + +     T K++ E  +  + K+ L AL D   EH  D   L+T ++ L +   D   +   +  + KEYN L  +    C   + +  L  ++  +  D   W+  +  T  KC D     S++ + L  I     E EN GQ K    +  GE L   L     ++ +Q+M   K DW      L+Q  S L N   + + F+  ++ +  WL   E   + D ++  H  ++P    +   +  + +++L E++ H+    +L   A +L     A  SF    SQ+  +Y+ LS+  K+K+ ++++  A++ Q  Q + E+E W+ + +I ++             ++ + ++E   L+K   EI  N+L    E            ++  N + +    +Q+ L  L   + +L  S I  + HL+ ++ KW +YQD
Sbjct: 1932 EQMDNEIHSLQADWKQWEDSICHSQKALDGLLNQMAISEQEFSNQVSKLEDAIQDFSFFLE---KWTQKLNQGEGKDTDKEIVE--QWHRQKDVLTALND--AEHVTD--ELKTKLNDLCRFSKDLSIYSAKVSSLIKEYNSLCLQASKGCQNKEQV--LQQRFRTAFRDFQQWLVNAKVTTAKCFDIPQSVSEVSANLQKIQECLSESEN-GQHKLQTVMTRGELLYSILTEEKAKVTRQKMLTAKDDWKGFISSLHQKESALENLQIQMKDFETSADPVQTWLSATEKI-VRDSNNRLH--DLP----SKKKEQQKLQSILEEISSHEPQITRLKEKAQQLREGQSACKSFAHRGSQLSAQYLALSSLTKEKMSRMDRIVAEHQQFSQGMIELEDWISE-AIHMLQSYCHPTADRSVLDSRMSKLEALLLVKQEKEIEMNMLLSRGE------------SVVRNTSPEGAPAIQNQLQDLKNTWASLLLSCIQCKSHLEGALSKWTSYQD 2411          
BLAST of Nesprin-1 vs. Ensembl Xenopus
Match: SYNE1 (spectrin repeat containing, nuclear envelope 1 [Source:NCBI gene;Acc:100145637])

HSP 1 Score: 216.853 bits (551), Expect = 6.634e-55
Identity = 175/513 (34.11%), Postives = 278/513 (54.19%), Query Frame = 2
Query:  218 TFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGM--------------ANDPNAK------VKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNM--EEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENIS-----EEITAEINSGLMSMVQPPNELDIVKDFN---DKVDKNFENL-----NSKNNYDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPF--PNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISP---KQLEAMKTRMENVCKAEGPVREKLNIFGIQANL-------KNKAQKWAVDLNSWDS 1603
            T  +++ S+L Q+ PP++I +L +D+ DG  L+ LLE+L+   L  E+ + +++IH ++NI  AL+F+E  ++IKLVNIN +D+ DG+P+IVLGL+WT IL+FQIEE    L Q   M              A  P  K      ++G AKK L+ W     + + G+ +KDFG SW +G AF+++++ I P LV+M  E++++ TN+E LE AF+IAENELGIP+LLD EDVDV+KPDEKSIMTY+AQFLK YP+   P + S     + + A          +   +  +++D     ++ +K+         + ++ Y  F     Q    R  ++ L+  +  D  L LD   V+Q    ++K   ++ +W   LDK LP  LG+ I SWL  AE ++ E       H++T N  + +KL++H+ +    +     F+E+ ++   N  P   +QLE M  R   V  +      KL    ++  L       ++K + W +     DS
Sbjct:   12 TLNQYVISFL-QRHPPMVINELFEDIKDGTKLIALLEVLSGQKLPCEQGRQLKRIHWVANIGAALKFLEG-RRIKLVNINSTDIADGRPSIVLGLIWTIILYFQIEELTSNLPQLHAMSSSTSSVDSVVSSEAASPPIKRKIVNKIQGSAKKALLRWVQYTAAKRLGIEVKDFGPSWRNGIAFHSVIYAIRPDLVDMDIEKLKRRTNRENLEEAFSIAENELGIPRLLDPEDVDVDKPDEKSIMTYIAQFLKHYPD---PHHTSLDGQEDSVMAGGTPSFSRSSKHREDRIVLRDMKVWLEQFEKDISRAQMVESSPQDRYQSFKQYRVQYEVKRKQVEALIHPLGKDGKLSLDQTMVKQA---WEKVSSRIFDWHLQLDKSLPAPLGT-IASWLYRAEVAMREEIVVQQSHEETAN-IMHRKLEQHKDVLKNLDGYKKAFQEIHRSRSVNGIPVPIEQLEDMAERFSYVASSSHLHMIKLEFMELKYRLLALLVLAESKLKSWIIKYGRRDS 514          

HSP 2 Score: 75.0998 bits (183), Expect = 4.177e-12
Identity = 95/399 (23.81%), Postives = 175/399 (43.86%), Query Frame = 2
Query: 10796 ETAENELETLKANWSKLSKRI------------------NELNNLKMDLDKALEHFNIWLNNSCKWFVNITE-----TRKKVFESNETLQMKNNLQALKDDITEHKVDLSRLQTFVDSLMKICND-ETFQKTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATEL-----ANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWV 11905
            E  +NE+ +L+A+W +    I                   E +N    L+ A++ F+ +L    KW   + +     T K++ E  +  + K+ L AL D   EH  D   L+T ++ L +   D   +   +  + KEYN L  +    C   + +  L  ++  +  D   W+  +  T  KC D     S++ + L  I     E EN GQ K    +  GE L   L     ++ +Q+M   K DW      L+Q  S L N   + + F+  ++ +  WL   E   + D ++  H  ++P    +   +  + +++L E++ H+    +L   A +L     A  SF    SQ+  +Y+ LS+  K+K+ ++++  A++ Q  Q + E+E W+
Sbjct: 2847 EQMDNEIHSLQADWKQWEDSICHSQKALDGLLNQMAISEQEFSNQVSKLEDAIQDFSFFLE---KWTQKLNQGEGKDTDKEIVE--QWHRQKDVLTALND--AEHVTD--ELKTKLNDLCRFSKDLSIYSAKVSSLIKEYNSLCLQASKGCQNKEQV--LQQRFRTAFRDFQQWLVNAKVTTAKCFDIPQSVSEVSANLQKIQECLSESEN-GQHKLQTVMTRGELLYSILTEEKAKVTRQKMLTAKDDWKGFISSLHQKESALENLQIQMKDFETSADPVQTWLSATEKI-VRDSNNRLH--DLP----SKKKEQQKLQSILEEISSHEPQITRLKEKAQQLREGQSACKSFAHRGSQLSAQYLALSSLTKEKMSRMDRIVAEHQQFSQGMIELEDWI 3226          
BLAST of Nesprin-1 vs. Ensembl Xenopus
Match: SYNE1 (spectrin repeat containing, nuclear envelope 1 [Source:NCBI gene;Acc:100145637])

HSP 1 Score: 216.853 bits (551), Expect = 7.033e-55
Identity = 175/508 (34.45%), Postives = 280/508 (55.12%), Query Frame = 2
Query:  218 TFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGM--------------ANDPNAK------VKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNM--EEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFN---DKVDKNFENL-----NSKNNYDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPF--PNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISP---KQLEAMKTRMENVCKAEGPVREKLNIFGIQANL-------KNKAQKWAVDLNSWDS 1603
            T  +++ S+L Q+ PP++I +L +D+ DG  L+ LLE+L+   L  E+ + +++IH ++NI  AL+F+E  ++IKLVNIN +D+ DG+P+IVLGL+WT IL+FQIEE    L Q   M              A  P  K      ++G AKK L+ W     + + G+ +KDFG SW +G AF+++++ I P LV+M  E++++ TN+E LE AF+IAENELGIP+LLD EDVDV+KPDEKSIMTY+AQFLK YP+   P + S  +  + +S  ++      +  +++D     ++ +K+         + ++ Y  F     Q    R  ++ L+  +  D  L LD   V+Q    ++K   ++ +W   LDK LP  LG+ I SWL  AE ++ E       H++T N  + +KL++H+ +    +     F+E+ ++   N  P   +QLE M  R   V  +      KL    ++  L       ++K + W +     DS
Sbjct:   29 TLNQYVISFL-QRHPPMVINELFEDIKDGTKLIALLEVLSGQKLPCEQGRQLKRIHWVANIGAALKFLEG-RRIKLVNINSTDIADGRPSIVLGLIWTIILYFQIEELTSNLPQLHAMSSSTSSVDSVVSSEAASPPIKRKIVNKIQGSAKKALLRWVQYTAAKRLGIEVKDFGPSWRNGIAFHSVIYAIRPDLVDMDIEKLKRRTNRENLEEAFSIAENELGIPRLLDPEDVDVDKPDEKSIMTYIAQFLKHYPD---PHHTS--LDGQEDSVSIAKEYFREDRIVLRDMKVWLEQFEKDISRAQMVESSPQDRYQSFKQYRVQYEVKRKQVEALIHPLGKDGKLSLDQTMVKQA---WEKVSSRIFDWHLQLDKSLPAPLGT-IASWLYRAEVAMREEIVVQQSHEETAN-IMHRKLEQHKDVLKNLDGYKKAFQEIHRSRSVNGIPVPIEQLEDMAERFSYVASSSHLHMIKLEFMELKYRLLALLVLAESKLKSWIIKYGRRDS 524          

HSP 2 Score: 90.1225 bits (222), Expect = 1.299e-16
Identity = 118/512 (23.05%), Postives = 222/512 (43.36%), Query Frame = 2
Query: 10796 ETAENELETLKANWSKLSKRI------------------NELNNLKMDLDKALEHFNIWLNNSCKWFVNITE-----TRKKVFESNETLQMKNNLQALKDDITEHKVDLSRLQTFVDSLMKICND-ETFQKTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATEL-----ANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENAEQGK---TTNNTIQEIET--LIKHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQD 12229
            E  +NE+ +L+A+W +    I                   E +N    L+ A++ F+ +L    KW   + +     T K++ E  +  + K+ L AL D   EH  D   L+T ++ L +   D   +   +  + KEYN L  +    C   + +  L  ++  +  D   W+  +  T  KC D     S++ + L  I     E EN GQ K    +  GE L   L     ++ +Q+M   K DW      L+Q  S L N   + + F+  ++ +  WL   E   + D ++  H  ++P    +   +  + +++L E++ H+    +L   A +L     A  SF    SQ+  +Y+ LS+  K+K+ ++++  A++ Q  Q + E+E W+ + +I ++             ++ + ++E   L+K   EI  N+L    E            ++  N + +    +Q+ L  L   + +L  S I  + HL+ ++ KW +YQD
Sbjct: 2840 EQMDNEIHSLQADWKQWEDSICHSQKALDGLLNQMAISEQEFSNQVSKLEDAIQDFSFFLE---KWTQKLNQGEGKDTDKEIVE--QWHRQKDVLTALND--AEHVTD--ELKTKLNDLCRFSKDLSIYSAKVSSLIKEYNSLCLQASKGCQNKEQV--LQQRFRTAFRDFQQWLVNAKVTTAKCFDIPQSVSEVSANLQKIQECLSESEN-GQHKLQTVMTRGELLYSILTEEKAKVTRQKMLTAKDDWKGFISSLHQKESALENLQIQMKDFETSADPVQTWLSATEKI-VRDSNNRLH--DLP----SKKKEQQKLQSILEEISSHEPQITRLKEKAQQLREGQSACKSFAHRGSQLSAQYLALSSLTKEKMSRMDRIVAEHQQFSQGMIELEDWISE-AIHMLQSYCHPTADRSVLDSRMSKLEALLLVKQEKEIEMNMLLSRGE------------SVVRNTSPEGAPAIQNQLQDLKNTWASLLLSCIQCKSHLEGALSKWTSYQD 3319          
BLAST of Nesprin-1 vs. Ensembl Xenopus
Match: SYNE1 (spectrin repeat containing, nuclear envelope 1 [Source:NCBI gene;Acc:100145637])

HSP 1 Score: 216.853 bits (551), Expect = 8.032e-55
Identity = 175/514 (34.05%), Postives = 279/514 (54.28%), Query Frame = 2
Query:  215 KTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGM--------------ANDPNAK------VKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNM--EEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENIS-----EEITAEINSGLMSMVQPPNELDIVKDFN---DKVDKNFENL-----NSKNNYDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPF--PNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISP---KQLEAMKTRMENVCKAEGPVREKLNIFGIQANL-------KNKAQKWAVDLNSWDS 1603
            +T  +++ S+L Q+ PP++I +L +D+ DG  L+ LLE+L+   L  E+ + +++IH ++NI  AL+F+E  ++IKLVNIN +D+ DG+P+IVLGL+WT IL+FQIEE    L Q   M              A  P  K      ++G AKK L+ W     + + G+ +KDFG SW +G AF+++++ I P LV+M  E++++ TN+E LE AF+IAENELGIP+LLD EDVDV+KPDEKSIMTY+AQFLK YP+   P + S     + + A          +   +  +++D     ++ +K+         + ++ Y  F     Q    R  ++ L+  +  D  L LD   V+Q    ++K   ++ +W   LDK LP  LG+ I SWL  AE ++ E       H++T N  + +KL++H+ +    +     F+E+ ++   N  P   +QLE M  R   V  +      KL    ++  L       ++K + W +     DS
Sbjct:    7 ETLNQYVISFL-QRHPPMVINELFEDIKDGTKLIALLEVLSGQKLPCEQGRQLKRIHWVANIGAALKFLEG-RRIKLVNINSTDIADGRPSIVLGLIWTIILYFQIEELTSNLPQLHAMSSSTSSVDSVVSSEAASPPIKRKIVNKIQGSAKKALLRWVQYTAAKRLGIEVKDFGPSWRNGIAFHSVIYAIRPDLVDMDIEKLKRRTNRENLEEAFSIAENELGIPRLLDPEDVDVDKPDEKSIMTYIAQFLKHYPD---PHHTSLDGQEDSVMAGGTPSFSRSSKHREDRIVLRDMKVWLEQFEKDISRAQMVESSPQDRYQSFKQYRVQYEVKRKQVEALIHPLGKDGKLSLDQTMVKQA---WEKVSSRIFDWHLQLDKSLPAPLGT-IASWLYRAEVAMREEIVVQQSHEETAN-IMHRKLEQHKDVLKNLDGYKKAFQEIHRSRSVNGIPVPIEQLEDMAERFSYVASSSHLHMIKLEFMELKYRLLALLVLAESKLKSWIIKYGRRDS 510          

HSP 2 Score: 90.1225 bits (222), Expect = 1.343e-16
Identity = 118/512 (23.05%), Postives = 222/512 (43.36%), Query Frame = 2
Query: 10796 ETAENELETLKANWSKLSKRI------------------NELNNLKMDLDKALEHFNIWLNNSCKWFVNITE-----TRKKVFESNETLQMKNNLQALKDDITEHKVDLSRLQTFVDSLMKICND-ETFQKTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATEL-----ANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENAEQGK---TTNNTIQEIET--LIKHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQD 12229
            E  +NE+ +L+A+W +    I                   E +N    L+ A++ F+ +L    KW   + +     T K++ E  +  + K+ L AL D   EH  D   L+T ++ L +   D   +   +  + KEYN L  +    C   + +  L  ++  +  D   W+  +  T  KC D     S++ + L  I     E EN GQ K    +  GE L   L     ++ +Q+M   K DW      L+Q  S L N   + + F+  ++ +  WL   E   + D ++  H  ++P    +   +  + +++L E++ H+    +L   A +L     A  SF    SQ+  +Y+ LS+  K+K+ ++++  A++ Q  Q + E+E W+ + +I ++             ++ + ++E   L+K   EI  N+L    E            ++  N + +    +Q+ L  L   + +L  S I  + HL+ ++ KW +YQD
Sbjct: 2800 EQMDNEIHSLQADWKQWEDSICHSQKALDGLLNQMAISEQEFSNQVSKLEDAIQDFSFFLE---KWTQKLNQGEGKDTDKEIVE--QWHRQKDVLTALND--AEHVTD--ELKTKLNDLCRFSKDLSIYSAKVSSLIKEYNSLCLQASKGCQNKEQV--LQQRFRTAFRDFQQWLVNAKVTTAKCFDIPQSVSEVSANLQKIQECLSESEN-GQHKLQTVMTRGELLYSILTEEKAKVTRQKMLTAKDDWKGFISSLHQKESALENLQIQMKDFETSADPVQTWLSATEKI-VRDSNNRLH--DLP----SKKKEQQKLQSILEEISSHEPQITRLKEKAQQLREGQSACKSFAHRGSQLSAQYLALSSLTKEKMSRMDRIVAEHQQFSQGMIELEDWISE-AIHMLQSYCHPTADRSVLDSRMSKLEALLLVKQEKEIEMNMLLSRGE------------SVVRNTSPEGAPAIQNQLQDLKNTWASLLLSCIQCKSHLEGALSKWTSYQD 3279          
BLAST of Nesprin-1 vs. Ensembl Xenopus
Match: SYNE1 (spectrin repeat containing, nuclear envelope 1 [Source:NCBI gene;Acc:100145637])

HSP 1 Score: 216.468 bits (550), Expect = 9.186e-55
Identity = 175/514 (34.05%), Postives = 279/514 (54.28%), Query Frame = 2
Query:  215 KTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGM--------------ANDPNAK------VKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNM--EEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENIS-----EEITAEINSGLMSMVQPPNELDIVKDFN---DKVDKNFENL-----NSKNNYDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPF--PNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISP---KQLEAMKTRMENVCKAEGPVREKLNIFGIQANL-------KNKAQKWAVDLNSWDS 1603
            +T  +++ S+L Q+ PP++I +L +D+ DG  L+ LLE+L+   L  E+ + +++IH ++NI  AL+F+E  ++IKLVNIN +D+ DG+P+IVLGL+WT IL+FQIEE    L Q   M              A  P  K      ++G AKK L+ W     + + G+ +KDFG SW +G AF+++++ I P LV+M  E++++ TN+E LE AF+IAENELGIP+LLD EDVDV+KPDEKSIMTY+AQFLK YP+   P + S     + + A          +   +  +++D     ++ +K+         + ++ Y  F     Q    R  ++ L+  +  D  L LD   V+Q    ++K   ++ +W   LDK LP  LG+ I SWL  AE ++ E       H++T N  + +KL++H+ +    +     F+E+ ++   N  P   +QLE M  R   V  +      KL    ++  L       ++K + W +     DS
Sbjct:    7 ETLNQYVISFL-QRHPPMVINELFEDIKDGTKLIALLEVLSGQKLPCEQGRQLKRIHWVANIGAALKFLEG-RRIKLVNINSTDIADGRPSIVLGLIWTIILYFQIEELTSNLPQLHAMSSSTSSVDSVVSSEAASPPIKRKIVNKIQGSAKKALLRWVQYTAAKRLGIEVKDFGPSWRNGIAFHSVIYAIRPDLVDMDIEKLKRRTNRENLEEAFSIAENELGIPRLLDPEDVDVDKPDEKSIMTYIAQFLKHYPD---PHHTSLDGQEDSVMAGGTPSFSRSSKHREDRIVLRDMKVWLEQFEKDISRAQMVESSPQDRYQSFKQYRVQYEVKRKQVEALIHPLGKDGKLSLDQTMVKQA---WEKVSSRIFDWHLQLDKSLPAPLGT-IASWLYRAEVAMREEIVVQQSHEETAN-IMHRKLEQHKDVLKNLDGYKKAFQEIHRSRSVNGIPVPIEQLEDMAERFSYVASSSHLHMIKLEFMELKYRLLALLVLAESKLKSWIIKYGRRDS 510          

HSP 2 Score: 90.1225 bits (222), Expect = 1.424e-16
Identity = 118/512 (23.05%), Postives = 222/512 (43.36%), Query Frame = 2
Query: 10796 ETAENELETLKANWSKLSKRI------------------NELNNLKMDLDKALEHFNIWLNNSCKWFVNITE-----TRKKVFESNETLQMKNNLQALKDDITEHKVDLSRLQTFVDSLMKICND-ETFQKTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATEL-----ANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENAEQGK---TTNNTIQEIET--LIKHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQD 12229
            E  +NE+ +L+A+W +    I                   E +N    L+ A++ F+ +L    KW   + +     T K++ E  +  + K+ L AL D   EH  D   L+T ++ L +   D   +   +  + KEYN L  +    C   + +  L  ++  +  D   W+  +  T  KC D     S++ + L  I     E EN GQ K    +  GE L   L     ++ +Q+M   K DW      L+Q  S L N   + + F+  ++ +  WL   E   + D ++  H  ++P    +   +  + +++L E++ H+    +L   A +L     A  SF    SQ+  +Y+ LS+  K+K+ ++++  A++ Q  Q + E+E W+ + +I ++             ++ + ++E   L+K   EI  N+L    E            ++  N + +    +Q+ L  L   + +L  S I  + HL+ ++ KW +YQD
Sbjct: 2826 EQMDNEIHSLQADWKQWEDSICHSQKALDGLLNQMAISEQEFSNQVSKLEDAIQDFSFFLE---KWTQKLNQGEGKDTDKEIVE--QWHRQKDVLTALND--AEHVTD--ELKTKLNDLCRFSKDLSIYSAKVSSLIKEYNSLCLQASKGCQNKEQV--LQQRFRTAFRDFQQWLVNAKVTTAKCFDIPQSVSEVSANLQKIQECLSESEN-GQHKLQTVMTRGELLYSILTEEKAKVTRQKMLTAKDDWKGFISSLHQKESALENLQIQMKDFETSADPVQTWLSATEKI-VRDSNNRLH--DLP----SKKKEQQKLQSILEEISSHEPQITRLKEKAQQLREGQSACKSFAHRGSQLSAQYLALSSLTKEKMSRMDRIVAEHQQFSQGMIELEDWISE-AIHMLQSYCHPTADRSVLDSRMSKLEALLLVKQEKEIEMNMLLSRGE------------SVVRNTSPEGAPAIQNQLQDLKNTWASLLLSCIQCKSHLEGALSKWTSYQD 3305          
BLAST of Nesprin-1 vs. Ensembl Mouse
Match: Syne1 (spectrin repeat containing, nuclear envelope 1 [Source:MGI Symbol;Acc:MGI:1927152])

HSP 1 Score: 253.062 bits (645), Expect = 1.148e-70
Identity = 198/598 (33.11%), Postives = 318/598 (53.18%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXX---------------XXXXALGMANDPN-----AKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLME--PFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPAN---ISPKQLEAMKTRMENVCKAEGPVREKLNIFGIQANLKNKAQKWAVDLNSWDSPIQSKQDLLDKIEQFNISMENGTSMDKFTSQLDELVKRKVKFCKENPVLD--EDLLNFINKAINECEEENDILPEKFESTLMKLENLSSEWDEISD 1885
            L+DEQE +QK+TFTKW+NS+L ++KPP+++ DL +D+ DG+ LL LLE+L+   L  E+   +++IH ++NI TAL+F+E  +KIKLVNIN +D+ DG+P+IVLGL+WT IL+FQIEE                    + +   A+ P+     AK++G AKK L+ W  +    + G+ +KDFG+SW  G AF++++H I P LV++E+++  +N+E LE+AF IAE +LGIP+LLD EDVDV+KPDEKSIMTYVAQFL  YP+        +E   +       ++    ++ I +   D         + ++ Y  F     Q    R  ++ ++  +  D  L LD   V+Q    +++   +L +W   LDK LP  LG+ IG+WL  AE +L E      VH++T N  + +KL++H+ +    +     F E+ Q    N   + P QLE M  R   V         K+    ++  L +        L SW      ++ +   ++ +   +EN    +++      L +    + K    ++  E+++ F+++A  +       L  +  S    LE + S WD   D
Sbjct:   21 LQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGIKLLALLEVLSGQKLPCEQGHRVKRIHAVANIGTALKFLEG-RKIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSMVSTETASPPSKRKVAAKIQGNAKKTLLKWVQHTAGKQMGIEVKDFGKSWRTGLAFHSVIHAIQPELVDLEKVKTRSNRENLEDAFTIAETQLGIPRLLDPEDVDVDKPDEKSIMTYVAQFLTQYPDIHGAGCDGQEDDRDDR-----LILKETKVWIEQFERDFTRAQMTESSLQDKYQAFKHFRVQYEMKRKQVEHIIQPLQRDGKLTLDQALVKQC---WERVSSRLFDWHIQLDKSLPAPLGT-IGAWLYRAEVALREEITIQQVHEETANT-IQRKLEQHKDLLQNTDAHKRAFHEIYQTRSVNGIPMPPDQLEDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGRRESVELLLQSYISFIENSKFFEQYEVTYQILKQTADIYVKAEGSVEEAENVMKFMSEATAQWRN----LSVEVRSVRSMLEEVISNWDRYGD 603          
BLAST of Nesprin-1 vs. Ensembl Mouse
Match: Syne1 (spectrin repeat containing, nuclear envelope 1 [Source:MGI Symbol;Acc:MGI:1927152])

HSP 1 Score: 248.825 bits (634), Expect = 2.756e-65
Identity = 172/480 (35.83%), Postives = 267/480 (55.62%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKK------IKLVNINPSDVVDGKPAIVLGLVWT---------------AXXXXXXXXXXXXXXXALGMANDPN-----AKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKD---FNDKVDKNFENLNS-----KNNYDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLME--PFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPAN---ISPKQLEAMKTRMENV 1495
            L+DEQE +QK+TFTKW+NS+L ++KPP+++ DL +D+ DG+ LL LLE+L+   L  E+   +++IH ++NI TAL+F+E  K       IKLVNIN +D+ DG+P+IVLGL+WT                +            + +   A+ P+     AK++G AKK L+ W  +    + G+ +KDFG+SW  G AF++++H I P LV++E+++  +N+E LE+AF IAE +LGIP+LLD EDVDV+KPDEKSIMTYVAQFL  YP+                +G        ++  I+K+   + ++ +++F          ++ Y  F     Q    R  ++ ++  +  D  L LD   V+Q    +++   +L +W   LDK LP  LG+ IG+WL  AE +L E      VH++T N  + +KL++H+ +    +     F E+ Q    N   + P QLE M  R   V
Sbjct:   21 LQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGIKLLALLEVLSGQKLPCEQGHRVKRIHAVANIGTALKFLEGRKSMYRGSPIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSMVSTETASPPSKRKVAAKIQGNAKKTLLKWVQHTAGKQMGIEVKDFGKSWRTGLAFHSVIHAIQPELVDLEKVKTRSNRENLEDAFTIAETQLGIPRLLDPEDVDVDKPDEKSIMTYVAQFLTQYPDIH-------------GAGCDGQEDDRDDRLILKETKVWIEQFERDFTRAQMTESSLQDKYQAFKHFRVQYEMKRKQVEHIIQPLQRDGKLTLDQALVKQC---WERVSSRLFDWHIQLDKSLPAPLGT-IGAWLYRAEVALREEITIQQVHEETANT-IQRKLEQHKDLLQNTDAHKRAFHEIYQTRSVNGIPMPPDQLEDMAERFHFV 482          
BLAST of Nesprin-1 vs. Ensembl Mouse
Match: Syne1 (spectrin repeat containing, nuclear envelope 1 [Source:MGI Symbol;Acc:MGI:1927152])

HSP 1 Score: 250.751 bits (639), Expect = 3.561e-65
Identity = 172/480 (35.83%), Postives = 267/480 (55.62%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKK------IKLVNINPSDVVDGKPAIVLGLVWT---------------AXXXXXXXXXXXXXXXALGMANDPN-----AKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKD---FNDKVDKNFENLNS-----KNNYDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLME--PFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPAN---ISPKQLEAMKTRMENV 1495
            L+DEQE +QK+TFTKW+NS+L ++KPP+++ DL +D+ DG+ LL LLE+L+   L  E+   +++IH ++NI TAL+F+E  K       IKLVNIN +D+ DG+P+IVLGL+WT                +            + +   A+ P+     AK++G AKK L+ W  +    + G+ +KDFG+SW  G AF++++H I P LV++E+++  +N+E LE+AF IAE +LGIP+LLD EDVDV+KPDEKSIMTYVAQFL  YP+                +G        ++  I+K+   + ++ +++F          ++ Y  F     Q    R  ++ ++  +  D  L LD   V+Q    +++   +L +W   LDK LP  LG+ IG+WL  AE +L E      VH++T N  + +KL++H+ +    +     F E+ Q    N   + P QLE M  R   V
Sbjct:   21 LQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGIKLLALLEVLSGQKLPCEQGHRVKRIHAVANIGTALKFLEGRKSMYRGSPIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSMVSTETASPPSKRKVAAKIQGNAKKTLLKWVQHTAGKQMGIEVKDFGKSWRTGLAFHSVIHAIQPELVDLEKVKTRSNRENLEDAFTIAETQLGIPRLLDPEDVDVDKPDEKSIMTYVAQFLTQYPDIH-------------GAGCDGQEDDRDDRLILKETKVWIEQFERDFTRAQMTESSLQDKYQAFKHFRVQYEMKRKQVEHIIQPLQRDGKLTLDQALVKQC---WERVSSRLFDWHIQLDKSLPAPLGT-IGAWLYRAEVALREEITIQQVHEETANT-IQRKLEQHKDLLQNTDAHKRAFHEIYQTRSVNGIPMPPDQLEDMAERFHFV 482          

HSP 2 Score: 65.855 bits (159), Expect = 1.988e-9
Identity = 81/393 (20.61%), Postives = 174/393 (44.27%), Query Frame = 2
Query: 11108 FQKTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATEL-----ANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINE---NAEQGKTTNNTIQEIETLIKHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQDFLQSTKLFLDN 12262
            + + +  + KEYN L  +    C   + +  L  +++ +      W+  +  T  KC D     S++ S L  I     E EN GQ K    +  GE L   L     Q VQ ++   K +W      L+Q  S L N   + + F+  +  + NWL   E         ++      ++      +  + +++L E+  ++    +L   A +L     A+ SF    SQ+ ++Y+ LSN  K+K+ +L++  A++++  Q ++E++ W+   ++ +++            ++ + ++E L+          + QE EI ++   V     +  + + +    +Q  L  + + + +L S++I  +  L+ ++ KW +YQD ++    ++D+
Sbjct: 3024 YSEKVSGLIKEYNCLCLQASKGCQNKEQI--LQERFQKASRGFQQWLVNAKITTAKCFDLPQNLSEVSSSLQKIQEFLSESEN-GQHKLNTMLFKGELLSSLLTEEKAQAVQAKVLTAKEEWKSFHANLHQKESALENLKIQMKDFEVSAELVQNWLSKTERL-------VQESSNRLYDLPAKRREQQKLQSVLEEIQCYEPQLHRLKEKARQLWEGQAASKSFVHRVSQLSSQYLALSNVTKEKVSRLDRIIAEHNRFSQGVKELQDWM-SDAVHMLDSYCLPTSDKSVLDSRMLKLEALLS---------VRQEKEI-QMKMVVTRGEYVLQSTSLEGSAAVQQQLQAVKDMWESLLSAAIRCKSQLEGALSKWTSYQDDVRQFSSWMDS 3395          
BLAST of Nesprin-1 vs. Ensembl Mouse
Match: Syne2 (spectrin repeat containing, nuclear envelope 2 [Source:MGI Symbol;Acc:MGI:2449316])

HSP 1 Score: 181.03 bits (458), Expect = 3.858e-47
Identity = 154/464 (33.19%), Postives = 240/464 (51.72%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXX-------------XXXALGMANDP----------NAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFPNVHDKTFNDKVLQ-KLKEHESI---FNKKNDVLAKFREVLQNPPANISPKQLEAMKTRMENV 1495
            L+ EQE  QKKTFT W+NS L +  PP ++ DL  D+  G +LLDLLE+L+   L ++K  N     C  NI  AL F++N + IKL+NI+ +D+V+G P+I+LGL+WT ILHF IE+  +               + A    + P           A+ +  AKK L+ W     +    +N+ DF  SW +G AF A++H + P L++M+ +   +NK+ L+ AF IAE+EL IPKLL+ EDVDV  PDEKSIMTYVAQFLK   +   P + ++   A++   L+ +     E    K   D   + + N      + + + + S  ++ +  +D +S    +     D  ++   +     ++  W+  LD  LP  L  E  +WL+D E  + E  P     +    ++Q KL   +S+   F+  +DVL  F+   +     + P +LE M  R+ NV
Sbjct:   25 LQAEQEDTQKKTFTCWINSQLAKHTPPSVVSDLFADIKKGHVLLDLLEVLSGQQLPRDKGSNT--FQCRINIEHALTFLKN-RSIKLINIHVADIVEGNPSIILGLIWTIILHFHIEKLAQTLSCDYNQPSPEVVSVAASSPTSSPPTKKCSKAQAQARWQWSAKKALLQWAQEQCARSESVNVTDFKSSWRNGMAFLAVIHALRPDLIDMDSMRHRSNKDNLKEAFRIAEHELKIPKLLEPEDVDVVNPDEKSIMTYVAQFLKYSKDAPGPGDSTQ---AKVRDALVWLTL--QEKRFQKMLKDSASETYCN----KYHSLLSFMESLNEEKESFIDVLSLKGRMGELNEDESRLRQGWTSLMHQVAAWRAQLDDALPSPL-KETEAWLKDIEGVVQEGVPTSQSYSEARTLIQGKLSSFKSLMGSFDYHSDVLMAFQSNAEKSLPAVPPVKLEEMTRRINNV 475          
BLAST of Nesprin-1 vs. Ensembl Mouse
Match: Syne2 (spectrin repeat containing, nuclear envelope 2 [Source:MGI Symbol;Acc:MGI:2449316])

HSP 1 Score: 181.8 bits (460), Expect = 2.184e-44
Identity = 154/464 (33.19%), Postives = 240/464 (51.72%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXX-------------XXXALGMANDP----------NAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFPNVHDKTFNDKVLQ-KLKEHESI---FNKKNDVLAKFREVLQNPPANISPKQLEAMKTRMENV 1495
            L+ EQE  QKKTFT W+NS L +  PP ++ DL  D+  G +LLDLLE+L+   L ++K  N     C  NI  AL F++N + IKL+NI+ +D+V+G P+I+LGL+WT ILHF IE+  +               + A    + P           A+ +  AKK L+ W     +    +N+ DF  SW +G AF A++H + P L++M+ +   +NK+ L+ AF IAE+EL IPKLL+ EDVDV  PDEKSIMTYVAQFLK   +   P + ++   A++   L+ +     E    K   D   + + N      + + + + S  ++ +  +D +S    +     D  ++   +     ++  W+  LD  LP  L  E  +WL+D E  + E  P     +    ++Q KL   +S+   F+  +DVL  F+   +     + P +LE M  R+ NV
Sbjct:   25 LQAEQEDTQKKTFTCWINSQLAKHTPPSVVSDLFADIKKGHVLLDLLEVLSGQQLPRDKGSNT--FQCRINIEHALTFLKN-RSIKLINIHVADIVEGNPSIILGLIWTIILHFHIEKLAQTLSCDYNQPSPEVVSVAASSPTSSPPTKKCSKAQAQARWQWSAKKALLQWAQEQCARSESVNVTDFKSSWRNGMAFLAVIHALRPDLIDMDSMRHRSNKDNLKEAFRIAEHELKIPKLLEPEDVDVVNPDEKSIMTYVAQFLKYSKDAPGPGDSTQ---AKVRDALVWLT--LQEKRFQKMLKDSASETYCN----KYHSLLSFMESLNEEKESFIDVLSLKGRMGELNEDESRLRQGWTSLMHQVAAWRAQLDDALPSPL-KETEAWLKDIEGVVQEGVPTSQSYSEARTLIQGKLSSFKSLMGSFDYHSDVLMAFQSNAEKSLPAVPPVKLEEMTRRINNV 475          
BLAST of Nesprin-1 vs. UniProt
Match: sp|Q8NF91|SYNE1_HUMAN (Nesprin-1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV=4)

HSP 1 Score: 258.07 bits (658), Expect = 1.499e-66
Identity = 182/479 (38.00%), Postives = 269/479 (56.16%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXX------------XXXXXXXXXXXXXALGMANDPN--------AKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELD-----IVKDFNDKVDKNFENL--------NSKNNYDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFP--NVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPAN---ISPKQLEAMKTRMENV 1495
            L+DEQE +QK+TFTKW+NS+L ++KPP+++ DL +D+ DG+ LL LLE+L+   L  E+ + M++IH ++NI TAL+F+E  +KIKLVNIN +D+ DG+P+IVLGL+WT IL              Q        + ++  +  P+         K++G AKK L+ W       + G+ +KDFG+SW  G AF++++H I P LV++E ++  +N+E LE+AF IAE ELGIP+LLD EDVDV+KPDEKSIMTYVAQFLK YP+        +E   EI  G  S              I K+    +++   +L        N ++ Y  F     Q    R  ++ L+  +  D  L LD   V+Q    +D+   +L +W   LDK LP  LG+ IG+WL  AE +L E      VH++T N  + +KL++H+ +    +     F E+ +    N   + P QLE M  R   V
Sbjct:   21 LQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLEG-RKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSIVSSETPSPPSKRKVTTKIQGNAKKALLKWVQYTAGKQTGIEVKDFGKSWRSGVAFHSVIHAIRPELVDLETVKGRSNRENLEDAFTIAETELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDIHNASTDGQE-DDEILPGFPSFANSVQNFKREDRVIFKEMKVWIEQFERDLTRAQMVESNLQDKYQSFKHFRVQYEMKRKQIEHLIQPLHRDGKLSLDQALVKQ---SWDRVTSRLFDWHIQLDKSLPAPLGT-IGAWLYRAEVALREEITVQQVHEETANT-IQRKLEQHKDLLQNTDAHKRAFHEIYRTRSVNGIPVPPDQLEDMAERFHFV 492          

HSP 2 Score: 81.2629 bits (199), Expect = 3.683e-13
Identity = 158/754 (20.95%), Postives = 305/754 (40.45%), Query Frame = 2
Query: 10796 ETAENELETLKANW------------------SKLSKRINELNNLKMDLDKALEHFNIWLNNSCKWFVNITETRKKVFESNETLQMKNNLQALKDDITEHKVDLSRLQTFVDSLMKICND-ETFQKTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATEL-----ANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENAEQGKTTNNTIQEIETL-------IKHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQDFLQSTKLFLDNELPNWWRERNQDQMKSAYSNFN-NEPILKEILDMDNKLNGLKTTMELEAKACDGILPTIAITASRSQTPNFKSNRSLYSPSSNWSTNKSDVTPNDELIPNILSKSIYEDLDENIKKVSNLKKEIIEK----ITDWNNFNREKTSFKNWMDNEMLKFS--SVLYTEPGISNFASLQKSKLKEIQEEMNY--KKQALLNLNTHFKE--LTSNVSGAADLVLKNLNQDFDETEKKIS 12931
            E    E++ L+A+W                  S+++    E +     L++ALE F+  L     W   +T    K  +  E ++  +  Q + D + + +     L++ ++ L +   D  T+   +  + KEYN L  +    C   + +  L  ++  +  D   W+  +  T  KC D     S++ + L  I     E EN GQ K    +  GE L   L     + +Q ++   K DW      L+Q  S L N   + + F+  +  + +WL   E         +       ++      +  + +++L E++ ++    +L   A +L     A+ SF    SQ+ ++Y+ LSN  K+K+ +L++  A+++Q    I+E++ W+   +I +++       T++ ++ +  TL       +K   EI      Q   IV  G++V        N + +    +Q  L  + + + +L S+ I  +  L+ ++ KW +YQD ++        +   W        M S  +N N +E    E+ D    L   K   E E  +   +L TI +  +   T ++ +   L                              +DL E  + +    KE + K    +     + R+  +F+ W+  E  K    SVL  +      A   ++ L+++QE   +  + QALLN   H +E  + S +  A D  L++L QD+   + ++S
Sbjct: 2917 ELMHTEMQALRADWKQWEDSVFQTQSCLENLVSQMALSEQEFSGQVAQLEQALEQFSALLKT---WAQQLTLLEGKNTD-EEIVECWHKGQEILDALQKAEPRTEDLKSQLNELCRFSRDLSTYSGKVSGLIKEYNCLCLQASKGCQNKEQI--LQQRFRKAFRDFQQWLVNAKITTAKCFDIPQNISEVSTSLQKIQEFLSESEN-GQHKLNMMLSKGELLSTLLTKEKAKGIQAKVTAAKEDWKNFHSNLHQKESALENLKIQMKDFEVSAEPIQDWLSKTEKM-------VHESSNRLYDLPAKRREQQKLQSVLEEIHCYEPQLNRLKEKAQQLWEGQAASKSFRHRVSQLSSQYLALSNLTKEKVSRLDRIVAEHNQFSLGIKELQDWM-TDAIHMLDSYCH--PTSDKSVLDSRTLKLEALLSVKQEKEI------QMKMIVTRGESV------LQNTSPEGIPTIQQQLQSVKDMWASLLSAGIRCKSQLEGALSKWTSYQDGVR--------QFSGW--------MDSMEANLNESERQHAELRDKTTMLGKAKLLNE-EVLSYSSLLETIEVKGA-GMTEHYVTQLEL------------------------------QDLQERYRAIQERAKEAVTKSEKLVRLHQEYQRDLKAFEVWLGQEQEKLDQYSVLEGD------AHTHETTLRDLQELQVHCAEGQALLNSVLHTREDVIPSGIPQAEDRALESLRQDWQAYQHRLS 3587          
BLAST of Nesprin-1 vs. UniProt
Match: sp|Q6ZWR6|SYNE1_MOUSE (Nesprin-1 OS=Mus musculus OX=10090 GN=Syne1 PE=1 SV=2)

HSP 1 Score: 257.299 bits (656), Expect = 2.582e-66
Identity = 176/480 (36.67%), Postives = 274/480 (57.08%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWT---------------AXXXXXXXXXXXXXXXALGMANDPN-----AKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYP-------EGKKPENISEEITAEINSGLMSMVQPPNELDI--VKDFNDKVDKNFENLNS-----KNNYDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLME--PFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPAN---ISPKQLEAMKTRMENV 1495
            L+DEQE +QK+TFTKW+NS+L ++KPP+++ DL +D+ DG+ LL LLE+L+   L  E+   +++IH ++NI TAL+F+E  +KIKLVNIN +D+ DG+P+IVLGL+WT                +            + +   A+ P+     AK++G AKK L+ W  +    + G+ +KDFG+SW  G AF++++H I P LV++E+++  +N+E LE+AF IAE +LGIP+LLD EDVDV+KPDEKSIMTYVAQFL  YP       +G++ + +    T   N  L+   Q  + L +   K + ++ +++F          ++ Y  F     Q    R  ++ ++  +  D  L LD   V+Q    +++   +L +W   LDK LP  LG+ IG+WL  AE +L E      VH++T N  + +KL++H+ +    +     F E+ Q    N   + P QLE M  R   V
Sbjct:   21 LQDEQEIVQKRTFTKWINSHLAKRKPPMVVDDLFEDMKDGIKLLALLEVLSGQKLPCEQGHRVKRIHAVANIGTALKFLEG-RKIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLSSSASSVDSMVSTETASPPSKRKVAAKIQGNAKKTLLKWVQHTAGKQMGIEVKDFGKSWRTGLAFHSVIHAIQPELVDLEKVKTRSNRENLEDAFTIAETQLGIPRLLDPEDVDVDKPDEKSIMTYVAQFLTQYPDIHGAGCDGQEDDVVFVGFTN--NIALLLGFQRDDRLILKETKVWIEQFERDFTRAQMTESSLQDKYQAFKHFRVQYEMKRKQVEHIIQPLQRDGKLTLDQALVKQC---WERVSSRLFDWHIQLDKSLPAPLGT-IGAWLYRAEVALREEITIQQVHEETANT-IQRKLEQHKDLLQNTDAHKRAFHEIYQTRSVNGIPMPPDQLEDMAERFHFV 492          

HSP 2 Score: 66.2402 bits (160), Expect = 1.147e-8
Identity = 81/393 (20.61%), Postives = 174/393 (44.27%), Query Frame = 2
Query: 11108 FQKTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATEL-----ANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINE---NAEQGKTTNNTIQEIETLIKHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQDFLQSTKLFLDN 12262
            + + +  + KEYN L  +    C   + +  L  +++ +      W+  +  T  KC D     S++ S L  I     E EN GQ K    +  GE L   L     Q VQ ++   K +W      L+Q  S L N   + + F+  +  + NWL   E         ++      ++      +  + +++L E+  ++    +L   A +L     A+ SF    SQ+ ++Y+ LSN  K+K+ +L++  A++++  Q ++E++ W+   ++ +++            ++ + ++E L+          + QE EI ++   V     +  + + +    +Q  L  + + + +L S++I  +  L+ ++ KW +YQD ++    ++D+
Sbjct: 3034 YSEKVSGLIKEYNCLCLQASKGCQNKEQI--LQERFQKASRGFQQWLVNAKITTAKCFDLPQNLSEVSSSLQKIQEFLSESEN-GQHKLNTMLFKGELLSSLLTEEKAQAVQAKVLTAKEEWKSFHANLHQKESALENLKIQMKDFEVSAELVQNWLSKTERL-------VQESSNRLYDLPAKRREQQKLQSVLEEIQCYEPQLHRLKEKARQLWEGQAASKSFVHRVSQLSSQYLALSNVTKEKVSRLDRIIAEHNRFSQGVKELQDWM-SDAVHMLDSYCLPTSDKSVLDSRMLKLEALLS---------VRQEKEI-QMKMVVTRGEYVLQSTSLEGSAAVQQQLQAVKDMWESLLSAAIRCKSQLEGALSKWTSYQDDVRQFSSWMDS 3405          
BLAST of Nesprin-1 vs. UniProt
Match: sp|Q6ZWQ0|SYNE2_MOUSE (Nesprin-2 OS=Mus musculus OX=10090 GN=Syne2 PE=1 SV=2)

HSP 1 Score: 181.415 bits (459), Expect = 1.661e-43
Identity = 154/464 (33.19%), Postives = 240/464 (51.72%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXX-------------XXXALGMANDP----------NAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFPNVHDKTFNDKVLQ-KLKEHESI---FNKKNDVLAKFREVLQNPPANISPKQLEAMKTRMENV 1495
            L+ EQE  QKKTFT W+NS L +  PP ++ DL  D+  G +LLDLLE+L+   L ++K  N     C  NI  AL F++N + IKL+NI+ +D+V+G P+I+LGL+WT ILHF IE+  +               + A    + P           A+ +  AKK L+ W     +    +N+ DF  SW +G AF A++H + P L++M+ +   +NK+ L+ AF IAE+EL IPKLL+ EDVDV  PDEKSIMTYVAQFLK   +   P + ++   A++   L+ +     E    K   D   + + N      + + + + S  ++ +  +D +S    +     D  ++   +     ++  W+  LD  LP  L  E  +WL+D E  + E  P     +    ++Q KL   +S+   F+  +DVL  F+   +     + P +LE M  R+ NV
Sbjct:   25 LQAEQEDTQKKTFTCWINSQLAKHTPPSVVSDLFADIKKGHVLLDLLEVLSGQQLPRDKGSNT--FQCRINIEHALTFLKN-RSIKLINIHVADIVEGNPSIILGLIWTIILHFHIEKLAQTLSCDYNQPSPEVVSVAASSPTSSPPTKKCSKAQAQARWQWSAKKALLQWAQEQCARSESVNVTDFKSSWRNGMAFLAVIHALRPDLIDMDSMRHRSNKDNLKEAFRIAEHELKIPKLLEPEDVDVVNPDEKSIMTYVAQFLKYSKDAPGPGDSTQ---AKVRDALVWLT--LQEKRFQKMLKDSASETYCN----KYHSLLSFMESLNEEKESFIDVLSLKGRMGELNEDESRLRQGWTSLMHQVAAWRAQLDDALPSPL-KETEAWLKDIEGVVQEGVPTSQSYSEARTLIQGKLSSFKSLMGSFDYHSDVLMAFQSNAEKSLPAVPPVKLEEMTRRINNV 475          
BLAST of Nesprin-1 vs. UniProt
Match: sp|Q8WXH0|SYNE2_HUMAN (Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=3)

HSP 1 Score: 180.259 bits (456), Expect = 4.138e-43
Identity = 167/506 (33.00%), Postives = 261/506 (51.58%), Query Frame = 2
Query:  179 VLLKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGM-------------ANDPNAK----VKGQ----AKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELD-IVKDFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFPNVHDKTFNDKVLQ-KLKEHESI---FNKKNDVLAKFREVLQNPPANISPKQLEAMKTRMENVCKAEGPV-----REKLNIFGIQANLKNKAQKWAVDLNSWDS 1603
            + L+ EQE  QKK FT W+NS L +   P +I DL  D+  G +LLDLLE+L+   L ++K  N     C  NI  AL F+ N + IKL+NI+ +D++DG P+I+LGL+WT ILHF IE+  + L                   A+ P AK    V+ +    A+K L+ W     +    +N+ DF  SW +G AF A++H + P L++M+ ++  +NK+ L  AF IAE EL IP+LL+ EDVDV  PDEKSIMTYVAQFL+     K      EE   ++   +  +     +L  ++KD  +  D  F+  NS     + + + S  ++ K  LD +S    LD    D  Q+   +D  + ++N W+  L+  LP  L  +  +WLQ+ EE + E      D +    ++Q K+   +S+   F   +++L  F    +N    + P +LE MK R+ N+ + +  +       K  + G+   +K+K   W +   S +S
Sbjct:   23 ISLQAEQEDTQKKAFTCWINSQLARHTSPSVISDLFTDIKKGHVLLDLLEVLSGQQLPRDKGSNT--FQCRINIEHALTFLRN-RSIKLINIHVTDIIDGNPSIILGLIWTIILHFHIEKLAQTLSCNYNQPSLDDVSVVDSSPASSPPAKKCSKVQARWQMSARKALLLWAQEQCATYESVNVTDFKSSWRNGMAFLAIIHALRPDLIDMKSVKHRSNKDNLREAFRIAEQELKIPRLLEPEDVDVVDPDEKSIMTYVAQFLQY---SKDAPGTGEEAQGKVKDAMGWLTLQKEKLQKLLKDSEN--DTYFKKYNS-----LLSFMESFNEEKKSFLDVLSIKRDLDELDKDHLQLREAWDGLDHQINAWKIKLNYALPPPL-HQTEAWLQEVEELMDEDLSASQDHSQAVTLIQEKMTLFKSLMDRFEHHSNILLTFENKDENHLPLVPPNKLEEMKRRINNILEKKFILLLEFHYYKCLVLGLVDEVKSKLDIWNIKYGSRES 514          
BLAST of Nesprin-1 vs. UniProt
Match: sp|Q96JQ2|CLMN_HUMAN (Calmin OS=Homo sapiens OX=9606 GN=CLMN PE=1 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 8.660e-35
Identity = 110/297 (37.04%), Postives = 174/297 (58.59%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWT----------AXXXXXXXXXXXXXXXALGMAND------PNAK------VKGQAK--KGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNE 1003
            L+ E+E +QK+TFT+W+N +L +  PP+ +KDL  D+ DG +L+ LLE+L+   L  E   +  +I  L+NI  AL+F+E D  +KLV+I+ +++ DG P++VLGL+W                +          + G  +D      P A+      VK Q K  K L+AW     + KYG+ ++DF  SW  G AF A++  IDP+LV+M++  + + +E LE AF+IA++ L IP+LL+ ED+ V+ PDE+SIMTYVAQFL+ +PE +  +    +    I S  + + + P+E
Sbjct:   26 LQVERENVQKRTFTRWINLHLEKCNPPLEVKDLFVDIQDGKILMALLEVLSGRNLLHEYKSSSHRIFRLNNIAKALKFLE-DSNVKLVSIDAAEIADGNPSLVLGLIWNIILFFQIKELTGNLSRNSPSSSLSPGSGGTDSDSSFPPTPTAERSVAISVKDQRKAIKALLAWVQRK-TRKYGVAVQDFAGSWRSGLAFLAVIKAIDPSLVDMKQALENSTRENLEKAFSIAQDALHIPRLLEPEDIMVDTPDEQSIMTYVAQFLERFPELEAEDIFDSDKEVPIESTFVRIKETPSE 320          
BLAST of Nesprin-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18275911 (tr|A0A267EWS2|A0A267EWS2_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031215g1 PE=4 SV=1)

HSP 1 Score: 339.347 bits (869), Expect = 3.103e-90
Identity = 215/483 (44.51%), Postives = 302/483 (62.53%), Query Frame = 2
Query:  146 MDRKDTVVKKGVLLKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMAN--DPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEG--KKPENIS--EEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKN-----NYDIFADLMSQRDDMK----LLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFPNVH----DKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISPKQLEAMKTRMENVCKAEGPVREKLNIF 1537
            M R+ + +     L+DEQE++QKKTFT W+N+YL Q +PP  I DL  ++ DG+ LL LLE+L+   L  E  K MQ++HCLSN+RTAL F+E+ KKIKLVNINP+D+VDGKP+IVLGL+WT IL+FQIEEQE+ ++++L      +   K KG AKK L+AW  N L DKY ++I+DFG SW DG AFNA+VHNIDP+LV+ME++   TN+E LE AF  AE+ L IP+L+D EDVDV+KPDEKSIMTYVAQFLK+YPEG  KKP+ +   E+  +++ +   +  Q  N+L  + DF + V++              NY  F +   Q+  +K     LL + +  + L L  ++V  +   +     +LNEW+W LD  LPG LG ++G WL  AE  L EPFP+      D+     + Q+L EH +IF     +   F+E  ++    +  +QL  +  R+  V + E  VR+KL   
Sbjct:    1 MQRRQSFMSNVKNLRDEQERVQKKTFTNWINTYLIQCQPPCKIADLFPEVKDGIKLLLLLEVLSGQKLPHESRKVMQRVHCLSNVRTALSFLES-KKIKLVNINPADIVDGKPSIVLGLIWTIILYFQIEEQEDTIMKSLEGTELAERGEKFKGSAKKALLAWAQNNLGDKYAIDIRDFGNSWRDGSAFNAMVHNIDPSLVDMEKLGDRTNRENLEAAFAAAESGLNIPRLIDPEDVDVDKPDEKSIMTYVAQFLKAYPEGSKKKPKLLEQIEDAQSKVEAAKQAAEQERNDLRKISDFCEAVERELPTSGKGRGDPVENYKKFEEFRQQQAALKEAYEALLKRRADGHLLTLKPDEVDALEAQWRAASDQLNEWRWQLDSALPGDLG-KVGGWLARAERCLREPFPDTAAGEPDEAIAQALHQRLTEHRAIFADAPAMRKAFQEARKSAGRGLPAEQLADIDRRLTQVQQDEPEVRQKLEFL 481          
BLAST of Nesprin-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18315987 (tr|A0A267EZS9|A0A267EZS9_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015905g1 PE=4 SV=1)

HSP 1 Score: 338.961 bits (868), Expect = 9.518e-90
Identity = 214/481 (44.49%), Postives = 299/481 (62.16%), Query Frame = 2
Query:  146 MDRKDTVVKKGVLLKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMAN--DPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEG--KKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKN-----NYDIFADLMSQRDDMK----LLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFPNVH----DKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISPKQLEAMKTRMENVCKAEGPVREKLNIF 1537
            M R+ + +     L+DEQE++QKKTFT W+N+YL Q +PP  I DL  ++ DG+ LL LLE+L+   L  E  K MQ++HCLSN+RTAL F+E+ KKIKLVNINP+D+VDGKP+IVLGL+WT IL+FQIEEQE+ ++++L      +   K KG AKK L+AW  N L DKY ++I+DFG SW DG AFNA+VHNIDP+LV+ME++   TN+E LE AF  AE+ L IP+L+D EDVDV+KPDEKSIMTYVAQFLK+YPEG  KKP     ++  ++ +   +  Q  N+L  + DF + V++              NY  F +   Q+  +K     LL + +  + L L  ++V  +   +     +LNEW+W LD  LPG LG ++G WL  AE  L EPFP+      D+     + Q+L EH +IF     +   F+E  ++    +  +QL  +  R+  V + E  VR+KL   
Sbjct:    1 MQRRQSFMSNVKNLRDEQERVQKKTFTNWINTYLIQCQPPCKIADLFPEVKDGIKLLLLLEVLSGQKLPHESRKVMQRVHCLSNVRTALSFLES-KKIKLVNINPADIVDGKPSIVLGLIWTIILYFQIEEQEDTIMKSLEGTELAERGEKFKGSAKKALLAWAQNNLGDKYAIDIRDFGNSWRDGSAFNAMVHNIDPSLVDMEKLGDRTNRENLEAAFAAAESGLNIPRLIDPEDVDVDKPDEKSIMTYVAQFLKAYPEGSKKKP-----KLLEQVEAAKQAAEQERNDLRKISDFCEAVERELPTSGKGRGDPVENYKKFEEFRQQQAALKEAYEALLKRRADGHLLTLKPDEVDALEAQWRAASDQLNEWRWQLDSALPGDLG-KVGGWLARAERCLREPFPDTAAGEPDEAIAQALHQRLTEHRAIFADAPAMRKAFQEARKSAGRGLPAEQLADIDRRLTQVQQDEPEVRQKLEFL 474          
BLAST of Nesprin-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18292364 (tr|A0A1I8GMD0|A0A1I8GMD0_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 5.630e-87
Identity = 223/552 (40.40%), Postives = 324/552 (58.70%), Query Frame = 2
Query:  152 RKDTVVKKGVLLKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMAN--DPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPE-NISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLL---LDKMSTDN-YLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLME--PFPNVHDKTFNDKVLQKLKEHESIFNK-KNDVLAKFREVLQNPPANISPKQLEAMKTRMENVCKAEGPVREKLNIFGIQANLKNKAQKWAVDLNSWDSPIQSKQDLLDKIEQFNISMENGTSMDKFTSQLDELVKRKVKFCKENPVLDEDLLNFIN 1777
            R+ +++     L+DEQE++QKKTFT W+N+YL   +PP  I DL  ++ DG  LL LLE+L+   L+KE   NMQ++HCLSN+RTAL F+E+ K+IKLVNINP+D+VDGKP IVLGL+WT IL+FQIEEQE+ + ++L      +     KG AKK L+AW  N L DKY +++KDFG SW DG AFNA+VHNIDP+LV+M+ +   +N+E LE AF  AEN L IP+LLD+EDVDV+KPDEKSIMTY+AQFLK+YPEG K    + +++ A   +G    +    +LD + DF  KV+    N     +Y   A+L ++RD+++     L K S D   L     DV   +  + + + +L + +W LD  LPG  G  IG WL  AE  L +  P  +  D +  +++ ++L+EH  +F++    V    +   + PPA +S  Q+  M TR+  V   E  VR +L     +  L     +    L  W      +Q++ D    +N  + +G  +D     LD L K+     K +P    +   F++
Sbjct:    2 RRSSLMTNVKSLRDEQERVQKKTFTNWINTYLITCQPPCKISDLFTEIKDGTRLLLLLEVLSGNKLQKENRGNMQRVHCLSNVRTALSFLES-KQIKLVNINPADIVDGKPTIVLGLMWTIILYFQIEEQEDMIRKSLEGTELAERGELFKGSAKKALLAWAQNNLGDKYDVDLKDFGSSWRDGAAFNAMVHNIDPSLVDMDALRSRSNRENLEAAFQAAENGLNIPRLLDAEDVDVDKPDEKSIMTYIAQFLKAYPEGGKNRPKLQDQLDAARQAGEKERL----DLDSINDFCRKVESEAPN----GDYQTLAELQAERDNLQPSVEDLAKRSKDGRLLSTPPADVDAALAAWRQADDQLRKLRWRLDAELPGDFG-RIGQWLGRAEACLYQDWPADDAPDDSAAEELSERLREHNEVFSEDPQSVRRDLQAARRAPPAGVSDAQIANMDTRLGRVIADEPDVRRRLEFLEPKRRLLASLAQCERKLPLWTGKCGKQQEVEDLFSDYNAFVIDGKLVDGVEQALDSLRKQAEPMRKRDPSGSREADRFLS 543          
BLAST of Nesprin-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18303179 (tr|A0A267F524|A0A267F524_9PLAT Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010703g1 PE=4 SV=1)

HSP 1 Score: 320.857 bits (821), Expect = 1.013e-83
Identity = 223/552 (40.40%), Postives = 324/552 (58.70%), Query Frame = 2
Query:  152 RKDTVVKKGVLLKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMAN--DPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPE-NISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLL---LDKMSTDN-YLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLME--PFPNVHDKTFNDKVLQKLKEHESIFNKK-NDVLAKFREVLQNPPANISPKQLEAMKTRMENVCKAEGPVREKLNIFGIQANLKNKAQKWAVDLNSWDSPIQSKQDLLDKIEQFNISMENGTSMDKFTSQLDELVKRKVKFCKENPVLDEDLLNFIN 1777
            R+ +++     L+DEQE++QKKTFT W+N+YL   +PP  I DL  ++ DG  LL LLE+L+   L+KE   NMQ++HCLSN+RTAL F+E+ K+IKLVNINP+D+VDGKP IVLGL+WT IL+FQIEEQE+ + ++L      +     KG AKK L+AW  N L DKY +++KDFG SW DG AFNA+VHNIDP+LV+M+ +   +N+E LE AF  AEN L IP+LLD+EDVDV+KPDEKSIMTY+AQFLK+YPEG K    + +++ A   +G    +    +LD + DF  KV+    N     +Y   A+L ++RD+++     L K S D   L     DV   +  + + + +L + +W LD  LPG  G  IG WL  AE  L +  P  +  D +  +++ ++L+EH  +F++    V    +   + PPA +S  Q+  M TR+  V   E  VR +L     +  L     +    L  W      +Q++ D    +N  + +G  +D     LD L K+     K +P    +   F++
Sbjct:    2 RRSSLMTNVKSLRDEQERVQKKTFTNWINTYLISCQPPCKISDLFTEIKDGTRLLLLLEVLSGNKLQKENRGNMQRVHCLSNVRTALSFLES-KQIKLVNINPADIVDGKPTIVLGLMWTIILYFQIEEQEDMIRKSLEGTELAERGELFKGSAKKALLAWAQNNLGDKYDVDLKDFGSSWRDGAAFNAMVHNIDPSLVDMDALRSRSNRENLEAAFQAAENGLNIPRLLDAEDVDVDKPDEKSIMTYIAQFLKAYPEGGKNRPKLQDQLDAARQAGEKERL----DLDSINDFCRKVESEAPN----GDYQTLAELQAERDNLQPSVEDLAKRSKDGRLLSTPPADVDAALAAWRQADDQLRKLRWRLDAELPGDFGR-IGQWLGRAEACLYQDWPADDAPDDSAAEELSERLREHNEVFSEDPQSVRRDLQAARRAPPAGVSDAQIANMDTRLGRVIADEPDVRRRLEFLEPKRRLLASLAQCERKLPLWTGKCGKQQEVEDLFSDYNAFVIDGKLVDGVEQALDSLRKQAEPMRKRDPSGSREADRFLS 543          
BLAST of Nesprin-1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18316125 (tr|A0A1I8GVC4|A0A1I8GVC4_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 3.031e-83
Identity = 224/557 (40.22%), Postives = 324/557 (58.17%), Query Frame = 2
Query:  137 TD*MDRKDTVVKKGVLLKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMAN--DPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPE-NISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLL---LDKMSTDN-YLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLME--PFPNVHDKTFNDKVLQKLKEHESIFNK-KNDVLAKFREVLQNPPANISPKQLEAMKTRMENVCKAEGPVREKLNIFGIQANLKNKAQKWAVDLNSWDSPIQSKQDLLDKIEQFNISMENGTSMDKFTSQLDELVKRKVKFCKENPVLDEDLLNFIN 1777
             D +D  D +    V+ + EQE++QKKTFT W+N+YL   +PP  I DL  ++ DG  LL LLE+L+   L+KE   NMQ++HCLSN+RTAL F+E+ K+IKLVNINP+D+VDGKP IVLGL+WT IL+FQIEEQE+ + ++L      +     KG AKK L+AW  N L DKY +++KDFG SW DG AFNA+VHNIDP+LV+M+ +   +N+E LE AF  AEN L IP+LLD+EDVDV+KPDEKSIMTY+AQFLK+YPEG K    + +++ A   +G    +    +LD + DF  KV+    N     +Y   A+L ++RD+++     L K S D   L     DV   +  + + + +L + +W LD  LPG  G  IG WL  AE  L +  P  +  D +  +++ ++L+EH  +F++    V    +   + PPA +S  Q+  M TR+  V   E  VR +L     +  L     +    L  W      +Q++ D    +N  + +G  +D     LD L K+     K +P    +   F++
Sbjct:  558 ADGVDITDVIDAAIVIFRYEQERVQKKTFTNWINTYLITCQPPCKISDLFTEIKDGTRLLLLLEVLSGNKLQKENRGNMQRVHCLSNVRTALSFLES-KQIKLVNINPADIVDGKPTIVLGLMWTIILYFQIEEQEDMIRKSLEGTELAERGELFKGSAKKALLAWAQNNLGDKYDVDLKDFGSSWRDGAAFNAMVHNIDPSLVDMDALRSRSNRENLEAAFQAAENGLNIPRLLDAEDVDVDKPDEKSIMTYIAQFLKAYPEGGKNRPKLQDQLDAARQAGEKERL----DLDSINDFCRKVESEAPN----GDYQTLAELQAERDNLQPSVEDLAKRSKDGRLLSTPPADVDAALAAWRQADDQLRKLRWRLDAELPGDFG-RIGQWLGRAEACLYQDWPADDAPDDSAAEELSERLREHNEVFSEDPQSVRRDLQAARRAPPAGVSDAQIANMDTRLGRVIADEPDVRRRLEFLEPKRRLLASLAQCERKLPLWTGKCGKQQEVEDLFSDYNAFVIDGKLVDGVEQALDSLRKQAEPMRKRDPSGSREADRFLS 1104          
BLAST of Nesprin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000039764.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:24167966:24185412:1 gene:ENSAMXG00000043596.1 transcript:ENSAMXT00000039764.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 246.514 bits (628), Expect = 3.802e-70
Identity = 176/436 (40.37%), Postives = 261/436 (59.86%), Query Frame = 2
Query:  194 EQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKK------IKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNA--------------------KVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPE--NISEEITAEINSGLMSMVQPPNE--LDIVKDFNDKVDKNFENL-----NSKNNYDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLME--PFPNVHDKTFNDKVLQKLKEHE 1378
            EQE +QK+TFTKW+NS+L ++ PP+ I DL +D+ DG+ LL LLE+L+   L  E+ + +++IH +SNI TAL+F+E  +       IKLVNIN +D+ DG+P+IVLGL+WT IL+FQIEE    L     ++N  ++                    K +G AK+ L+ W     + + G+ +KDFG SW  G AF+++++ I P LV+ME +++ +N+E LE AF +AENELGIP+LLD EDVDV+KPDEKSIMTYVAQFLK YP+  + E     EE+   +NS L   VQ      L  +K + D+++++         N  + Y  F +   Q    +  ++ LL  +  D  L +D   V+Q    +D+  ++L +W   LDK LPG LG  IG+WL  AE +L E  P    H++T N  + +KL++H+
Sbjct:   10 EQESVQKRTFTKWINSHLAKRNPPLEINDLFEDIKDGVKLLALLEVLSGQRLPSEQGRQLKRIHWVSNIGTALKFLEGRRSVYRGSPIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPALQALSNSASSVDSMASSETASPPMKRKVVTKFQGNAKRALLRWVQCTATKRLGIEVKDFGSSWRTGVAFHSVIYAIRPDLVDMELVKRRSNRENLEEAFTVAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDPHQSETDGQQEEV---LNSSLNVFVQREERKVLRELKAWLDQLERDILRAQGAEGNLSDKYQAFKNFRVQYEVRKKQVESLLQPVHRDGKLSVDQAVVKQ---SWDQVSVRLLDWHIHLDKSLPGPLGV-IGAWLHRAELALREDIPIQQAHEETAN-IIHRKLEQHK 437          
BLAST of Nesprin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000036923.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:24166584:24185412:1 gene:ENSAMXG00000043596.1 transcript:ENSAMXT00000036923.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 246.514 bits (628), Expect = 4.894e-70
Identity = 176/437 (40.27%), Postives = 262/437 (59.95%), Query Frame = 2
Query:  191 DEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKK------IKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNA--------------------KVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPE--NISEEITAEINSGLMSMVQPPNE--LDIVKDFNDKVDKNFENL-----NSKNNYDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLME--PFPNVHDKTFNDKVLQKLKEHE 1378
            +EQE +QK+TFTKW+NS+L ++ PP+ I DL +D+ DG+ LL LLE+L+   L  E+ + +++IH +SNI TAL+F+E  +       IKLVNIN +D+ DG+P+IVLGL+WT IL+FQIEE    L     ++N  ++                    K +G AK+ L+ W     + + G+ +KDFG SW  G AF+++++ I P LV+ME +++ +N+E LE AF +AENELGIP+LLD EDVDV+KPDEKSIMTYVAQFLK YP+  + E     EE+   +NS L   VQ      L  +K + D+++++         N  + Y  F +   Q    +  ++ LL  +  D  L +D   V+Q    +D+  ++L +W   LDK LPG LG  IG+WL  AE +L E  P    H++T N  + +KL++H+
Sbjct:   12 NEQESVQKRTFTKWINSHLAKRNPPLEINDLFEDIKDGVKLLALLEVLSGQRLPSEQGRQLKRIHWVSNIGTALKFLEGRRSVYRGSPIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPALQALSNSASSVDSMASSETASPPMKRKVVTKFQGNAKRALLRWVQCTATKRLGIEVKDFGSSWRTGVAFHSVIYAIRPDLVDMELVKRRSNRENLEEAFTVAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDPHQSETDGQQEEV---LNSSLNVFVQREERKVLRELKAWLDQLERDILRAQGAEGNLSDKYQAFKNFRVQYEVRKKQVESLLQPVHRDGKLSVDQAVVKQ---SWDQVSVRLLDWHIHLDKSLPGPLGV-IGAWLHRAELALREDIPIQQAHEETAN-IIHRKLEQHK 440          
BLAST of Nesprin-1 vs. Ensembl Cavefish
Match: ENSAMXT00000045503.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:24166584:24193162:1 gene:ENSAMXG00000043596.1 transcript:ENSAMXT00000045503.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 252.292 bits (643), Expect = 1.651e-66
Identity = 188/522 (36.02%), Postives = 295/522 (56.51%), Query Frame = 2
Query:  191 DEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKK------IKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNA--------------------KVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYP-------EGKKPENISEEITAEINSGLMSMVQPPNELDIVK------DFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLME--PFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISP---KQLEAMKTRMENVCKAEGPVREKLNIFGIQANL-------KNKAQKWAVDLNSWDS 1603
            +EQE +QK+TFTKW+NS+L ++ PP+ I DL +D+ DG+ LL LLE+L+   L  E+ + +++IH +SNI TAL+F+E  +       IKLVNIN +D+ DG+P+IVLGL+WT IL+FQIEE    L     ++N  ++                    K +G AK+ L+ W     + + G+ +KDFG SW  G AF+++++ I P LV+ME +++ +N+E LE AF +AENELGIP+LLD EDVDV+KPDEKSIMTYVAQFLK YP       +G++ E    ++  E+ + L  +     E DI++      + +DK  + F+N   +  Y++      ++  ++ LL  +  D  L +D   V+Q    +D+  ++L +W   LDK LPG LG  IG+WL  AE +L E  P    H++T N  + +KL++H+ +          F+++ ++   N  P   +QL+ M  R   V  +      KL  + ++  L       ++K + W +     DS
Sbjct:   12 NEQESVQKRTFTKWINSHLAKRNPPLEINDLFEDIKDGVKLLALLEVLSGQRLPSEQGRQLKRIHWVSNIGTALKFLEGRRSVYRGSPIKLVNINATDIADGRPSIVLGLMWTIILYFQIEELTSNLPALQALSNSASSVDSMASSETASPPMKRKVVTKFQGNAKRALLRWVQCTATKRLGIEVKDFGSSWRTGVAFHSVIYAIRPDLVDMELVKRRSNRENLEEAFTVAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPDPHQSETDGQQEEREERKVLRELKAWLDQL-----ERDILRAQGAEGNLSDKY-QAFKNF--RVQYEV------RKKQVESLLQPVHRDGKLSVDQAVVKQ---SWDQVSVRLLDWHIHLDKSLPGPLGV-IGAWLHRAELALREDIPIQQAHEETANI-IHRKLEQHKDVLTNLEGHRQAFQQIHRDRSVNGVPVPAEQLQDMAERFNFVSTSSHVHLIKLEFWEMKYRLMAFLILAESKLKSWIIKYGRRDS 514          
BLAST of Nesprin-1 vs. Ensembl Cavefish
Match: syne1a (spectrin repeat containing, nuclear envelope 1a [Source:ZFIN;Acc:ZDB-GENE-030131-4172])

HSP 1 Score: 229.18 bits (583), Expect = 7.612e-59
Identity = 202/636 (31.76%), Postives = 326/636 (51.26%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALG--------------------MANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNEL--DIVKDFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLM-EPFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISP---KQLEAMKTRMENVCKAEGPVREKLNIFGIQANL-------KNKAQKWAVDLNSWDSPIQSKQDLLDKIEQFNISMENGTSMDKFTSQLDELVKRKVKFCKENPVLDEDLLNFINKAINECEEENDILPEKFESTLMKLENLSSEWDEISDGEQKIETFSRRLSKALQLDDFQQQRSLVDQLPEVLD 1993
            L+DEQE +QK+TFTKW+NS+L ++ PP+++KDL +D+ DG++LL LLE+L+   L  E+ + +++IH L+N+ TAL F+E  ++IKLVNIN +DVVDG+P+IVLGL+WT IL+FQIEE    L    G                    +   P    +G AK+ L+ W     + + GL++KDFG SW  G AF+A++  + P LVNME +    N+  LE AF++AE ELGIP+LLD EDVDV+KPDEKSIMTYVAQFLK +P+G + E++ ++   E    L  +    ++L  D  +   DK D   +   S   Y +  +L  +R  +   L     D  L  D    +Q    +++   +L +W   LD  LP  LG+ +G WL  AE+ L  EP P    +   + + Q L++H+ I          F+++ ++   +  P   +QL+ M  R+  +  +      KL  + ++  +       ++K + W V        +++ Q LL     F   +E      K+ S  ++L +  V +   +   +E +  F+    ++       L  +  S    L+ +   W++ S     ++ +      AL   +   +R     LP  +D
Sbjct:   35 LRDEQEAVQKRTFTKWINSHLAKRDPPLVVKDLYEDIKDGVMLLALLEVLSGHKLPCEQGRKLRRIHWLANVGTALRFLEG-RRIKLVNINTTDVVDGRPSIVLGLIWTIILYFQIEELTSSLPPQKGQNSSNSSVDSSNSTETASPPVKRKPRLSFQGGAKRALLKWVQRTATKRLGLDVKDFGPSWRSGVAFHAVIFALRPQLVNMERVWNRPNRANLEEAFSLAERELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHHPDGGEAESVGQQEEREQRKVLRELKVWADQLEKDCAQAQMDKGDPGHQ-YKSFKQYRVQYEL--KRRQVLSSLQSTQRDGILTSDQALFKQA---WERISTRLLDWHIQLDSALPNPLGA-VGIWLHQAEKILQEEPLPQQSHEQTANAIHQTLQQHQEILGLFETHQQTFQQLHRDRSVSGVPVPAEQLQDMAERLNYISTSSHVHLSKLEFWELKYRMLALLTLGESKLKSWIVKYGR----LETTQLLLQSYVSF---VEGQQFFQKYESLYEDLKQAAVLYTNADSSAEEAVRRFLRDMADQWRS----LAVEIRSVRSMLKEVEGNWEKYSSAVSSLQAWLEDAQVALHQPE-NTKREFFRNLPHWMD 650          

HSP 2 Score: 63.929 bits (154), Expect = 6.202e-9
Identity = 84/377 (22.28%), Postives = 164/377 (43.50%), Query Frame = 2
Query: 11129 ITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATEL-----ANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENAEQGKTTNNTIQEIETLIKHSNEIIANILSQEPEI-----VKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQD 12229
            + K +N L  +   EC   + L++   ++  S  D   W+  +  +  KC D      +  + L  I     + E  GQ++    +  GE+L   +    ++ V+ + +    DW  +   L Q  + L+   SR +AF+E    L +WL+  E T + D S   H  ++P +         + +++L E+   + +   L   A  L     A   F     Q+  RY+ LSN  K+K+ ++ +   ++    Q ++E++ WV +   +I+    E  ++T      + T + H  +++     QE EI     +  G+AV    N S        K++QD    L ++++ L S +I  +  L+ ++  W +YQ+
Sbjct: 2916 LIKLHNSLGLRASRECQNKEKLLE--QRFRSSLRDFRQWLVNANISTAKCFDSPHSIQEASAALQRIQEFMSDREQ-GQARLDAVLAHGEQLSAVVQADRVEAVRAKTSAASDDWRSLMDNLQQREAILQGLQSRMQAFEESLQPLQDWLNRTEIT-VQDSSTRLH--DLPAKRLELC----KLQSVLEEMCCREPELGGLRERAHSLWEGQAAGKGFVHRVCQLAARYLALSNRTKEKVSRIERVVGEHQLFSQGLQELQSWVSEAQ-KIL----ETCRSTTADKSMLVTRMGHLEDLLTA--RQEREIQLKMLITRGEAVQR--NTSAEGVPVVRKQIQD----LKDSWDLLLSGTIQCKSQLEGALSHWTSYQE 3269          
BLAST of Nesprin-1 vs. Ensembl Cavefish
Match: MACF1 (microtubule actin crosslinking factor 1 [Source:HGNC Symbol;Acc:HGNC:13664])

HSP 1 Score: 155.606 bits (392), Expect = 4.179e-38
Identity = 104/284 (36.62%), Postives = 156/284 (54.93%), Query Frame = 2
Query:  158 DTVVKKGVLLKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYP------EGKKPENISEEITAEINSGLMSMVQ 991
            D   +  V + DE++++QKKTFTKW+N +L + +  I                 +  +   + ++  + K   + H L N++ AL+F++  +++KLVNI   D+ DG P + LGL+WT ILHFQI E         G + D  AK K      L+ WT  A     GL   +F  SW +GR FNAL+H   P L++ME + + +N+E LE AF IAE+ LG+ +LLD+EDVDV  PDEKS++TYV+    ++P      EG  P  + +   AE  S   S++Q
Sbjct:   54 DPAERAVVRVADERDRVQKKTFTKWVNKHLIKVRKHIT----DLYEDLRDGHNLISLLEVLSGVQLPREKGRMRFHRLQNVQIALDFLKQ-RQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISEIYVS-----GESGDLTAKEK------LLLWTQQATEGYPGLRCSNFSSSWSNGRMFNALLHRYRPDLIDMEVVARQSNRENLEQAFEIAES-LGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKIPEGGEGITPHEVDQRW-AEYQSRFSSLLQ 319          
BLAST of Nesprin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009426.1 (pep scaffold:Pmarinus_7.0:GL476614:383620:553344:1 gene:ENSPMAG00000008375.1 transcript:ENSPMAT00000009426.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.126 bits (492), Expect = 6.246e-49
Identity = 153/409 (37.41%), Postives = 222/409 (54.28%), Query Frame = 2
Query:  191 DEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWT---------AXXXXXXXXXXXXXXXALGMANDPNAK---------VKGQAKKGLMAWTNNAL----SDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPEN--ISEEITAEINSGLMSMVQPPNELDIVK--DFNDKVDKNFENLN-------SKNNYDIFADLMSQRDDMK----LLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESL 1306
            DEQE +QK+TFTKW+NS+L   +PP+++ DL KDL DG+ L+ LLE+LT   L  E+ + +++IH LSNI TAL+FME  ++IKLVNIN   + DGKP+IVLGL+WT         A  +               M     A          ++  AKK L+ W    +    S   G  I+DFG SW  G AF+ ++  I P LVN+E++ + +N E LE AF +AE +LGIP+LLD +DVDV+KPDEK IMTYVAQFLK YP   + E   + +E+           V      D +K  +    +++  ++++        K +Y  F  +    +D K    L+L  +  +  L ++ +  ++   D+D    KL EWQ  LD  LP  L +E+G WL   E +L
Sbjct:    1 DEQEAVQKRTFTKWINSHLALVRPPLVVDDLFKDLRDGVKLIALLEVLTGERLPYEQGRQLKRIHALSNIGTALKFMEA-RRIKLVNINAPYIADGKPSIVLGLIWTIILYFQIEEATNNLLPISPWSSETSLSSMEGSSTASPQRKRRQTPMRSTAKKALLKWVQLVVPSLESRVGGTEIRDFGASWRTGIAFHLMIRAIQPELVNLEQVTQRSNHENLEEAFIVAEEKLGIPRLLDPKDVDVDKPDEKIIMTYVAQFLKHYPNAAESEGNLLGDEVCLSTIPTFALSVPKLQREDRIKFMELQAWLNQAIKDVSLQATPEALKEHYQAFRRIKVPYEDRKSTVLLMLQPLKGNGKLSVEQSTAKK---DWDLLSAKLWEWQGLLDGALPPPL-AEVGVWLHRVETAL 404          

HSP 2 Score: 55.0694 bits (131), Expect = 6.557e-7
Identity = 63/301 (20.93%), Postives = 130/301 (43.19%), Query Frame = 2
Query: 11201 LMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELE-----NYGQSKFVEAIQDGEELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATELANP------SFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENAEQGKTT--NNTIQEIETLI--KHSNEIIANILSQEPEIVKIGQ 12058
            L +++  +  DV  W+  +  +L++ SD  +         ++ D+L+K  E       GQS+       GE L+  L       VQ ++A  + +W  +   LN+  + L+    + E  +  +  +  WL + E T L   +    Q ++P +         R +++L ++  H     +L   A ++A        SF +  S +  RY+ L+N  KD+ ++  +   ++ Q +Q   E++ W+  + + +    A  G  T   + + ++E L+  +   EI  N++    + V I Q
Sbjct: 2737 LESRFRSALRDVQLWMAQARASLVQGSDTGVA--------VVTDSLQKTQEVLSQSEEGQSRLNTLASKGELLMSVLGHEEAGGVQAELASAREEWKALLGSLNKQEAQLQGLQEQLEELEASTAPVHKWLGETE-TSLAQAADGGAQADLPAKR----QLQRRLQSVLEDVACHAPQLARLRERAQQMAEACAPAAHSFGLRVSALNTRYLALANLAKDQAQRATRALQEHQQFEQGWRELQDWLADSRLLLDTYLAPSGDRTVLRSRLAKVEALVATRLEKEIQLNLVLSRGDTVLITQ 3024          
BLAST of Nesprin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006506.1 (pep scaffold:Pmarinus_7.0:GL476558:286440:335800:-1 gene:ENSPMAG00000005865.1 transcript:ENSPMAT00000006506.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 151.754 bits (382), Expect = 4.755e-37
Identity = 88/242 (36.36%), Postives = 137/242 (56.61%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNAKVKG-----QAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVA 895
            L DE++++QKKTFTKW+NS+L Q +  I                 +  + + +     + K   ++H + NI+  L ++++ +++KLVNI   D+VDG P + LGL+WT I               L   N   A ++G     Q+++ L+AW      D  GL+  +F  SW DGR   A+VH   P LV++EE+ +   ++ LE A ++AE+ELG+P+LLD EDVDV+ PDEKSI+TYV+
Sbjct:    1 LADERDRVQKKTFTKWINSHLQQVRMNI----GDLYEDLRDGQALISLLESLSGDCIIREKGRLRVHHVQNIQIVLNYLQH-QQVKLVNIRKEDIVDGNPKLTLGLIWTII---------------LHYQNASFAHIEGNHSSMQSRERLLAWARLVAKDVPGLSCHNFSSSWRDGRLLCAIVHAHRPGLVDLEEVRRRGARQNLEEALSLAESELGVPRLLDPEDVDVDAPDEKSIITYVS 222          
BLAST of Nesprin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006515.1 (pep scaffold:Pmarinus_7.0:GL476558:286719:335794:-1 gene:ENSPMAG00000005865.1 transcript:ENSPMAT00000006515.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 1.993e-35
Identity = 87/237 (36.71%), Postives = 135/237 (56.96%), Query Frame = 2
Query:  191 DEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQF 901
            DE++++QKKTFTKW+NS+L Q +  I                 +  + + +     + K   ++H + NI+  L ++++ +++KLVNI   D+VDG P + LGL+WT ILH+Q+             A        G+ +  L+AW      D  GL+  +F  SW DGR   A+VH   P LV++EE+ +   ++ LE A ++AE+ELG+P+LLD EDVDV+ PDEKSI+TYV+  
Sbjct:    1 DERDRVQKKTFTKWINSHLQQVRMNI----GDLYEDLRDGQALISLLESLSGDCIIREKGRLRVHHVQNIQIVLNYLQH-QQVKLVNIRKEDIVDGNPKLTLGLIWTIILHYQVS------------AGQVGGGTPGRER--LLAWARLVAKDVPGLSCHNFSSSWRDGRLLCAIVHAHRPGLVDLEEVRRRGARQNLEEALSLAESELGVPRLLDPEDVDVDAPDEKSIITYVSAL 218          
BLAST of Nesprin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002838.1 (pep scaffold:Pmarinus_7.0:GL477168:22072:87306:1 gene:ENSPMAG00000002584.1 transcript:ENSPMAT00000002838.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.976 bits (367), Expect = 3.753e-35
Identity = 96/271 (35.42%), Postives = 144/271 (53.14%), Query Frame = 2
Query:  179 VLLKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNAKVKGQ-----AKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGL 976
            +L+ DE++++QKKTFTKW+N +L + +  +                 +  +   +  K  + K   + H L N++ AL+F+   ++IKLVNI   D+ DG P + LGL+WT ILHFQI                 + +V GQ     AK  L+ W+   +    G+   +F  SW DGR FNA++H   P L++M+ +    N+E LE AF +AE ++G+ +LLD EDVDV  PDEKSI+TYV+      P  + P         E+NSGL
Sbjct:    2 LLIADERDRVQKKTFTKWVNKHLMKVRKHV----NDMYEDLRDGHNLISLLEVLSGEKLPREKGRMRFHRLHNVQIALDFLRL-RQIKLVNIRSDDIADGNPKLTLGLIWTIILHFQI----------------ADIQVSGQSEDMTAKDRLLLWSQRMVEGYPGIRCDNFTTSWRDGRLFNAIIHRHRPELIDMKRVAVRANRENLEQAFTVAERDMGVTRLLDPEDVDVPSPDEKSIITYVSSLYDVIP--RMP---------EVNSGL 240          
BLAST of Nesprin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008111.1 (pep scaffold:Pmarinus_7.0:GL478136:8967:48859:1 gene:ENSPMAG00000007298.1 transcript:ENSPMAT00000008111.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.976 bits (367), Expect = 1.637e-34
Identity = 92/247 (37.25%), Postives = 141/247 (57.09%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGK 925
            L DE+E +QKKTFTKW+NS+L +    I     +        +L  L  +       +  +   +IHCL N+  AL+F++ ++K+ L N+   D+VDG   ++LGL+WT IL FQI++        + +  + N K +  AK  L+ W     +    +NI +F  SW DG AFNA+VH   P L+  ++++K      L+NAFNIAE +LG+ KLLD ED+ V++PDEKSI+TYV  +   + + K
Sbjct:   51 LADEREAVQKKTFTKWVNSHLARVSCRIT---DLYTDLRDGRMLIKLLEVLSGEKLPKPTRGKMRIHCLENVDKALQFLK-EQKVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQD--------ISVETEDN-KERRSAKDALLLWCQMKTAGYQNVNIHNFTTSWRDGLAFNAIVHKHRPDLIEFDKLKKSNAHHNLQNAFNIAEQKLGLTKLLDPEDISVDQPDEKSIITYVVTYYHYFSKMK 284          
BLAST of Nesprin-1 vs. Ensembl Nematostella
Match: EDO37708 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF38])

HSP 1 Score: 149.443 bits (376), Expect = 3.141e-35
Identity = 95/249 (38.15%), Postives = 142/249 (57.03%), Query Frame = 2
Query:  191 DEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNAKVKGQ------AKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDV-EKPDEKSIMTYVAQFLKSYP 916
            D ++ +QKKTFTKW+N+ L +    + ++ L            LL +     +K  + + + + H L N++TALEF+E+ KKIKLVNI   D+VDG P + LGL+WT IL+F                ND + ++ G+      AK  L+ W+         +++K+F  SW DG AFNA++H   P LV+  ++ K + +  +E AF++AE EL +P+LLD EDV V E PDEKSIMTYVA   + +P
Sbjct:   33 DHRDAVQKKTFTKWVNNRLLK----VGVRILDLYEELRDGEDLLLLLEVLCNVKLPRERGLLRFHMLQNVQTALEFLES-KKIKLVNIRSDDIVDGNPKLTLGLIWTIILYF--------------QINDLDVEIAGEKVQDLSAKDALLHWSKKVTQGYPKVDVKNFSSSWRDGFAFNAIIHRYRPDLVDFSKLSKTSPEANIEYAFHVAEKELNVPRLLDVEDVVVSENPDEKSIMTYVASLYEVFP 262          
BLAST of Nesprin-1 vs. Ensembl Nematostella
Match: EDO29101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4L2])

HSP 1 Score: 131.339 bits (329), Expect = 3.258e-32
Identity = 95/257 (36.96%), Postives = 149/257 (57.98%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEIT 955
            LK+E+   QKKTFTKW+NS+L + +  + + DL +DL+DG +L+ LLEI++   +         ++H + N+  ALEF++  K +KL +I   DVVDG   ++LGL+W  IL FQI +             D  +K +  AK+ L+ W          ++I++F  SW +G AFNAL+H   P L++   +    ++  L NAF +AE +LGI +LLD+EDVD  +PD++S+MTYVA + + + + K  E     I 
Sbjct:   17 LKNERIFSQKKTFTKWVNSFLDKVRSGLHVNDLFEDLADGKILISLLEIISGEKIGFAARGKF-RVHNIQNVNKALEFLQ--KSVKLESIGAEDVVDGNERLILGLIWMIILRFQIADISY---------QDDMSKERKSAKEALLLWCQRMTRGYPDVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAEEKLGITRLLDAEDVDCPRPDDRSVMTYVAAYYQYFAKLKSEETGGRRIA 261          
BLAST of Nesprin-1 vs. Ensembl Nematostella
Match: EDO37406 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFT6])

HSP 1 Score: 124.79 bits (312), Expect = 4.784e-31
Identity = 96/261 (36.78%), Postives = 144/261 (55.17%), Query Frame = 2
Query:  191 DEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDG----------------KPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNAKVKG--------QAKKGLMAWTNNALSDKYGLN--IKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVA 895
            D+QEK+QKKTFTKWMN YL + KP + + D+  +L DG  LL LLE+L+   L+KE+    ++ H L+N+   ++F+  +KK+KLVNI+P  +VDG                + + +   +       +           +  A +  ++++G        + +K ++ W   A S   G N  IKDF  SW  G+AF  ++H+  P LVN+  I +  N   L  AF++A   L +PKLL+ EDVDVEKPDEKSIMTY+A
Sbjct:    7 DDQEKIQKKTFTKWMNFYLAKSKPSVQVDDIFTELQDGTKLLTLLEVLSGEKLRKERGN--KRPHQLANLGHVIDFL-TEKKVKLVNIHPESIVDGNTTIILGLLWIIIHHYQSSKIAQNIKAQRSLSEKYRIVPASNSLVPCAFETISQIQGFYATKKKVRTRKFMLEWAKKATSKASGSNEAIKDFSTSWRTGQAFLQIIHSFRPDLVNIATIAERDNITNLTEAFDLAYTHLNVPKLLEPEDVDVEKPDEKSIMTYMA 264          
BLAST of Nesprin-1 vs. Ensembl Nematostella
Match: EDO42431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C0])

HSP 1 Score: 135.191 bits (339), Expect = 5.247e-31
Identity = 99/251 (39.44%), Postives = 146/251 (58.17%), Query Frame = 2
Query:  182 LLKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPE 934
            +L DE+E++QKKTFTKW+NS+L  ++    + +L  DL DG  L+ LLE+L+   L K     M +IH L N+  +L F++  +++ L N+   D+VDG   I LGL+WT IL FQI+           +  +     K  AK  L+ W  +       + I +F  SW DG AFNA++H   P L+  E++ K   ++ LE AF +AE +LGI  LLD+EDV+V+ PDEKSI+TYVA +   + + K  E
Sbjct:   17 VLADERERVQKKTFTKWINSHL--QRVGARVNELYHDLQDGRKLILLLEVLSGEKLPKPSKGRM-RIHNLENVEKSLVFLKK-QRVHLENVGAHDIVDGNQKITLGLIWTIILRFQIQ----------DITIEGETTEKRSAKDALLLWCQSKTVGYVHVTITNFTTSWRDGLAFNAIIHRHRPDLIEFEKLTKADAEQNLEQAFEVAETQLGITPLLDAEDVNVDFPDEKSILTYVAAYYHYFAKMKTVE 253          
BLAST of Nesprin-1 vs. Ensembl Nematostella
Match: EDO49576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP7])

HSP 1 Score: 130.183 bits (326), Expect = 7.178e-30
Identity = 96/257 (37.35%), Postives = 148/257 (57.59%), Query Frame = 2
Query:  185 LKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEIT 955
            LK+E+   QKKTFTKW+NS+L   K  + + DL +DL+DG +L+ LLEI++   +         ++H + N+  ALEF++  K +KL +I   DVVDG   ++LGL+W  IL FQI +             D  +K +  AK+ L+ W         G++I++F  SW +G AFNAL+H   P L++   +    ++  L NAF +A  +LGI +LLD+EDVD  +PD++S+MTYVA + + + + K  E     I 
Sbjct:   17 LKNERIFSQKKTFTKWVNSFL--DKSGLHVNDLFEDLADGKILISLLEIISGEKIGFAARGKF-RVHNIQNVNKALEFLQ--KSVKLESIGAEDVVDGNERLILGLIWMIILRFQIADISY---------QDDMSKERKSAKEALLLWCQRMTRGYPGVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAAEKLGITRLLDAEDVDCPRPDDRSVMTYVAAYYQYFAKLKSEETGGRRIA 259          
BLAST of Nesprin-1 vs. Ensembl Medaka
Match: ENSORLT00000000374.2 (pep primary_assembly:ASM223467v1:22:316712:329038:1 gene:ENSORLG00000000306.2 transcript:ENSORLT00000000374.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 241.506 bits (615), Expect = 4.544e-66
Identity = 179/468 (38.25%), Postives = 260/468 (55.56%), Query Frame = 2
Query:  194 EQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWT---------------AXXXXXXXXXXXXXXXALGMANDPN-----AKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNF-----ENLNSKNNYDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFPNVHDKTFNDKVL-QKLKEHESIFNKKNDVLAKFREVLQNPPAN---ISPKQLEAMKTRMENVC 1498
            EQE +QK+TFTKW+NS+L +      + DL +D+ DG+ LL LLE+L+   L  E+ +++++IH +SNI TAL+F+E  +KIKLVNI+ +DV DG+P+IVLGL+WT               A+  F         L +    + P       K +G AKK L+ W     +  +G+ +KDFG SW DG AF ++VH I P LV+MEE+ + +N+E LE AF++AENELGIP+LLD EDVDV+KPDEKSIMTYVAQFLK YP         E +    +  L    +    L  +K F D+++K+       + N  + Y +F     Q    +   + LL  +  D  L +D   V+Q    +D    +L +W   LDK LPG LGS IG+WL  AE +L E FP  H       VL +KL++H+ +          F+++ ++   +   + P+QL+ M  R   V 
Sbjct:    5 EQEAVQKRTFTKWINSHLEK------MNDLFEDIKDGVKLLALLEVLSGQRLPCEQGRHLKRIHWVSNISTALKFLEG-RKIKLVNIHATDVADGRPSIVLGLIWTIILYFQIEELTSNLPALQAFSNSSSSVDSLTSSETGSPPVKRKVLHKFQGNAKKVLLRWVQCTAAKHHGIEVKDFGPSWRDGVAFQSMVHAIRPDLVDMEEVRRRSNRENLEEAFSLAENELGIPRLLDPEDVDVDKPDEKSIMTYVAQFLKHYPNPGPAAGQQEVLLWPADCNLTR--EERKMLRELKVFLDQLEKDVLRAQGSDGNLSDKYQVFKHFHVQFEMKKKQAEPLLQPVHPDGKLSVDQALVKQA---WDHVSARLLDWHIHLDKSLPGPLGS-IGAWLHRAEMALREDFPLHHAPEETANVLHRKLQQHQDVLKNLEVHRRTFQQIHKDRSVHGVPVPPEQLQDMAERFNFVS 459          
BLAST of Nesprin-1 vs. Ensembl Medaka
Match: ENSORLT00000028699.1 (pep primary_assembly:ASM223467v1:24:9030419:9045840:-1 gene:ENSORLG00000028886.1 transcript:ENSORLT00000028699.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 207.223 bits (526), Expect = 1.185e-56
Identity = 165/446 (37.00%), Postives = 245/446 (54.93%), Query Frame = 2
Query:  194 EQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKK------IKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXX---------------------XXXALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNN-----YDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLM-EPFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFR 1420
            EQE +QK+TFTKW+NS+L +  PP+ +KDL +D+ DG++LL LLE+L+   L  E+ K +++IH ++NI TAL+F+E  K       IKLVNIN +D+VDG+P+IVLGLVWT IL++QIEE                            +  +   P   V+G A+K L+ W     +    L +KDFG SW  G AF AL++ + P LV+ME + + +N+E L+ AF +AE ELGIP+LLD EDVDV+KPDEKS+MTYVAQFLK YP  +K  +   +   E+ S   +  +    L  +K + D+++++              Y +F  L  Q    R  ++  L     D  L +D   V+Q    +++    L +W   LD+ LP  L + +G WL +AE +L  E    + D    + V + L++H+         L  FR
Sbjct:   15 EQEAVQKRTFTKWINSHLAKHAPPLEVKDLFEDIKDGVMLLALLEVLSGQKLPCEQGKKLKRIHWVANIGTALKFLEGRKSAYRGSPIKLVNINSTDIVDGRPSIVLGLVWTIILYYQIEELTSSLPELPLLSSSTSSMDSSTSSTDTTSPPVKRKPLPPVQGGARKALLRWVQQTSTKCLRLEVKDFGPSWRTGLAFFALINALRPNLVDMERVRRRSNRENLQEAFLLAETELGIPQLLDPEDVDVDKPDEKSVMTYVAQFLK-YPPQRKQRDAQGQQQEEVTS-CQNCREQRKALRELKMWLDQLERDALQTQETGGSLAQQYQLFKSLHVQLEVRRKQVEGALQSTQRDGMLTVDQALVKQA---WERAS-NLLDWHLQLDRSLPAPLDT-VGVWLHEAEGALRDEMVVQLADDITANTVHRALEQHKVNGEAHEYFLPSFR 453          
BLAST of Nesprin-1 vs. Ensembl Medaka
Match: ENSORLT00000033742.1 (pep primary_assembly:ASM223467v1:24:9030654:9050235:-1 gene:ENSORLG00000028886.1 transcript:ENSORLT00000033742.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 213.386 bits (542), Expect = 1.689e-56
Identity = 175/477 (36.69%), Postives = 258/477 (54.09%), Query Frame = 2
Query:  197 QEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXX---------------------XXXALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNN-----YDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFP----------NVHDKTFNDK-VLQKLKEHESIFNKKNDVLAKFREVLQNPPANISPKQLEAMKTRMENVCKA 1504
            QE +QK+TFTKW+NS+L +  PP+ +KDL +D+ DG++LL LLE+L+   L  E+ K +++IH ++NI TAL+F+E  +KIKLVNIN +D+VDG+P+IVLGLVWT IL++QIEE                            +  +   P   V+G A+K L+ W     +    L +KDFG SW  G AF AL++ + P LV+ME + + +N+E L+ AF +AE ELGIP+LLD EDVDV+KPDEKS+MTYVAQFLK YP  +K  +   +   E+ S   +  +    L  +K + D+++++              Y +F  L  Q    R  ++  L     D  L +D   V+Q      +    L +W   LD+ LP  L + +G WL +AE +L +              VH      K VL+ L+ H+ IF +    + K R V   P   + P QL+ M  R+  V  +
Sbjct:   19 QEAVQKRTFTKWINSHLAKHAPPLEVKDLFEDIKDGVMLLALLEVLSGQKLPCEQGKKLKRIHWVANIGTALKFLEG-RKIKLVNINSTDIVDGRPSIVLGLVWTIILYYQIEELTSSLPELPLLSSSTSSMDSSTSSTDTTSPPVKRKPLPPVQGGARKALLRWVQQTSTKCLRLEVKDFGPSWRTGLAFFALINALRPNLVDMERVRRRSNRENLQEAFLLAETELGIPQLLDPEDVDVDKPDEKSVMTYVAQFLK-YPPQRKQRDAQGQQQEEVTS-CQNCREQRKALRELKMWLDQLERDALQTQETGGSLAQQYQLFKSLHVQLEVRRKQVEGALQSTQRDGMLTVDQALVKQAW----ERASNLLDWHLQLDRSLPAPLDT-VGVWLHEAEGALRDEMVVQLADDITANTVHRALEQHKDVLRSLESHQQIFQR----IHKDRSVDGVP---VPPDQLQDMAERLNFVSTS 480          
BLAST of Nesprin-1 vs. Ensembl Medaka
Match: ENSORLT00000031933.1 (pep primary_assembly:ASM223467v1:24:9030419:9050235:-1 gene:ENSORLG00000028886.1 transcript:ENSORLT00000031933.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 205.297 bits (521), Expect = 5.275e-56
Identity = 164/445 (36.85%), Postives = 242/445 (54.38%), Query Frame = 2
Query:  197 QEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKK------IKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXX---------------------XXXALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNN-----YDIFADLMSQ----RDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLM-EPFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFR 1420
            QE +QK+TFTKW+NS+L +  PP+ +KDL +D+ DG++LL LLE+L+   L  E+ K +++IH ++NI TAL+F+E  K       IKLVNIN +D+VDG+P+IVLGLVWT IL++QIEE                            +  +   P   V+G A+K L+ W     +    L +KDFG SW  G AF AL++ + P LV+ME + + +N+E L+ AF +AE ELGIP+LLD EDVDV+KPDEKS+MTYVAQFLK YP  +K  +   +   E+ S   +  +    L  +K + D+++++              Y +F  L  Q    R  ++  L     D  L +D   V+Q      +    L +W   LD+ LP  L + +G WL +AE +L  E    + D    + V + L++H+         L  FR
Sbjct:   19 QEAVQKRTFTKWINSHLAKHAPPLEVKDLFEDIKDGVMLLALLEVLSGQKLPCEQGKKLKRIHWVANIGTALKFLEGRKSAYRGSPIKLVNINSTDIVDGRPSIVLGLVWTIILYYQIEELTSSLPELPLLSSSTSSMDSSTSSTDTTSPPVKRKPLPPVQGGARKALLRWVQQTSTKCLRLEVKDFGPSWRTGLAFFALINALRPNLVDMERVRRRSNRENLQEAFLLAETELGIPQLLDPEDVDVDKPDEKSVMTYVAQFLK-YPPQRKQRDAQGQQQEEVTS-CQNCREQRKALRELKMWLDQLERDALQTQETGGSLAQQYQLFKSLHVQLEVRRKQVEGALQSTQRDGMLTVDQALVKQAW----ERASNLLDWHLQLDRSLPAPLDT-VGVWLHEAEGALRDEMVVQLADDITANTVHRALEQHKVNGEAHEYFLPSFR 456          
BLAST of Nesprin-1 vs. Ensembl Medaka
Match: ENSORLT00000037920.1 (pep primary_assembly:ASM223467v1:11:16926158:17021095:-1 gene:ENSORLG00000025786.1 transcript:ENSORLT00000037920.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 151.369 bits (381), Expect = 1.212e-36
Identity = 102/267 (38.20%), Postives = 150/267 (56.18%), Query Frame = 2
Query:  158 DTVVKKGVLLKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITA 958
            D   +  V + DE++++QKKTFTKW+N +L + +  I                 +  +   + +   + K   + H L N++ AL+F++  +++KLVNI   D+ DG P + LGL+WT ILHFQI E         G + D  AK K      L+ W+  A     GL   +F  SW DGR FNAL+H   P L+NME + + +N++ LE AF IAE+ LG+ +LLD+EDVDV  PDEKS++TYV+    ++P  K PE   E I+A
Sbjct:   64 DPAERAVVRVADERDRVQKKTFTKWVNKHLIKVRKHI----ADLYEDLRDGHNLISLLEVLSGVALPREKGRMRFHRLQNVQIALDFLKQ-RQVKLVNIRNDDITDGNPKLTLGLIWTIILHFQISEIYVS-----GESADLTAKEK------LLLWSQQATDGYPGLRCVNFTSSWSDGRMFNALLHRYRPDLINMEVVSQQSNRDNLEQAFEIAES-LGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFP--KIPEG-GEGISA 310          
BLAST of Nesprin-1 vs. Planmine SMEST
Match: SMESG000077685.1 (SMESG000077685.1)

HSP 1 Score: 6555.7 bits (17007), Expect = 0.000e+0
Identity = 3471/3576 (97.06%), Postives = 3514/3576 (98.27%), Query Frame = 2
Query: 3164 DWQDFKQTKDLMTKCFDDIIDDLKESHQKRKGVHGENLTDKADXXXXXXXXXXXXIKQEDXXXXXXXXXXXXXXEKPINEVKNLKDQILKQKANLEEEIQQNEKDLENHQQFNNDIQSLHDWLAQTELLTNQIQNLPNTKEGLIEKQKLLEDLNSLKSTGDKKLKELKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLDKQGGINETIEKIEDLGEKSDQISENINEINKRLEKCLNLPSNTLNEKEKLAKELNNTIRLVDQQLAQINDLKSQCGSLEHSAALEDLLNKLESLEEHCFXXXXXXXXXXXXVDSDIKFQSALEEKLNDLSEIMNEVEIEFDYSKPKESSEAAINESLSQLQKLKAQHEPGKNILKTMIKLRNEFNAPEQCVTACNDLEQKYFDIEDDIKNLQKELEMKTTVWQKFNALKADLDKTCNTAILEIGNEHKKRSGIHGGDCEDKFNLLEDKKKILSNMTNKDPQVDALIEVSGKLGFDKALFDAQNIKRKYLKLIDDLQQEISQNEIDLDNHKKFDQSLFEFEDWMKNTEKIVKQIANLPNDKNGLLEKQNRLEEMKTLKSNGNEMIKNIKHLQNVVINETAGNFKTTLNEKVKNKIENFERVFGDLDQETDNIKETIDKLKVIDEKSXXXXXXXXXXXXXXXKCSIVPSESVGDKEKLGKIYRSLEHDIEQHLIDLDSLKQQCNALNATTANSAMINKLNKMTDECKSMKADISQLFSKNVSDLKNLKTFQDKMNEFNESMDRIETEIEKCSPNGCNEAAIKDNIKKLKKFRSLHENSKDVLTDLLRIGFELSGLSQISEASDQAEQKYSDVEDEITKLESKLEMQKNDWSNFNSDKNDLEKWLNEITKKVENLEQISDGIHGGKLSEKEKVLDSHQKLLQEALNREADIKLFLDRSTPLFSAVNQDSPKRVTNTLCKKYEKLLETLTNRIQKNEEDINLHENYAKQIDNFKEENNIIIKRMNEEIASLPNTKEGLKRKVDLLGNLKDLYNQRKMILVNLENLKNAVIDHSSSNYYSNLEQEWDQIIDSFEKSFNPSIENQSKLLLAVQQIEKTESICQDLQHQLENLERRLQEAVDQHISSLNDIDMKLETLKELRYELRDLQTPINDVQRKHCQNPSDVELIQERIEQIAKQHKVLNESISQNINETENHHKQLCNLTTSLNNFKTWLDYSSSQIEEKGKPGNLEMNNLKKNLTSLKQLADSISCQCDDQLSKIREHMLKIHKFSSEKLKDDLQKELNIMNGNVNSLKDKIQTTTEHEINRINEVEKIDILKNEIKENFLKFESQININFKNFDLNEKQNYITQLRNVQNLMKENEKKIEFLETSIQNIIKHSHGKMLDXXXXXXXXXXXXXXXQLNELINKLTQMSDEQMQFTDLLNDTKXXXXXXXXXXXXXXSFDNNIDQDKNNLNIVNEYLNINSKLSENKIEILRQKFKTVSRYVNEQENLKLEAEVDKLEKKFHETIELSKDNQSALLLNINNVTEADLFYERTIKWLNSKVSELEQFYVKPETLREKENRLRILNKIKFETEENTSMIKRQMDNLPVLLTVQNKNVDNKINTLKIQLKEIFERVSEEFNIHEEFSENFHSLINNMESCKYQLIQCVESIEFDXXXXXXXXXXXXXFTENISNNNKQLNKVNELYQTVKYQTSPGGIAILDTEMQLAQTLSKDIDELFLKLKTKEQKFENLQNKFESLINSIENSLTENEDEMKKLSELKRDLKQKASTKQHLVENILPEIHGTQSLIDELKEVCYEYLSEIIDRNKSRRANDIFYRFSELSRLAESSIKKVQKACEDHELFDKFYKEAVEYFNEINDEIEFVSNLLDVETNTFHELTKLTAKLSSYETQRTEFFQSMHNVESQGQITMELSNKEGRDLVRRQIKEINEHCNKLVDKINSTKIKLDRNIDNYNATKEKLDKINEFTNEINDRLNIIKSEVRDFNEKNQSIIWLGNCKDECDSNLKNLKLIKSSSVFPDLNXXXXXXXXXXXXXXXXXXDLTSNLKTELRRINEFENEKLTINKWLESLEKQYETLITSFSISDNLDLKINLIKNFETTSIDQVKISKFEEIQNQLQIQKTIVTNLMYMNQEFEVKDQIKKVNLFHEMIKRSIAIFEETSXXXXXXXXXXXXXXXXXXXAKSILQTKQNSEHNLKELKINVENLFEEFSKLNGEIDIEKFVITSVLSSENVEPXXXXXXXXXXXXXQLKSEMEIISKDIERRLKQIQIEEEIQNKFLENSERFYLFANEINVNIDEFDLQSINNFNQIDTITNKIIEIQKLFENIKETSVKQINQTKDLQIENEVKLARKKLSELNEKYENLFQVVQEKVKQVDAFSKLETDLENWLKYADNYMERYSENKPYSTHLQCETNLENMKEFFHEFEDKEYLLDKLKQMHCANNFPYIEKIEILTESFKKLKTEIENQINHLNKKTSGVLEMAESMESFNQYLRQDYLEYEKLEEIFNKCKNQFNQTAMNKLRLCLNDNAFSIRQETLWNLLQNVRKFSKLVERSRIDIAGNLLDQKETAENELETLKANWSKLSKRINELNNLKMDLDKALEHFNIWLNNSCKWFVNITETRKKVFESNETLQMKNNLQALKDDITEHKVDLSRLQTFVDSLMKICNDETFQKTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATELANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENAEQGKTTNNTIQEIETLIKHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQDFLQSTKLFLDNELPNWWRERNQDQMKSAYSNFNNEPILKEILDMDNKLNGLKTTMELEAKACDGILPTIAITASRSQTPNFKSNRSLYSPSSNWSTNKSDVTPNDELIPNILSKSIYEDLDENIKKVSNLKKEIIEKITDWNNFNREKTSFKNWMDNEMLKFSSVLYTEPGISNFASLQKSKLKEIQEEMNYKKQALLNLNTHFKELTSNVSGAADLVLKNLNQDFDETEKKISKLLNREDKGVEADFTDEESNMDIIQERKVPKLNLKNLESPQLFRYESPENLNRFTQTNISKDETDYKFKKTNFSSQTPGTKTTQTNFNDMSNFGTQTNDKYQKKRERKLESELQILNSLKNMNSEFERSKPFPEYNNISSVPMSAKPRSSALESVRRNIYPSYSQTRQTTCSPLMQRIENGYKSRRPLSPSTHSQNLLNKPLSQNSNLNLTKSSGDNLDDLIPTKNKWVDLEINAQLINSSLKSYPFDVPSREFHIDYNTKFEGFPVSLRKKSPQRRSSGXXXXXXXXXXXXXXITDSINRITEDANELRNLSQKLRSVK 13891
            +W  +   K  + K  + + DD+  SH+ RKG+HG++  DK  +  +NK+RL++L  +E  + +L + A  LG EKP+NEV  LK   L+ K +LE EI+ NEKDL+NH+Q+ ND+   HDW+ + E L ++I   P+TK GLIEKQ LL  L +LK  G+K LKE+KNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD Q GINETIEKIEDLGE+SDQ+SE+I+EINK+LEKCLNLPSNTLNEKEKLAKELN+T RL+DQQLA+INDLKSQCGSLEHSAALEDLLNKLESLEEHCFEIKTKIEERIKEVDSDIKFQSALEEKLNDLSEIMNEVEIEFDYSKPKESSEAAINESLSQLQKLKAQHEPGKNILKTMIKLRNEFNAPEQCVTACNDLEQKYFDIEDDIKNLQKELEMKTTVWQKFNALKADLDKTCNTAILEIGNEHKKRSGIHGGDCEDKFNLLEDKKKILSNMTNKDPQVDALIEVSGKLGFDKALFDAQNIKRKYLKLIDDLQQEISQNEIDLDNHKKFDQSLFEFEDWMKNTEKIVKQIANLPNDKNGLLEKQNRLEEMKTLKSNGNEMIKNIKHLQNVVINETAGNFKTTLNEKVKNKIENFERVFGDLDQETDNIKETIDKLKVIDEKSNEMERNIREIENTINKCSIVPSESVGDKEKLGKIYRSLEHDIEQHLIDLDSLKQQCNALNATTANSAMINKLNKMTDECKSMKADISQLFSKNVSDLKNLKTFQDKMNEFNESMDRIETEIEKCSPNGCNEAAIKDNIKKLKKFRSLHENSKDVLTDLLRIGFELSGLSQISEASDQAEQKYSDVEDEITKLESKLEMQKNDWSNFNSDKNDLEKWLNEITKKVENLEQISDGIHGGKLSEKEKVLDSHQKLLQEALNREADIKLFLDRSTPLFSAVNQDSPKRVTNTLCKKYEKLLETLTNRIQKNEEDINLHENYAKQIDNFKEENNIIIKRMNEEIASLPNTKEGLKRKVDLLGNLKDLYNQRKMILVNLENLKNAVIDHSSSNYYSNLEQEWDQIIDSFEKSFNPSIENQSKLLLAVQQIEKTESICQDLQHQLENLERRLQEAVDQHISSLNDIDMKLETLKELRYELRDLQTPINDVQRKHCQNPSDVELIQERIEQIAKQHKVLNESISQNINETENHHKQLCNLTTSLNNFKTWLDYSSSQIEEKGKPGNLEMNNLKKNLTSLKQLADSISCQCDDQLSKIREHMLKIHKFSSEKLKDDLQKELNIMNGNVNSLKDKIQTTTEHEINRINEVEKIDILKNEIKENFLKFESQININFKNFDLNEKQNYITQLRNVQNLMKENEKKIEFLETSIQNIIKHSHGKMLDINANKIINKRNSIKIQLNELINKLTQMSDEQMQFTDLLNDTKICIENQHNEINIEISFDNNIDQDKNNLNIVNEYLNINSKLSENKIEILRQKFKTVSRYVNEQENLKLEAEVDKLEKKFHETIELSKDNQSALLLNINNVTEADLFYERTIKWLNSKVSELEQFYVKPETLREKENRLRILNKIKFETEENTSMIKRQMDNLPVLLTVQNKNVDNKINTLKIQLKEIFERVSEEFNIHEEFSENFHSLINNMESCKYQLIQCVESIEFDKENKIIKKNSEEIFTENISNNNKQLNKVNELYQTVKYQTSPGGIAILDTEMQLAQTLSKDIDELFLKLKTKEQKFENLQNKFESLINSIENSLTENEDEMKKLSELKRDLKQKASTKQHLVENILPEIHGTQSLIDELKEVCYEYLSEIIDRNKSRRANDIFYRFSELSRLAESSIKKVQKACEDHELFDKFYKEAVEYFNEINDEIEFVSNLLDVETNTFHELTKLTAKLSSYETQRTEFFQSMHNVESQGQITMELSNKEGRDLVRRQIKEINEHCNKLVDKINSTKIKLDRNIDNYNATKEKLDKINEFTNEINDRLNIIKSEVRDFNEKNQSIIWLGNCKDECDSNLKNLKLIKSSSVFPDLNKGIETIELKLEKLNKKIKDLTSNLKTELRRINEFENEKLTINKWLESLEKQYETLITSFSISDNLDLKINLIKNFETTSIDQVKISKFEEIQNQLQIQKTIVTNLMYMNQEFEVKDQIKKVNLFHEMIKRSIAIFEETSTKINENKTIINKIEKWIINAKSILQTKQNSEHNLKELKINVENLFEEFSKLNGEIDIEKFVITSVLSSENVEPFFNILSNNLSNINQLKSEMEIISKDIERRLKQIQIEEEIQNKFLENSERFYLFANEINVNIDEFDLQSINNFNQIDTITNKIIEIQKLFENIKETSVKQINQTKDLQIENEVKLARKKLSELNEKYENLFQVVQEKVKQVDAFSKLETDLENWLKYADNYMERYSENKPYSTHLQCETNLENMKEFFHEFEDKEYLLDKLKQMHCANNFPYIEKIEILTESFKKLKTEIENQINHLNKKTSGVLEMAESMESFNQYLRQDYLEYEKLEEIFNKCKNQFNQTAMNKLRLCLNDNAFSIRQETLWNLLQNVRKFSKLVERSRIDIAGNLLDQKETAENELETLKANWSKLSKRINELNNLKMDLDKALEHFNIWLNNSCKWFVNITETRKKVFESNETLQMKNNLQALKDDITEHKVDLSRLQTFVDSLMKICNDETFQKTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATELANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENAEQGKTTNNTIQEIETLIKHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQDFLQSTKLFLDNELPNWWRERNQDQMKSAYSNFNNEPILKEILDMDNKLNGLKTTMELEAKACDGILPTIAITASRSQTPNFKSNRSLYSPSSNWSTNKSDVTPNDELIPNILSKSIYEDLDENIKKVSNLKKEIIEKITDWNNFNREKTSFKNWMDNEMLKFSSVLYTEPGISNFASLQKSKLKEIQEEMNYKKQALLNLNTHFKELTSNVSGAADLVLKNLNQDFDETEKKISKLLNREDKGVEADFTDEESNMDIIQERKVPKLNLKNLESPQLFRYESPENLNRFTQTNISKDETDYKFKKTNFSSQTPGTKTTQTNFNDMSNFGTQTNDKYQKKRERKLESELQILNSLKNMNSEFERSKPFPEYNNISSVPMSAKPRSSALESVRRNIYPSYSQTRQTTCSPLMQRIENGYKSRRPLSPSTHSQNLLNKPLSQNSNLNLTKSSGDNLDDLIPTKNKWVDLEINAQLINSSLKSYPFDVPSREFHIDYNTKFEGFPVSLRKKSPQRRSSGSPKRNRSKSARNSRITDSINRITEDANELRNLSQKLRSVK
Sbjct: 1856 NWSRYNLIKSDIEKSLETLKDDINVSHEMRKGIHGKDSKDKETIFHDNKKRLQDLNDKEKVINELIEMAKLLGSEKPVNEVLQLKKTFLEDKDDLENEIKINEKDLKNHRQYENDLDLFHDWILEAESLADKISGTPSTKAGLIEKQNLLNKLKNLKPVGEKMLKEIKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLDIQDGINETIEKIEDLGEQSDQVSEDISEINKKLEKCLNLPSNTLNEKEKLAKELNSTNRLLDQQLAKINDLKSQCGSLEHSAALEDLLNKLESLEEHCFEIKTKIEERIKEVDSDIKFQSALEEKLNDLSEIMNEVEIEFDYSKPKESSEAAINESLSQLQKLKAQHEPGKNILKTMIKLRNEFNAPEQCVTACNDLEQKYFDIEDDIKNLQKELEMKTTVWQKFNALKADLDKTCNTAILEIGNEHKKRSGIHGGDCEDKFNLLEDKKKILSNMTNKDPQVDALIEVSGKLGFDKALFDAQNIKRKYLKLIDDLQQEISQNEIDLDNHKKFDQSLFEFEDWMKNTEKIVKQIANLPNDKNGLLEKQNRLEEMKTLKSNGNEMIKNIKHLQNVVINETAGNFKTTLNEKVKNKIENFERVFGDLDQETDNIKETIDKLKVIDEKSNEMERNIREIENTINKCSIVPSESVGDKEKLGKIYRSLEHDIEQHLIDLDSLKQQCNALNATTANSAMINKLNKMTDECKSMKADISQLFSKNVSDLKNLKTFQDKMNEFNESMDRIETEIEKCSPNGCNEAAIKDNIKKLKKFRSLHENSKDVLTDLLRIGFELSGLSQISEASDQAEQKYSDVEDEITKLESKLEMQKNDWSNFNSDKNDLEKWLNEITKKVENLEQISDGIHGGKLSEKEKVLDSHQKLLQEALNREADIKLFLDRSTPLFSAVNQDSPKRVTNTLCKKYEKLLETLTNRIQKNEEDINLHENYAKQIDNFKEENNIIIKRMNEEIASLPNTKEGLKRKVDLLGNLKDLYNQRKMILVNLENLKNAVIDHSSSNYYSNLEQEWDQIIDSFEKSFNPSIENQSKLLLAVQQIEKTESICQDLQHQLENLERRLQEAVDQHISSLNDIDMKLETLKELRYELRDLQTPINDVQRKHCQNPSDVELIQERIEQIAKQHKVLNESISQNINETENHHKQLCNLTTSLNNFKTWLDYSSSQIEEKGKPGNLEMNNLKKNLTSLKQLADSISCQCDDQLSKIREHMLKIHKFSSEKLKDDLQKELNIMNGNVNSLKDKIQTTTEHEINRINEVEKIDILKNEIKENFLKFESQININFKNFDLNEKQNYITQLRNVQNLMKENEKKIEFLETSIQNIIKHSHGKMLDINANKIINKRNSIKIQLNELINKLTQMSDEQMQFTDLLNDTKICIENQHNEINIEISFDNNIDQDKNNLNIVNEYLNINSKLSENKIEILRQKFKTVSRYVNEQENLKLEAEVDKLEKKFHETIELSKDNQSALLLNINNVTEADLFYERTIKWLNSKVSELEQFYVKPETLREKENRLRILNKIKFETEENTSMIKRQMDNLPVLLTVQNKNVDNKINTLKIQLKEIFERVSEEFNIHEEFSENFHSLINNMESCKYQLIQCVESIEFDKENKIIKKNSEEIFTENISNNNKQLNKVNELYQTVKYQTSPGGIAILDTEMQLAQTLSKDIDELFLKLKTKEQKFENLQNKFESLINSIENSLTENEDEMKKLSELKRDLKQKASTKQHLVENILPEIHGTQSLIDELKEVCYEYLSEIIDRNKSRRANDIFYRFSELSRLAESSIKKVQKACEDHELFDKFYKEAVEYFNEINDEIEFVSNLLDVETNTFHELTKLTAKLSSYETQRTEFFQSMHNVESQGQITMELSNKEGRDLVRRQIKEINEHCNKLVDKINSTKIKLDRNIDNYNATKEKLDKINEFTNEINDRLNIIKSEVRDFNEKNQSIIWLGNCKDECDSNLKNLKLIKSSSVFPDLNKGIETIELKLEKLNKKIKDLTSNLKTELRRINEFENEKLTINKWLESLEKQYETLITSFSISDNLDLKINLIKNFETTSIDQVKISKFEEIQNQLQIQKTIVTNLMYMNQEFEVKDQIKKVNLFHEMIKRSIAIFEETSTKINENKTIINKIEKWIINAKSILQTKQNSEHNLKELKINVENLFEEFSKLNGEIDIEKFVITSVLSSENVEPFFNILSNNLSNINQLKSEMEIISKDIERRLKQIQIEEEIQNKFLENSERFYLFANEINVNIDEFDLQSINNFNQIDTITNKIIEIQKLFENIKETSVKQINQTKDLQIENEVKLARKKLSELNEKYENLFQVVQEKVKQVDAFSKLETDLENWLKYADNYMERYSENKPYSTHLQCETNLENMKEFFHEFEDKEYLLDKLKQMHCANNFPYIEKIEILTESFKKLKTEIENQINHLNKKTSGVLEMAESMESFNQYLRQDYLEYEKLEEIFNKCKNQFNQTAMNKLRLCLNDNAFSIRQETLWNLLQNVRKFSKLVERSRIDIAGNLLDQKETAENELETLKANWSKLSKRINELNNLKMDLDKALEHFNIWLNNSCKWFVNITETRKKVFESNETLQMKNNLQALKDDITEHKVDLSRLQTFVDSLMKICNDETFQKTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATELANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENAEQGKTTNNTIQEIETLIKHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQDFLQSTKLFLDNELPNWWRERNQDQMKSAYSNFNNEPILKEILDMDNKLNGLKTTMELEAKACDGILPTIAITASRSQTPNFKSNRSLYSPSSNWSTNKSDVTPNDELIPNILSKSIYEDLDENIKKVSNLKKEIIEKITDWNNFNREKTSFKNWMDNEMLKFSSVLYTEPGISNFASLQKSKLKEIQEEMNYKKQALLNLNTHFKELTSNVSGAADLVLKNLNQDFDETEKKISKLLNREDKGVEADFTDEESNMDIIQERKVPKLNLKNLESPQLFRYESPENLNRFTQTNISKDETDYKFKKTNFSSQTPGTKTTQTNFNDMSNFGTQTNDKYQKKRERKLESELQILNSLKNMNSEFERSKPFPEYNNISSVPMSAKPRSSALESVRRNIYPSYSQTRQTTCSPLMQRIENGYKSRRPLSPSTHSQNLLNKPLSQNSNLNLTKSSGDNLDDLIPTKNKWVDLEINAQLINSSLKSYPFDVPSREFHIDYNTKFEGFPVSLRKKSPQRRSSGSPKRNRSKSARNSRITDSINRITEDANELRNLSQKLRSVK 5431          

HSP 2 Score: 2623.58 bits (6799), Expect = 0.000e+0
Identity = 1552/2065 (75.16%), Postives = 1748/2065 (84.65%), Query Frame = 2
Query:  146 MDRKDTVVKKGVLLKDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISPKQLEAMKTRMENVCKAEGPVREKLNIFGIQANLKNKAQKWAVDLNSWDSPIQSKQDLLDKIEQFNISMENGTSMDKFTSQLDELVKRKVKFCKENPVLDEDLLNFINKAINECEEENDILPEKFESTLMKLENLSSEWDEISDGEQKIETFSRRLSKALQLDDFQQQRSLVDQLPEVLDLLNDVKYKIQNDLTPHCSEKLLYTMXXXXXXXXXXXXXXGAXXXXXXXXXXXXXXXXXXAARDTLIDEIFSCGQANVDSIKQWMNDLDQCMETPINGSSADLQYVLSKLKDLDKESPKIQKLIDQGYQKVDDLENENSPEKAQELKESLNEFQKKFKRYTEKEIPKNLQNLKTFIDTLNIVENDINDLEKTMKEGEFIKNHLDDLEFSNGTDDIIFKEQEFLEKENEXXXXXXXXXXXXXXXXXXVESTDLKIDLKPLEKRIFDSENVLQDLLTNAKENLTANNQCNEACTSADQSLECLLDQIEKNSSINNDEEGQKTKLKNIQNFXXXXXXXXKQINAAVAXXXXXXXXXXXXXXDKIDNSISKIKQKTVSIKENLQKTKVNLSNNLNDWQDFKQTKDLMTKCFDDIIDDLKESHQKRKGVHGENLTDKADXXXXXXXXXXXXIKQEDXXXXXXXXXXXXXXEKPINEVKNLKDQILKQKANLEEEIQQNEKDLENHQQFNNDIQSLHDWLAQTELLTNQIQNLPNTKEGLIEKQKLLEDLNSLKSTGDKKLKELKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLDKQGGINETIEKIEDLGEKSDQISENINEINKRLEKCLNLPSNTLNEKEKLAKELNNTIRLVDQQLAQINDLKSQCGSLEHSAALEDLLNKLESLEEHCFXXXXXXXXXXXXVDSDIKFQSALEEKLNDLSEIMNEVEIEFDYSKPKESSEAAINESLSQLQKLKAQHEPGKNILKTMIKLRNEFNAPEQCVTACNDLEQKYFDIEDDIKNLQKELEMKTTVWQKFNALKADLDKTCNTAILEIGNEHKKRSGIHGGDCEDKFNLLEDKKKILSNMTNKDPQVDALIEVSGKLGFDKALFDAQNIKRKYLKLIDDLQQEISQNEIDLDNHKKFDQSLFEFEDWMKNTEKIVKQIANLPNDKNGLLEKQNRLEEMKTLKSNGNEMIKNIKHLQNVVINETAGNFKTTLNEKVKNKIENFERVFGDLDQETDNIKETIDKLKVIDEKSXXXXXXXXXXXXXXXKCSIVPSESVGDKEKLGKIYRSLEHDIEQHLIDLDSLKQQCNALNATTANSAMINKLNKMTDECKSMKADISQLFSKNVSDLKNLKTFQDKMNEFNESMDRIETEIEKCSPNGCNEAAIKDNIKKLKKFRSLHENSKDVLTDLLRIGFELSGLSQISEASDQAEQKYSDVEDEITKLESKLEMQKNDWSNFNSDKNDLEKWLNEITKKVENLEQISDGIHGGKLSEKEKVLDSHQKLLQEALNREADIKLFLDRSTPLFSAVNQDSPKRVTNTLCKKYEKLLETLTNRIQKNEEDINLHENYAKQIDNFKEENNIII--KRMNEEIASLPNTKEGLKRKVDLLGNLKDLYNQRKMILVNLENLKNAVIDHSSSNYYSNLEQEWDQIIDSFEKSF 6334
            MDRKDTVVKKGVLLKDEQEKMQKKTFTKWMNSYLCQKKPPIIIKDLMKDLSDGLLLLDLLEILTKTTLKKEKPKNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAILHFQIEEQEEFLLQALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISPKQLEAMKTRMENVCKAEGPVREKLNIFGIQANLKNKAQKWAVDLNSWDSPIQSKQDLLDKIEQFNISMENGTSMDKFTSQLDELVKRKVKFCKENPVLDEDLLNFINKAINECEEENDILPEKFESTLMKLENLSSEWDEISDGEQKIETFSRRLSKALQLDDFQQQRSLVDQLPEVLDLLNDVKYKIQNDLTPHCSEKLLYTMKENLNELEINLKELGAQVVDKVEKQKQKIEQQQQAARDTLIDEIFSCGQANVDSIKQWMNDLDQCMETPINGSSADLQYVLSKLKDLDKESPKIQKLIDQGYQKVDDLENENSPEKAQELKESLNEFQKKFKRYTEKEIPKNLQNLKTFIDTLNIVENDINDLEKTMKEGEFIKNHLDDLEFSNGTDDIIFKEQEFLEKENEISKSLIKDKDLLKHIKKLVESTDLKIDLKPLEKRIFDSENVLQDLLTNAKENLTANNQCNEACTSADQSLECLLDQIEKNSSINNDEEGQKTKLKNIQNFEEEIEEVEKQINAAVALRNNLLSNLNKSNLDKIDNSISKIKQKTVSIKENLQKTKVNLSNNLNDWQDFKQTKDLMTKCFDDIIDDLKESHQKRKGVHGENLTDKADLLEENKERLENLIKQEDKLKDLNKKALKLGLEKPINEVKNLKDQILKQKANLEEEIQQNEKDLENHQQFNNDIQSLHDWLAQTELLTNQIQNLPNTKEGLIEKQKLLEDLNSLKSTGDKKLKELKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLDKQGGINETIEKIEDLGEKSDQISENINEINKRLEKCLNLPSNTLNEKEKLAKELNNTIRLVDQQLAQINDLKSQC  LE+  A+E+LLN LESLEE C   K KIEE++ E +SDIK Q ALE  L  L+++MNE E E   S  K++  +A+ E+L +L+ LK++ E  KNIL+ + + +++FN P+ C+ AC   ++KY D++D+I  L++ L +    W +F++ K+ ++++  T   +I N H   +GIHGGDC+DK +LL +KK  L ++  ++ + + L   + KLG +  + + QN+K + LK  ++L++EI QNE DL+NH++F+  +    DW+  TE +  QI NLPN K GL+EKQ  LE++ +LKS G++ +K +K+LQ VV+NETA + K  +N ++  +IE F  VF +LD++   I ETI+K++ + EKS+++  NI EI   + KC  +PS ++ +KEKL K   +    ++Q L  ++ LK QC +L    A   +++KL  + ++C   K++I     +N  ++K    F++K++EF   M+  E EI    P   +E AI+++++KL+  +S H   K+ L ++L+   EL    + SE  ++ E+KY ++E+ I  L + LE +K++WS +N  K+D+EK L  +   +    ++  GIHG    +KE +   ++K LQ+  ++E  I   ++ +  L S    + P      L K + +  + L N I+ NE+D+  H  Y   +D F   ++ I+  + + ++I+  P+TK GL  K +LL  LK+L    + +L  ++NL+  V++ ++ +   N+  + +  I+ F + F
Sbjct:    1 MDRKDTVVKKGVLLKDEQEKMQKKTFTKWMNSYLCQKKPPIIIKDLMKDLSDGLLLLDLLEILTKTTLKKEKPKNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAILHFQIEEQEEFLLQALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISPKQLEAMKTRMENVCKAEGPVREKLNIFGIQANLKNKAQKWAVDLNSWDSPIQSKQDLLDKIEQFNISMENGTSMDKFTSQLDELVKRKVKFCKENPVLDEDLLNFINKAINECEEENDILPEKFESTLMKLENLSSEWDEISDGEQKIETFSRRLSKALQLDDFQQQRSLVDQLPEVLDLLNDVKYKIQNDLTPHCSEKLLYTMKENLNELEINLKELGAQVVDKVEKQKQKIEQQQQAARDTLIDEIFSCGQANVDSIKQWMNDLDQCMETPINGSSADLQYVLSKLKDLDKESPKIQKLIDQGYQKVDDLENENSPEKAQELKESLNEFQKKFKRYTEKEIPKNLQNLKTFIDTLNIVENDINDLEKTMKEGEFIKNHLDDLEFSNGTDDIIFKEQEFLEKENEISKSLIKDKDLLKHIKKLVESTDLKIDLKPLEKRIFDSENVLQDLLTNAKENLTANNQCNEACTSADQSLECLLDQIEKNSSINNDEEGQKTKLKNIQNFEEEIEEVEKQINAAVALRNNLLSNLNKSNLDKIDNSISKIKQKTVSIKENLQKTKVNLSNNLNDWQDFKQTKDLMTKCFDDIIDDLKESHQKRKGVHGENLTDKADLLEENKERLENLIKQEDKLKDLNKKALKLGLEKPINEVKNLKDQILKQKANLEEEIQQNEKDLENHQQFNNDIQSLHDWLAQTELLTNQIQNLPNTKEGLIEKQKLLEDLNSLKSTGDKKLKELKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLDKQGGINETIEKIEDLGEKSDQISENINEINKRLEKCLNLPSNTLNEKEKLAKELNNTIRLVDQQLAQINDLKSQCKHLENCEAVEELLNNLESLEEQCNIRKAKIEEKMNETESDIKKQVALENNLKILADLMNETETEMKISVTKQTGASAVEENLEKLKGLKSKLESEKNILENIEEQKDDFNVPKHCLMACKSSKKKYLDLKDEIHQLEENLNLMKNNWSEFDSAKSKIEESLETIGNDIENMHVTHNGIHGGDCDDKVSLLNEKKNELDDLIRQEEETNDLFSKAKKLGSNAPMIEIQNLKERILKQKENLKKEIKQNEKDLENHQQFNNDIQSLHDWLAQTELLTNQIQNLPNTKEGLIEKQKLLEDLNSLKSTGDKKLKELKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLDKQG-GINETIEKIEDLGEKSDQISENINEINKRLEKCLNLPSNTLNEKEKLAKELNNTIRLVDQQLAQINDLKSQCESLENCEAVEELLDKLESLEEQCNENKSEIEDKIVENNINIKMQAAFEEKLDEFANLMNEAEIEITSL-PKENSEIAIEESLQKLENIKSKHLPGKNTLEEILKSQTELRIPQEYSETCEKYEEKYCNLENGIKDLTNALEQKKSNWSRYNLIKSDIEKSLETLKDDINVSHEMRKGIHGKDSKDKETIFHDNKKRLQDLNDKEKVINELIEMAKLLGS----EKPVNEVLQLKKTFLEDKDDLENEIKINEKDLKNHRQYENDLDLF---HDWILEAESLADKISGTPSTKAGLIEKQNLLNKLKNLKPVGEKMLKEIKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVF 2056          
BLAST of Nesprin-1 vs. Planmine SMEST
Match: SMESG000077685.1 (SMESG000077685.1)

HSP 1 Score: 6555.31 bits (17006), Expect = 0.000e+0
Identity = 3476/3594 (96.72%), Postives = 3523/3594 (98.02%), Query Frame = 2
Query: 3122 NLQKTKVNLSNNL----NDWQDFKQTKDLMTKCFDDIIDDLKESHQKRKGVHGENLTDKADXXXXXXXXXXXXIKQEDXXXXXXXXXXXXXXEKPINEVKNLKDQILKQKANLEEEIQQNEKDLENHQQFNNDIQSLHDWLAQTELLTNQIQNLPNTKEGLIEKQKLLEDLNSLKSTGDKKLKELKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLDKQGGINETIEKIEDLGEKSDQISENINEINKRLEKCLNLPSNTLNEKEKLAKELNNTIRLVDQQLAQINDLKSQCGSLEHSAALEDLLNKLESLEEHCFXXXXXXXXXXXXVDSDIKFQSALEEKLNDLSEIMNEVEIEFDYSKPKESSEAAINESLSQLQKLKAQHEPGKNILKTMIKLRNEFNAPEQCVTACNDLEQKYFDIEDDIKNLQKELEMKTTVWQKFNALKADLDKTCNTAILEIGNEHKKRSGIHGGDCEDKFNLLEDKKKILSNMTNKDPQVDALIEVSGKLGFDKALFDAQNIKRKYLKLIDDLQQEISQNEIDLDNHKKFDQSLFEFEDWMKNTEKIVKQIANLPNDKNGLLEKQNRLEEMKTLKSNGNEMIKNIKHLQNVVINETAGNFKTTLNEKVKNKIENFERVFGDLDQETDNIKETIDKLKVIDEKSXXXXXXXXXXXXXXXKCSIVPSESVGDKEKLGKIYRSLEHDIEQHLIDLDSLKQQCNALNATTANSAMINKLNKMTDECKSMKADISQLFSKNVSDLKNLKTFQDKMNEFNESMDRIETEIEKCSPNGCNEAAIKDNIKKLKKFRSLHENSKDVLTDLLRIGFELSGLSQISEASDQAEQKYSDVEDEITKLESKLEMQKNDWSNFNSDKNDLEKWLNEITKKVENLEQISDGIHGGKLSEKEKVLDSHQKLLQEALNREADIKLFLDRSTPLFSAVNQDSPKRVTNTLCKKYEKLLETLTNRIQKNEEDINLHENYAKQIDNFKEENNIIIKRMNEEIASLPNTKEGLKRKVDLLGNLKDLYNQRKMILVNLENLKNAVIDHSSSNYYSNLEQEWDQIIDSFEKSFNPSIENQSKLLLAVQQIEKTESICQDLQHQLENLERRLQEAVDQHISSLNDIDMKLETLKELRYELRDLQTPINDVQRKHCQNPSDVELIQERIEQIAKQHKVLNESISQNINETENHHKQLCNLTTSLNNFKTWLDYSSSQIEEKGKPGNLEMNNLKKNLTSLKQLADSISCQCDDQLSKIREHMLKIHKFSSEKLKDDLQKELNIMNGNVNSLKDKIQTTTEHEINRINEVEKIDILKNEIKENFLKFESQININFKNFDLNEKQNYITQLRNVQNLMKENEKKIEFLETSIQNIIKHSHGKMLDXXXXXXXXXXXXXXXQLNELINKLTQMSDEQMQFTDLLNDTKXXXXXXXXXXXXXXSFDNNIDQDKNNLNIVNEYLNINSKLSENKIEILRQKFKTVSRYVNEQENLKLEAEVDKLEKKFHETIELSKDNQSALLLNINNVTEADLFYERTIKWLNSKVSELEQFYVKPETLREKENRLRILNKIKFETEENTSMIKRQMDNLPVLLTVQNKNVDNKINTLKIQLKEIFERVSEEFNIHEEFSENFHSLINNMESCKYQLIQCVESIEFDXXXXXXXXXXXXXFTENISNNNKQLNKVNELYQTVKYQTSPGGIAILDTEMQLAQTLSKDIDELFLKLKTKEQKFENLQNKFESLINSIENSLTENEDEMKKLSELKRDLKQKASTKQHLVENILPEIHGTQSLIDELKEVCYEYLSEIIDRNKSRRANDIFYRFSELSRLAESSIKKVQKACEDHELFDKFYKEAVEYFNEINDEIEFVSNLLDVETNTFHELTKLTAKLSSYETQRTEFFQSMHNVESQGQITMELSNKEGRDLVRRQIKEINEHCNKLVDKINSTKIKLDRNIDNYNATKEKLDKINEFTNEINDRLNIIKSEVRDFNEKNQSIIWLGNCKDECDSNLKNLKLIKSSSVFPDLNXXXXXXXXXXXXXXXXXXDLTSNLKTELRRINEFENEKLTINKWLESLEKQYETLITSFSISDNLDLKINLIKNFETTSIDQVKISKFEEIQNQLQIQKTIVTNLMYMNQEFEVKDQIKKVNLFHEMIKRSIAIFEETSXXXXXXXXXXXXXXXXXXXAKSILQTKQNSEHNLKELKINVENLFEEFSKLNGEIDIEKFVITSVLSSENVEPXXXXXXXXXXXXXQLKSEMEIISKDIERRLKQIQIEEEIQNKFLENSERFYLFANEINVNIDEFDLQSINNFNQIDTITNKIIEIQKLFENIKETSVKQINQTKDLQIENEVKLARKKLSELNEKYENLFQVVQEKVKQVDAFSKLETDLENWLKYADNYMERYSENKPYSTHLQCETNLENMKEFFHEFEDKEYLLDKLKQMHCANNFPYIEKIEILTESFKKLKTEIENQINHLNKKTSGVLEMAESMESFNQYLRQDYLEYEKLEEIFNKCKNQFNQTAMNKLRLCLNDNAFSIRQETLWNLLQNVRKFSKLVERSRIDIAGNLLDQKETAENELETLKANWSKLSKRINELNNLKMDLDKALEHFNIWLNNSCKWFVNITETRKKVFESNETLQMKNNLQALKDDITEHKVDLSRLQTFVDSLMKICNDETFQKTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATELANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENAEQGKTTNNTIQEIETLIKHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQDFLQSTKLFLDNELPNWWRERNQDQMKSAYSNFNNEPILKEILDMDNKLNGLKTTMELEAKACDGILPTIAITASRSQTPNFKSNRSLYSPSSNWSTNKSDVTPNDELIPNILSKSIYEDLDENIKKVSNLKKEIIEKITDWNNFNREKTSFKNWMDNEMLKFSSVLYTEPGISNFASLQKSKLKEIQEEMNYKKQALLNLNTHFKELTSNVSGAADLVLKNLNQDFDETEKKISKLLNREDKGVEADFTDEESNMDIIQERKVPKLNLKNLESPQLFRYESPENLNRFTQTNISKDETDYKFKKTNFSSQTPGTKTTQTNFNDMSNFGTQTNDKYQKKRERKLESELQILNSLKNMNSEFERSKPFPEYNNISSVPMSAKPRSSALESVRRNIYPSYSQTRQTTCSPLMQRIENGYKSRRPLSPSTHSQNLLNKPLSQNSNLNLTKSSGDNLDDLIPTKNKWVDLEINAQLINSSLKSYPFDVPSREFHIDYNTKFEGFPVSLRKKSPQRRSSGXXXXXXXXXXXXXXITDSINRITEDANELRNLSQKLRSVK 13891
            NL+    +L+N L    ++W  +   K  + K  + + DD+  SH+ RKG+HG++  DK  +  +NK+RL++L  +E  + +L + A  LG EKP+NEV  LK   L+ K +LE EI+ NEKDL+NH+Q+ ND+   HDW+ + E L ++I   P+TK GLIEKQ LL  L +LK  G+K LKE+KNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLD Q GINETIEKIEDLGE+SDQ+SE+I+EINK+LEKCLNLPSNTLNEKEKLAKELN+T RL+DQQLA+INDLKSQCGSLEHSAALEDLLNKLESLEEHCFEIKTKIEERIKEVDSDIKFQSALEEKLNDLSEIMNEVEIEFDYSKPKESSEAAINESLSQLQKLKAQHEPGKNILKTMIKLRNEFNAPEQCVTACNDLEQKYFDIEDDIKNLQKELEMKTTVWQKFNALKADLDKTCNTAILEIGNEHKKRSGIHGGDCEDKFNLLEDKKKILSNMTNKDPQVDALIEVSGKLGFDKALFDAQNIKRKYLKLIDDLQQEISQNEIDLDNHKKFDQSLFEFEDWMKNTEKIVKQIANLPNDKNGLLEKQNRLEEMKTLKSNGNEMIKNIKHLQNVVINETAGNFKTTLNEKVKNKIENFERVFGDLDQETDNIKETIDKLKVIDEKSNEMERNIREIENTINKCSIVPSESVGDKEKLGKIYRSLEHDIEQHLIDLDSLKQQCNALNATTANSAMINKLNKMTDECKSMKADISQLFSKNVSDLKNLKTFQDKMNEFNESMDRIETEIEKCSPNGCNEAAIKDNIKKLKKFRSLHENSKDVLTDLLRIGFELSGLSQISEASDQAEQKYSDVEDEITKLESKLEMQKNDWSNFNSDKNDLEKWLNEITKKVENLEQISDGIHGGKLSEKEKVLDSHQKLLQEALNREADIKLFLDRSTPLFSAVNQDSPKRVTNTLCKKYEKLLETLTNRIQKNEEDINLHENYAKQIDNFKEENNIIIKRMNEEIASLPNTKEGLKRKVDLLGNLKDLYNQRKMILVNLENLKNAVIDHSSSNYYSNLEQEWDQIIDSFEKSFNPSIENQSKLLLAVQQIEKTESICQDLQHQLENLERRLQEAVDQHISSLNDIDMKLETLKELRYELRDLQTPINDVQRKHCQNPSDVELIQERIEQIAKQHKVLNESISQNINETENHHKQLCNLTTSLNNFKTWLDYSSSQIEEKGKPGNLEMNNLKKNLTSLKQLADSISCQCDDQLSKIREHMLKIHKFSSEKLKDDLQKELNIMNGNVNSLKDKIQTTTEHEINRINEVEKIDILKNEIKENFLKFESQININFKNFDLNEKQNYITQLRNVQNLMKENEKKIEFLETSIQNIIKHSHGKMLDINANKIINKRNSIKIQLNELINKLTQMSDEQMQFTDLLNDTKICIENQHNEINIEISFDNNIDQDKNNLNIVNEYLNINSKLSENKIEILRQKFKTVSRYVNEQENLKLEAEVDKLEKKFHETIELSKDNQSALLLNINNVTEADLFYERTIKWLNSKVSELEQFYVKPETLREKENRLRILNKIKFETEENTSMIKRQMDNLPVLLTVQNKNVDNKINTLKIQLKEIFERVSEEFNIHEEFSENFHSLINNMESCKYQLIQCVESIEFDKENKIIKKNSEEIFTENISNNNKQLNKVNELYQTVKYQTSPGGIAILDTEMQLAQTLSKDIDELFLKLKTKEQKFENLQNKFESLINSIENSLTENEDEMKKLSELKRDLKQKASTKQHLVENILPEIHGTQSLIDELKEVCYEYLSEIIDRNKSRRANDIFYRFSELSRLAESSIKKVQKACEDHELFDKFYKEAVEYFNEINDEIEFVSNLLDVETNTFHELTKLTAKLSSYETQRTEFFQSMHNVESQGQITMELSNKEGRDLVRRQIKEINEHCNKLVDKINSTKIKLDRNIDNYNATKEKLDKINEFTNEINDRLNIIKSEVRDFNEKNQSIIWLGNCKDECDSNLKNLKLIKSSSVFPDLNKGIETIELKLEKLNKKIKDLTSNLKTELRRINEFENEKLTINKWLESLEKQYETLITSFSISDNLDLKINLIKNFETTSIDQVKISKFEEIQNQLQIQKTIVTNLMYMNQEFEVKDQIKKVNLFHEMIKRSIAIFEETSTKINENKTIINKIEKWIINAKSILQTKQNSEHNLKELKINVENLFEEFSKLNGEIDIEKFVITSVLSSENVEPFFNILSNNLSNINQLKSEMEIISKDIERRLKQIQIEEEIQNKFLENSERFYLFANEINVNIDEFDLQSINNFNQIDTITNKIIEIQKLFENIKETSVKQINQTKDLQIENEVKLARKKLSELNEKYENLFQVVQEKVKQVDAFSKLETDLENWLKYADNYMERYSENKPYSTHLQCETNLENMKEFFHEFEDKEYLLDKLKQMHCANNFPYIEKIEILTESFKKLKTEIENQINHLNKKTSGVLEMAESMESFNQYLRQDYLEYEKLEEIFNKCKNQFNQTAMNKLRLCLNDNAFSIRQETLWNLLQNVRKFSKLVERSRIDIAGNLLDQKETAENELETLKANWSKLSKRINELNNLKMDLDKALEHFNIWLNNSCKWFVNITETRKKVFESNETLQMKNNLQALKDDITEHKVDLSRLQTFVDSLMKICNDETFQKTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATELANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENAEQGKTTNNTIQEIETLIKHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQDFLQSTKLFLDNELPNWWRERNQDQMKSAYSNFNNEPILKEILDMDNKLNGLKTTMELEAKACDGILPTIAITASRSQTPNFKSNRSLYSPSSNWSTNKSDVTPNDELIPNILSKSIYEDLDENIKKVSNLKKEIIEKITDWNNFNREKTSFKNWMDNEMLKFSSVLYTEPGISNFASLQKSKLKEIQEEMNYKKQALLNLNTHFKELTSNVSGAADLVLKNLNQDFDETEKKISKLLNREDKGVEADFTDEESNMDIIQERKVPKLNLKNLESPQLFRYESPENLNRFTQTNISKDETDYKFKKTNFSSQTPGTKTTQTNFNDMSNFGTQTNDKYQKKRERKLESELQILNSLKNMNSEFERSKPFPEYNNISSVPMSAKPRSSALESVRRNIYPSYSQTRQTTCSPLMQRIENGYKSRRPLSPSTHSQNLLNKPLSQNSNLNLTKSSGDNLDDLIPTKNKWVDLEINAQLINSSLKSYPFDVPSREFHIDYNTKFEGFPVSLRKKSPQRRSSGSPKRNRSKSARNSRITDSINRITEDANELRNLSQKLRSVK
Sbjct: 1839 NLENGIKDLTNALEQKKSNWSRYNLIKSDIEKSLETLKDDINVSHEMRKGIHGKDSKDKETIFHDNKKRLQDLNDKEKVINELIEMAKLLGSEKPVNEVLQLKKTFLEDKDDLENEIKINEKDLKNHRQYENDLDLFHDWILEAESLADKISGTPSTKAGLIEKQNLLNKLKNLKPVGEKMLKEIKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLDIQDGINETIEKIEDLGEQSDQVSEDISEINKKLEKCLNLPSNTLNEKEKLAKELNSTNRLLDQQLAKINDLKSQCGSLEHSAALEDLLNKLESLEEHCFEIKTKIEERIKEVDSDIKFQSALEEKLNDLSEIMNEVEIEFDYSKPKESSEAAINESLSQLQKLKAQHEPGKNILKTMIKLRNEFNAPEQCVTACNDLEQKYFDIEDDIKNLQKELEMKTTVWQKFNALKADLDKTCNTAILEIGNEHKKRSGIHGGDCEDKFNLLEDKKKILSNMTNKDPQVDALIEVSGKLGFDKALFDAQNIKRKYLKLIDDLQQEISQNEIDLDNHKKFDQSLFEFEDWMKNTEKIVKQIANLPNDKNGLLEKQNRLEEMKTLKSNGNEMIKNIKHLQNVVINETAGNFKTTLNEKVKNKIENFERVFGDLDQETDNIKETIDKLKVIDEKSNEMERNIREIENTINKCSIVPSESVGDKEKLGKIYRSLEHDIEQHLIDLDSLKQQCNALNATTANSAMINKLNKMTDECKSMKADISQLFSKNVSDLKNLKTFQDKMNEFNESMDRIETEIEKCSPNGCNEAAIKDNIKKLKKFRSLHENSKDVLTDLLRIGFELSGLSQISEASDQAEQKYSDVEDEITKLESKLEMQKNDWSNFNSDKNDLEKWLNEITKKVENLEQISDGIHGGKLSEKEKVLDSHQKLLQEALNREADIKLFLDRSTPLFSAVNQDSPKRVTNTLCKKYEKLLETLTNRIQKNEEDINLHENYAKQIDNFKEENNIIIKRMNEEIASLPNTKEGLKRKVDLLGNLKDLYNQRKMILVNLENLKNAVIDHSSSNYYSNLEQEWDQIIDSFEKSFNPSIENQSKLLLAVQQIEKTESICQDLQHQLENLERRLQEAVDQHISSLNDIDMKLETLKELRYELRDLQTPINDVQRKHCQNPSDVELIQERIEQIAKQHKVLNESISQNINETENHHKQLCNLTTSLNNFKTWLDYSSSQIEEKGKPGNLEMNNLKKNLTSLKQLADSISCQCDDQLSKIREHMLKIHKFSSEKLKDDLQKELNIMNGNVNSLKDKIQTTTEHEINRINEVEKIDILKNEIKENFLKFESQININFKNFDLNEKQNYITQLRNVQNLMKENEKKIEFLETSIQNIIKHSHGKMLDINANKIINKRNSIKIQLNELINKLTQMSDEQMQFTDLLNDTKICIENQHNEINIEISFDNNIDQDKNNLNIVNEYLNINSKLSENKIEILRQKFKTVSRYVNEQENLKLEAEVDKLEKKFHETIELSKDNQSALLLNINNVTEADLFYERTIKWLNSKVSELEQFYVKPETLREKENRLRILNKIKFETEENTSMIKRQMDNLPVLLTVQNKNVDNKINTLKIQLKEIFERVSEEFNIHEEFSENFHSLINNMESCKYQLIQCVESIEFDKENKIIKKNSEEIFTENISNNNKQLNKVNELYQTVKYQTSPGGIAILDTEMQLAQTLSKDIDELFLKLKTKEQKFENLQNKFESLINSIENSLTENEDEMKKLSELKRDLKQKASTKQHLVENILPEIHGTQSLIDELKEVCYEYLSEIIDRNKSRRANDIFYRFSELSRLAESSIKKVQKACEDHELFDKFYKEAVEYFNEINDEIEFVSNLLDVETNTFHELTKLTAKLSSYETQRTEFFQSMHNVESQGQITMELSNKEGRDLVRRQIKEINEHCNKLVDKINSTKIKLDRNIDNYNATKEKLDKINEFTNEINDRLNIIKSEVRDFNEKNQSIIWLGNCKDECDSNLKNLKLIKSSSVFPDLNKGIETIELKLEKLNKKIKDLTSNLKTELRRINEFENEKLTINKWLESLEKQYETLITSFSISDNLDLKINLIKNFETTSIDQVKISKFEEIQNQLQIQKTIVTNLMYMNQEFEVKDQIKKVNLFHEMIKRSIAIFEETSTKINENKTIINKIEKWIINAKSILQTKQNSEHNLKELKINVENLFEEFSKLNGEIDIEKFVITSVLSSENVEPFFNILSNNLSNINQLKSEMEIISKDIERRLKQIQIEEEIQNKFLENSERFYLFANEINVNIDEFDLQSINNFNQIDTITNKIIEIQKLFENIKETSVKQINQTKDLQIENEVKLARKKLSELNEKYENLFQVVQEKVKQVDAFSKLETDLENWLKYADNYMERYSENKPYSTHLQCETNLENMKEFFHEFEDKEYLLDKLKQMHCANNFPYIEKIEILTESFKKLKTEIENQINHLNKKTSGVLEMAESMESFNQYLRQDYLEYEKLEEIFNKCKNQFNQTAMNKLRLCLNDNAFSIRQETLWNLLQNVRKFSKLVERSRIDIAGNLLDQKETAENELETLKANWSKLSKRINELNNLKMDLDKALEHFNIWLNNSCKWFVNITETRKKVFESNETLQMKNNLQALKDDITEHKVDLSRLQTFVDSLMKICNDETFQKTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDGEELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATELANPSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENAEQGKTTNNTIQEIETLIKHSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQDFLQSTKLFLDNELPNWWRERNQDQMKSAYSNFNNEPILKEILDMDNKLNGLKTTMELEAKACDGILPTIAITASRSQTPNFKSNRSLYSPSSNWSTNKSDVTPNDELIPNILSKSIYEDLDENIKKVSNLKKEIIEKITDWNNFNREKTSFKNWMDNEMLKFSSVLYTEPGISNFASLQKSKLKEIQEEMNYKKQALLNLNTHFKELTSNVSGAADLVLKNLNQDFDETEKKISKLLNREDKGVEADFTDEESNMDIIQERKVPKLNLKNLESPQLFRYESPENLNRFTQTNISKDETDYKFKKTNFSSQTPGTKTTQTNFNDMSNFGTQTNDKYQKKRERKLESELQILNSLKNMNSEFERSKPFPEYNNISSVPMSAKPRSSALESVRRNIYPSYSQTRQTTCSPLMQRIENGYKSRRPLSPSTHSQNLLNKPLSQNSNLNLTKSSGDNLDDLIPTKNKWVDLEINAQLINSSLKSYPFDVPSREFHIDYNTKFEGFPVSLRKKSPQRRSSGSPKRNRSKSARNSRITDSINRITEDANELRNLSQKLRSVK 5432          

HSP 2 Score: 2593.53 bits (6721), Expect = 0.000e+0
Identity = 1537/2051 (74.94%), Postives = 1734/2051 (84.54%), Query Frame = 2
Query:  188 KDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISPKQLEAMKTRMENVCKAEGPVREKLNIFGIQANLKNKAQKWAVDLNSWDSPIQSKQDLLDKIEQFNISMENGTSMDKFTSQLDELVKRKVKFCKENPVLDEDLLNFINKAINECEEENDILPEKFESTLMKLENLSSEWDEISDGEQKIETFSRRLSKALQLDDFQQQRSLVDQLPEVLDLLNDVKYKIQNDLTPHCSEKLLYTMXXXXXXXXXXXXXXGAXXXXXXXXXXXXXXXXXXAARDTLIDEIFSCGQANVDSIKQWMNDLDQCMETPINGSSADLQYVLSKLKDLDKESPKIQKLIDQGYQKVDDLENENSPEKAQELKESLNEFQKKFKRYTEKEIPKNLQNLKTFIDTLNIVENDINDLEKTMKEGEFIKNHLDDLEFSNGTDDIIFKEQEFLEKENEXXXXXXXXXXXXXXXXXXVESTDLKIDLKPLEKRIFDSENVLQDLLTNAKENLTANNQCNEACTSADQSLECLLDQIEKNSSINNDEEGQKTKLKNIQNFXXXXXXXXKQINAAVAXXXXXXXXXXXXXXDKIDNSISKIKQKTVSIKENLQKTKVNLSNNLNDWQDFKQTKDLMTKCFDDIIDDLKESHQKRKGVHGENLTDKADXXXXXXXXXXXXIKQEDXXXXXXXXXXXXXXEKPINEVKNLKDQILKQKANLEEEIQQNEKDLENHQQFNNDIQSLHDWLAQTELLTNQIQNLPNTKEGLIEKQKLLEDLNSLKSTGDKKLKELKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLDKQGGINETIEKIEDLGEKSDQISENINEINKRLEKCLNLPSNTLNEKEKLAKELNNTIRLVDQQLAQINDLKSQCGSLEHSAALEDLLNKLESLEEHCFXXXXXXXXXXXXVDSDIKFQSALEEKLNDLSEIMNEVEIEFDYSKPKESSEAAINESLSQLQKLKAQHEPGKNILKTMIKLRNEFNAPEQCVTACNDLEQKYFDIEDDIKNLQKELEMKTTVWQKFNALKADLDKTCNTAILEIGNEHKKRSGIHGGDCEDKFNLLEDKKKILSNMTNKDPQVDALIEVSGKLGFDKALFDAQNIKRKYLKLIDDLQQEISQNEIDLDNHKKFDQSLFEFEDWMKNTEKIVKQIANLPNDKNGLLEKQNRLEEMKTLKSNGNEMIKNIKHLQNVVINETAGNFKTTLNEKVKNKIENFERVFGDLDQETDNIKETIDKLKVIDEKSXXXXXXXXXXXXXXXKCSIVPSESVGDKEKLGKIYRSLEHDIEQHLIDLDSLKQQCNALNATTANSAMINKLNKMTDECKSMKADISQLFSKNVSDLKNLKTFQDKMNEFNESMDRIETEIEKCSPNGCNEAAIKDNIKKLKKFRSLHENSKDVLTDLLRIGFELSGLSQISEASDQAEQKYSDVEDEITKLESKLEMQKNDWSNFNSDKNDLEKWLNEITKKVENLEQISDGIHGGKLSEKEKVLDSHQKLLQEALNREADIKLFLDRSTPLFSAVNQDSPKRVTNTLCKKYEKLLETLTNRIQKNEEDINLHENYAKQIDNFKEENNIII--KRMNEEIASLPNTKEGLKRKVDLLGNLKDLYNQRKMILVNLENLKNAVIDHSSSNYYSNLEQEWDQIIDSFEKSF 6334
            K+EQEKMQKKTFTKWMNSYLCQKKPPIIIKDLMKDLSDGLLLLDLLEILTKTTLKKEKPKNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAILHFQIEEQEEFLLQALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISPKQLEAMKTRMENVCKAEGPVREKLNIFGIQANLKNKAQKWAVDLNSWDSPIQSKQDLLDKIEQFNISMENGTSMDKFTSQLDELVKRKVKFCKENPVLDEDLLNFINKAINECEEENDILPEKFESTLMKLENLSSEWDEISDGEQKIETFSRRLSKALQLDDFQQQRSLVDQLPEVLDLLNDVKYKIQNDLTPHCSEKLLYTMKENLNELEINLKELGAQVVDKVEKQKQKIEQQQQAARDTLIDEIFSCGQANVDSIKQWMNDLDQCMETPINGSSADLQYVLSKLKDLDKESPKIQKLIDQGYQKVDDLENENSPEKAQELKESLNEFQKKFKRYTEKEIPKNLQNLKTFIDTLNIVENDINDLEKTMKEGEFIKNHLDDLEFSNGTDDIIFKEQEFLEKENEISKSLIKDKDLLKHIKKLVESTDLKIDLKPLEKRIFDSENVLQDLLTNAKENLTANNQCNEACTSADQSLECLLDQIEKNSSINNDEEGQKTKLKNIQNFEEEIEEVEKQINAAVALRNNLLSNLNKSNLDKIDNSISKIKQKTVSIKENLQKTKVNLSNNLNDWQDFKQTKDLMTKCFDDIIDDLKESHQKRKGVHGENLTDKADLLEENKERLENLIKQEDKLKDLNKKALKLGLEKPINEVKNLKDQILKQKANLEEEIQQNEKDLENHQQFNNDIQSLHDWLAQTELLTNQIQNLPNTKEGLIEKQKLLEDLNSLKSTGDKKLKELKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLDKQGGINETIEKIEDLGEKSDQISENINEINKRLEKCLNLPSNTLNEKEKLAKELNNTIRLVDQQLAQINDLKSQC  LE+  A+E+LLN LESLEE C   K KIEE++ E +SDIK Q ALE  L  L+++MNE E E   S  K++  +A+ E+L +L+ LK++ E  KNIL+ + + +++FN P+ C+ AC   ++KY D++D+I  L++ L +    W +F++ K+ ++++  T   +I N H   +GIHGGDC+DK +LL +KK  L ++  ++ + + L   + KLG +  + + QN+K + LK  ++L++EI QNE DL+NH++F+  +    DW+  TE +  QI NLPN K GL+EKQ  LE++ +LKS G++ +K +K+LQ VV+NETA + K  +N ++  +IE F  VF +LD++   I ETI+K++ + EKS+++  NI EI   + KC  +PS ++ +KEKL K   +    ++Q L  ++ LK QC +L    A   +++KL  + ++C   K++I     +N  ++K    F++K++EF   M+  E EI    P   +E AI+++++KL+  +S H   K+ L ++L+   EL    + SE  ++ E+KY ++E+ I  L + LE +K++WS +N  K+D+EK L  +   +    ++  GIHG    +KE +   ++K LQ+  ++E  I   ++ +  L S    + P      L K + +  + L N I+ NE+D+  H  Y   +D F   ++ I+  + + ++I+  P+TK GL  K +LL  LK+L    + +L  ++NL+  V++ ++ +   N+  + +  I+ F + F
Sbjct:   16 KNEQEKMQKKTFTKWMNSYLCQKKPPIIIKDLMKDLSDGLLLLDLLEILTKTTLKKEKPKNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAILHFQIEEQEEFLLQALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKNFENLNSKNNYDIFADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFPNVHDKTFNDKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISPKQLEAMKTRMENVCKAEGPVREKLNIFGIQANLKNKAQKWAVDLNSWDSPIQSKQDLLDKIEQFNISMENGTSMDKFTSQLDELVKRKVKFCKENPVLDEDLLNFINKAINECEEENDILPEKFESTLMKLENLSSEWDEISDGEQKIETFSRRLSKALQLDDFQQQRSLVDQLPEVLDLLNDVKYKIQNDLTPHCSEKLLYTMKENLNELEINLKELGAQVVDKVEKQKQKIEQQQQAARDTLIDEIFSCGQANVDSIKQWMNDLDQCMETPINGSSADLQYVLSKLKDLDKESPKIQKLIDQGYQKVDDLENENSPEKAQELKESLNEFQKKFKRYTEKEIPKNLQNLKTFIDTLNIVENDINDLEKTMKEGEFIKNHLDDLEFSNGTDDIIFKEQEFLEKENEISKSLIKDKDLLKHIKKLVESTDLKIDLKPLEKRIFDSENVLQDLLTNAKENLTANNQCNEACTSADQSLECLLDQIEKNSSINNDEEGQKTKLKNIQNFEEEIEEVEKQINAAVALRNNLLSNLNKSNLDKIDNSISKIKQKTVSIKENLQKTKVNLSNNLNDWQDFKQTKDLMTKCFDDIIDDLKESHQKRKGVHGENLTDKADLLEENKERLENLIKQEDKLKDLNKKALKLGLEKPINEVKNLKDQILKQKANLEEEIQQNEKDLENHQQFNNDIQSLHDWLAQTELLTNQIQNLPNTKEGLIEKQKLLEDLNSLKSTGDKKLKELKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLDKQGGINETIEKIEDLGEKSDQISENINEINKRLEKCLNLPSNTLNEKEKLAKELNNTIRLVDQQLAQINDLKSQCKHLENCEAVEELLNNLESLEEQCNIRKAKIEEKMNETESDIKKQVALENNLKILADLMNETETEMKISVTKQTGASAVEENLEKLKGLKSKLESEKNILENIEEQKDDFNVPKHCLMACKSSKKKYLDLKDEIHQLEENLNLMKNNWSEFDSAKSKIEESLETIGNDIENMHVTHNGIHGGDCDDKVSLLNEKKNELDDLIRQEEETNDLFSKAKKLGSNAPMIEIQNLKERILKQKENLKKEIKQNEKDLENHQQFNNDIQSLHDWLAQTELLTNQIQNLPNTKEGLIEKQKLLEDLNSLKSTGDKKLKELKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVFVNLDKQG-GINETIEKIEDLGEKSDQISENINEINKRLEKCLNLPSNTLNEKEKLAKELNNTIRLVDQQLAQINDLKSQCESLENCEAVEELLDKLESLEEQCNENKSEIEDKIVENNINIKMQAAFEEKLDEFANLMNEAEIEITSL-PKENSEIAIEESLQKLENIKSKHLPGKNTLEEILKSQTELRIPQEYSETCEKYEEKYCNLENGIKDLTNALEQKKSNWSRYNLIKSDIEKSLETLKDDINVSHEMRKGIHGKDSKDKETIFHDNKKRLQDLNDKEKVINELIEMAKLLGS----EKPVNEVLQLKKTFLEDKDDLENEIKINEKDLKNHRQYENDLDLF---HDWILEAESLADKISGTPSTKAGLIEKQNLLNKLKNLKPVGEKMLKEIKNLQKVVLNETAPDEKENINIQLNAEIEKFNEVF 2057          
BLAST of Nesprin-1 vs. Planmine SMEST
Match: SMESG000069851.1 (SMESG000069851.1)

HSP 1 Score: 238.424 bits (607), Expect = 4.989e-62
Identity = 161/279 (57.71%), Postives = 199/279 (71.33%), Query Frame = 2
Query:  146 MDRKDTVVKKGVLL----KDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTAXXXXXXXXXXXXXXXALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINS 970
            M+  D+V  K   L    KDEQE++Q+KTFT W+N+YL Q  PP  I +L + + DGL L+ LLE +T   L+KE+PKNMQKIH LSNI TALEF+++ +KIKLVNIN +D+ DG+P+I+LGL+WT IL FQIEEQEE L+ ALG   D     K  AK  L+ W N  + DKY LN+ DFG SW DG+AFNALVHNIDP+LV+   ++  TNKE L+ AF  AE +LGIP LLD +DVDV KPDEKSIMTY+ QFLKSYPEG K   I E I A  N+
Sbjct:    1 MEDHDSVKGKTETLILSKKDEQERVQRKTFTNWINTYLVQAHPPYKIDNLYESIKDGLCLIHLLEAMTGEKLRKEQPKNMQKIHRLSNINTALEFLKS-RKIKLVNINATDIADGRPSIILGLMWTVILFFQIEEQEEILIGALGADYDG----KLNAKTSLLNWVNKTIGDKYNLNVTDFGPSWRDGKAFNALVHNIDPSLVDWNGVKNKTNKENLQEAFKQAE-QLGIPHLLDVQDVDVAKPDEKSIMTYITQFLKSYPEGGKE--IEENIVATNNA 271          

HSP 2 Score: 90.1225 bits (222), Expect = 4.797e-17
Identity = 240/1149 (20.89%), Postives = 479/1149 (41.69%), Query Frame = 2
Query: 10145 ARKKLSELNEKYENLFQVVQEKVKQVDAFSKLETDLENWLKYADNYMERYSENKPYSTHLQCETNLENMKEFFHEFEDKEYLLDKLKQMHCANNFPYIEKIEILT------ESFKKLKTEIENQINHLNKKTSGVLEMAESMESFNQYLRQDYLEYEKL-----------EEIFNKCKNQFNQTAMNKLRL-CLNDNAFSIRQETLWNL--LQNVRKFSKLVERSRIDIAGNLLDQKETAENELETLKANWSKLSKRINELNNLKMDLDKALEHFNIWLNNSCKWFVNITETRKKVFESNETLQMKNNLQALKDDITEHKVDLSRL----QTFVDSLMKICNDETFQKTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHWIEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELEN------YGQSKFVEAIQDGEELLGELAGMPMQIV------QQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAFKEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLTELNRHKQDFLQLANLATELAN----PSFDIENSQIQNRYIRLSNNLKDKIEKLNKQQADYDQIKQDIEEMEKWVFQTSIRIINENAEQGKTTNNTIQEIETLIKHSNEIIANILSQEPEIVKIGQAVDSLI-------NISNNKNSDKEKELQDDLSKLIENFNNLKSSSIHKRDHLKDSVKKWDTYQDFLQSTKLFLDNELPNWWRERNQDQMKSAYSNFNN-EPILKEILDMDNKLNGLKTTMELEAKACDGILPTIAITASRSQTPNFKSNRSLYSPSSNWSTNKSDVTPNDELIPNILSKSIYEDLDENIKKVSNLKKEIIEKITDWNNFNREKTSFKNWMDNEMLKFSSVLYTEPGISN--FASLQKSKLKEIQEEMNYKKQALLNLNTHFKELTSNVSGAADLVLKNLNQDFDETEKKISKLLNREDKGVEA---DFTDEESNMDIIQERKVPKLNLKNLESPQLFRYESPENLNRFTQTNISKDETDYKFKKTNF-----SSQTPGTKTTQTN--FNDMSNFGTQTNDKYQKKRERKLESELQILNSLKNMNSEFERSKPFPEYNNISSVPMSA--KPRSSALESVRRN 13405
            A +KL++  ++  NL   +++ +K  +   K   D +N +  A  ++E     K  +T  +   ++E MK        ++ +++KL  +   +N   + K  + +      E+  K K EI N +  LNK   G L++ + + +  Q L     +   +           EE  NK  N    + ++K++L C +  A S   E L N   L N  +F    E  +  +  NL    E A+     ++ N    +  IN   N+           + WLN + K    + ET    +  ++  +  + L+ L +D+ E +  + ++    +   DS       +     LD+I  ++  L    +++  +    I+   +++ S      W+  +TQ LLK SD  +KQ         ID+  +  EN      YG+      I  G++ L  L     Q        Q+++ DL+ +W +  +Q++ ++ N+       + F  + N+L  ++ + E+ G+ +L  +E                   K ++ EL+    D  +L   A E+      PS  +    I +RY  +  NL+ ++ K  + + D++  K  +   EKW+  T  RII EN     +  +    +E   K  ++I  +   +  ++VKIG+ + S +       + S N +S  E E+  D+  L  +  NL  ++   +  L + +  W  Y+D +Q    +L N+L +WWR +          NF + +  ++E  ++   LN  +  M++    CD +       +S +   NF +   +     N     S  TP        L++S+   L++NI+++     E+   + +W +F+++   F+ W++ +   F S +  +P + +      Q++  +++++E++ +++       H  +L           +  L +  ++ ++++ KLL R+D+ ++A   D+ D+++   +  +    +LNL    + Q      PE  N  T T     +T  +  K +F     ++   G + +  N   + M      T+D       +KL  +    + LKN    F  + P    +     P     K RS+A ESVRRN
Sbjct:  849 ALRKLNQTKQQLSNLQTNIKDAIKDAENNVKNHQDFDNKMNGASEWLEMAKALKLDATSKETPGSIEEMKR-------RKDIIEKL--IESKSNGENLVKAAVTSGEIVAKETSLKGKEEILNGVRGLNK---GFLDLLDGLGAAKQSLEMKLAKASNINRDLDALVNWAEEFENKLFN-ITDSDLDKIKLLCDDAQAKSYLAENLVNQTKLMNDPEFQSRAENIKELVKHNL----ENAQQMYSQIRENLQAYNGLINNCKNM-----------DSWLNEAEKKMARLGETSG--YSPDDLAKNLSLLEKLAEDVKEKRNYIEKINNQGRDLTDS--SPSKGKETNALLDKINNKHKKLMENLEDKNQEVRRNIEDQKEFDESIHKAQQWMNDATQKLLKYSD--IKQCSP----TQIDSFSRNFENIVDSVPYGEEIVSSTIYTGQKHLEHLRQSKRQDSNNYERDQKRINDLEKNWGDFQKQIDLVNKNVHRVKDSLDEFNLLKNKLEEFITEKEN-GMKELPSVEI-----------------LKYIINELDDSINDLDKLQTKAVEVGGSLNYPSAIMVAKGITDRYQNMKKNLESELNKSKQLENDWNAYKNALNVCEKWIVDTGFRII-ENDYSAYSPEDAQVRLEEYSKLCDQI-QSFGEEVNKVVKIGKQLASKLPKDQKPDSNSMNFSSHSEPEIHADIENLQRSHKNLVENANQTKSRLIEQLDNWRKYRDLVQVNDKYLTNDLTDWWRNKKY----FPPQNFKDVDENIREAEEILRVLNDKQNEMKMTKSNCDSL-------SSENGPRNFSATAEI-----NRKRKISSTTPLSR-----LAESVETGLEKNIEEIKKYIPELENLLKEWQSFDKDTAEFEIWINEKEQMFESTI-GKPSMKSTCLTDKQRTFGEQLKKEIDGQEK-------HINDLLEKARVVGSRKINPLLKRIEDLKRQLKKLLERKDEEIDAVDFDYVDKQT---VGCQNNEMQLNLSETIATQTL----PEKYNISTSTEPRTRKTKVQTFKQDFIVPVNANNVFGLRNSGGNRGLSKMLYPYCCTSDLLN----QKLHLDYVHGSRLKNNQKSFIPNAPTRPIDGGKYPPRLGISKVRSAAEESVRRN 1899          
BLAST of Nesprin-1 vs. Planmine SMEST
Match: SMESG000016745.1 (SMESG000016745.1)

HSP 1 Score: 213.386 bits (542), Expect = 3.892e-54
Identity = 183/552 (33.15%), Postives = 298/552 (53.99%), Query Frame = 2
Query:  188 KDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTA----XXXXXXXXXXXXXXXALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPP--NELDIVKDFNDKVDK--------NFENLNSKNNY-DIFADLMSQRDDMKLL--LDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESL-------MEPFPNVHDKTFNDKVLQKLKEHESIFNKK---NDVLAKFREVLQNPPAN--ISPKQLEAMKTRMENVCKAEGPVREKLNIFGIQANLKNKAQKWAVDLNSWDSPIQSKQDLLDKIEQFNISMENGTSMDKFTSQLDELVKRKVKFCKENPVLDE 1756
            KDEQ+ +QKKTFTKW+N YL +    +I+KDL  D+ DGL+L+ LLE+L+ +T++KE+  NM+K+H LSN++ AL ++ +++KIKLVNINPSD+V+GKP IVLGL+W       +     +++     A+  AN  N+      K  L+ W  N +  +Y + I DFG+SW  G AF+AL+   +P LV+M+ + +G  ++ L++AF+IAE  LGI KLLDSEDV  EKPDEKSIMTYV+QFL+      +PE+  +++        +SM +P   NE    +  NDK+ +          E L    N+ D+F  + + +++++L+   D+ S+   L LD         DF   +  +   QW LD+ +     + +  WL  +E  L       ++    +  +  +D  +Q +KE+E+ F      +  LA+ +  + N   N  +      +++ R++ V K E  +R+KL +    A+LK K ++    L  W     S  +  D++  F  +M NG     F + + E++    K    +P   E
Sbjct:   11 KDEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYL-SERKIKLVNINPSDIVEGKPVIVLGLIWLIILFFQIQEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTI--TRPESPRKKLK-------LSMPEPAKSNE----RGVNDKIKRFIINVKESRIEKLKQIENFNDVFKLISNLKNELELIPEWDQTSSTGDLLLDQ--------DFKAAKRLVLSCQWLLDESVNNGWKN-LCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQ-IKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLLHKIASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGN----FVAIVTEMINDIEKLLSADPTFKE 534          
BLAST of Nesprin-1 vs. Planmine SMEST
Match: SMESG000016745.1 (SMESG000016745.1)

HSP 1 Score: 213.001 bits (541), Expect = 4.776e-54
Identity = 181/552 (32.79%), Postives = 298/552 (53.99%), Query Frame = 2
Query:  188 KDEQEKMQKKTFTKWMNSYLCQKKPPIIIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMQKIHCLSNIRTALEFMENDKKIKLVNINPSDVVDGKPAIVLGLVWTA----XXXXXXXXXXXXXXXALGMANDPNAKVKGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVNMEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVAQFLKSYPEGKKPENISEEITAEINSGLMSMVQPP--NELDIVKDFNDKVDK--------NFENLNSKNNY-DIFADLMSQRDDMKLL--LDKMSTDNYLDLDANDVRQVIGDFDKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESL-------MEPFPNVHDKTFNDKVLQKLKEHESIFNKK---NDVLAKFREVLQNPPAN--ISPKQLEAMKTRMENVCKAEGPVREKLNIFGIQANLKNKAQKWAVDLNSWDSPIQSKQDLLDKIEQFNISMENGTSMDKFTSQLDELVKRKVKFCKENPVLDE 1756
            ++EQ+ +QKKTFTKW+N YL +    +I+KDL  D+ DGL+L+ LLE+L+ +T++KE+  NM+K+H LSN++ AL ++ +++KIKLVNINPSD+V+GKP IVLGL+W       +     +++     A+  AN  N+      K  L+ W  N +  +Y + I DFG+SW  G AF+AL+   +P LV+M+ + +G  ++ L++AF+IAE  LGI KLLDSEDV  EKPDEKSIMTYV+QFL+      +PE+  +++        +SM +P   NE    +  NDK+ +          E L    N+ D+F  + + +++++L+   D+ S+   L LD         DF   +  +   QW LD+ +     + +  WL  +E  L       ++    +  +  +D  +Q +KE+E+ F      +  LA+ +  + N   N  +      +++ R++ V K E  +R+KL +    A+LK K ++    L  W     S  +  D++  F  +M NG     F + + E++    K    +P   E
Sbjct:   52 RNEQDFIQKKTFTKWINKYLKKHDSNLIVKDLFVDIRDGLMLIYLLEVLSGSTMRKERGPNMKKLHYLSNVKIALNYL-SERKIKLVNINPSDIVEGKPVIVLGLIWLIILFFQIQEHELDKKSQQSGAVRQANANNSASDKGVKLKLLTWIQNIIPREYNMTITDFGKSWSSGIAFHALIEVFNPNLVDMKIVLQGDPQKNLDSAFDIAERHLGIAKLLDSEDVIAEKPDEKSIMTYVSQFLELTI--TRPESPRKKLK-------LSMPEPAKSNE----RGVNDKIKRFIINVKESRIEKLKQIENFNDVFKLISNLKNELELIPEWDQTSSTGDLLLDQ--------DFKAAKRLVLSCQWLLDESVNNGWKN-LCKWLISSERILEFHKNNQIDVSKEISPELLDDLTVQ-IKEYETHFKNSPFHSPTLAELKRCMINTDKNNKVFISYTISVERRIQKVVKEEFSIRQKLLLLHKIASLKMKEKEINYKLQYWKREFDSLANAEDRLLDFESAMANGN----FVAIVTEMINDIEKLLSADPTFKE 575          
The following BLAST results are available for this feature:
BLAST of Nesprin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYNE12.813e-7234.01spectrin repeat containing nuclear envelope protei... [more]
SYNE16.240e-7133.12spectrin repeat containing nuclear envelope protei... [more]
SYNE16.423e-7133.55spectrin repeat containing nuclear envelope protei... [more]
SYNE11.424e-6839.78spectrin repeat containing nuclear envelope protei... [more]
SYNE16.609e-6833.55spectrin repeat containing nuclear envelope protei... [more]
back to top
BLAST of Nesprin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-708.890e-3333.79Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
unc-701.870e-3233.79Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
unc-702.318e-3233.79Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
unc-702.364e-3233.79Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
vab-109.841e-2830.91VAB-10B protein [Source:UniProtKB/TrEMBL;Acc:G5EF... [more]
back to top
BLAST of Nesprin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Msp3004.933e-6637.53gene:FBgn0261836 transcript:FBtr0332404[more]
Msp3005.643e-6637.53gene:FBgn0261836 transcript:FBtr0303388[more]
Msp3005.644e-6637.53gene:FBgn0261836 transcript:FBtr0303389[more]
Msp3006.044e-6637.39gene:FBgn0261836 transcript:FBtr0303383[more]
Msp3008.820e-6637.39gene:FBgn0261836 transcript:FBtr0303385[more]
back to top
BLAST of Nesprin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
syne1b4.436e-6938.09spectrin repeat containing, nuclear envelope 1b [S... [more]
syne1b4.436e-6938.09spectrin repeat containing, nuclear envelope 1b [S... [more]
syne1a2.836e-6035.49spectrin repeat containing, nuclear envelope 1a [S... [more]
syne1a5.361e-6035.49spectrin repeat containing, nuclear envelope 1a [S... [more]
syne2b9.903e-4240.60spectrin repeat containing, nuclear envelope 2b [S... [more]
back to top
BLAST of Nesprin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYNE11.537e-6132.81spectrin repeat containing, nuclear envelope 1 [So... [more]
SYNE16.634e-5534.11spectrin repeat containing, nuclear envelope 1 [So... [more]
SYNE17.033e-5534.45spectrin repeat containing, nuclear envelope 1 [So... [more]
SYNE18.032e-5534.05spectrin repeat containing, nuclear envelope 1 [So... [more]
SYNE19.186e-5534.05spectrin repeat containing, nuclear envelope 1 [So... [more]
back to top
BLAST of Nesprin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Syne11.148e-7033.11spectrin repeat containing, nuclear envelope 1 [So... [more]
Syne12.756e-6535.83spectrin repeat containing, nuclear envelope 1 [So... [more]
Syne13.561e-6535.83spectrin repeat containing, nuclear envelope 1 [So... [more]
Syne23.858e-4733.19spectrin repeat containing, nuclear envelope 2 [So... [more]
Syne22.184e-4433.19spectrin repeat containing, nuclear envelope 2 [So... [more]
back to top
BLAST of Nesprin-1 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8NF91|SYNE1_HUMAN1.499e-6638.00Nesprin-1 OS=Homo sapiens OX=9606 GN=SYNE1 PE=1 SV... [more]
sp|Q6ZWR6|SYNE1_MOUSE2.582e-6636.67Nesprin-1 OS=Mus musculus OX=10090 GN=Syne1 PE=1 S... [more]
sp|Q6ZWQ0|SYNE2_MOUSE1.661e-4333.19Nesprin-2 OS=Mus musculus OX=10090 GN=Syne2 PE=1 S... [more]
sp|Q8WXH0|SYNE2_HUMAN4.138e-4333.00Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV... [more]
sp|Q96JQ2|CLMN_HUMAN8.660e-3537.04Calmin OS=Homo sapiens OX=9606 GN=CLMN PE=1 SV=1[more]
back to top
BLAST of Nesprin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|182759113.103e-9044.51tr|A0A267EWS2|A0A267EWS2_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183159879.518e-9044.49tr|A0A267EZS9|A0A267EZS9_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182923645.630e-8740.40tr|A0A1I8GMD0|A0A1I8GMD0_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183031791.013e-8340.40tr|A0A267F524|A0A267F524_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183161253.031e-8340.22tr|A0A1I8GVC4|A0A1I8GVC4_9PLAT Uncharacterized pro... [more]
back to top
BLAST of Nesprin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039764.13.802e-7040.37pep primary_assembly:Astyanax_mexicanus-2.0:9:2416... [more]
ENSAMXT00000036923.14.894e-7040.27pep primary_assembly:Astyanax_mexicanus-2.0:9:2416... [more]
ENSAMXT00000045503.11.651e-6636.02pep primary_assembly:Astyanax_mexicanus-2.0:9:2416... [more]
syne1a7.612e-5931.76spectrin repeat containing, nuclear envelope 1a [S... [more]
MACF14.179e-3836.62microtubule actin crosslinking factor 1 [Source:HG... [more]
back to top
BLAST of Nesprin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009426.16.246e-4937.41pep scaffold:Pmarinus_7.0:GL476614:383620:553344:1... [more]
ENSPMAT00000006506.14.755e-3736.36pep scaffold:Pmarinus_7.0:GL476558:286440:335800:-... [more]
ENSPMAT00000006515.11.993e-3536.71pep scaffold:Pmarinus_7.0:GL476558:286719:335794:-... [more]
ENSPMAT00000002838.13.753e-3535.42pep scaffold:Pmarinus_7.0:GL477168:22072:87306:1 g... [more]
ENSPMAT00000008111.11.637e-3437.25pep scaffold:Pmarinus_7.0:GL478136:8967:48859:1 ge... [more]
back to top
BLAST of Nesprin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nesprin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO377083.141e-3538.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291013.258e-3236.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374064.784e-3136.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424315.247e-3139.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495767.178e-3037.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nesprin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000000374.24.544e-6638.25pep primary_assembly:ASM223467v1:22:316712:329038:... [more]
ENSORLT00000028699.11.185e-5637.00pep primary_assembly:ASM223467v1:24:9030419:904584... [more]
ENSORLT00000033742.11.689e-5636.69pep primary_assembly:ASM223467v1:24:9030654:905023... [more]
ENSORLT00000031933.15.275e-5636.85pep primary_assembly:ASM223467v1:24:9030419:905023... [more]
ENSORLT00000037920.11.212e-3638.20pep primary_assembly:ASM223467v1:11:16926158:17021... [more]
back to top
BLAST of Nesprin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077685.10.000e+097.06SMESG000077685.1[more]
SMESG000077685.10.000e+096.72SMESG000077685.1[more]
SMESG000069851.14.989e-6257.71SMESG000069851.1[more]
SMESG000016745.13.892e-5433.15SMESG000016745.1[more]
SMESG000016745.14.776e-5432.79SMESG000016745.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021613 ID=SMED30021613|Name=Nesprin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=14045bp
CAAAATCAATTAATAGCACTTTCGTGAATTTTAATCAATTATTACTGGAT
AAGTTAATTCTAATAGCGCTCAAATCAAACGTGGCTGAACAATAAAAGAA
ATTAAAACTTTTTTCGATTTATTTTATTATTTATCAACTGACTAAATGGA
TAGGAAAGATACTGTCGTGAAAAAAGGAGTCTTATTAAAAGATGAACAAG
AAAAGATGCAAAAGAAGACCTTTACAAAATGGATGAATTCATATCTTTGC
CAGAAAAAACCTCCCATAATCATAAAAGATCTCATGAAAGACCTCAGTGA
TGGACTTCTTTTGTTGGATCTTCTGGAAATATTGACAAAAACAACATTGA
AAAAAGAGAAACCAAAAAATATGCAAAAAATACATTGCTTATCTAATATA
AGAACAGCCTTAGAATTTATGGAGAATGATAAAAAAATAAAACTAGTTAA
TATAAATCCATCAGACGTGGTTGATGGAAAACCTGCAATTGTCCTTGGAT
TAGTATGGACAGCAATTTTACATTTTCAGATTGAAGAACAAGAAGAATTT
TTATTACAAGCATTAGGAATGGCAAATGATCCAAATGCAAAAGTCAAAGG
TCAAGCCAAAAAAGGTTTGATGGCTTGGACAAATAATGCTTTATCTGATA
AATACGGATTGAACATAAAAGATTTTGGAGAAAGTTGGTGTGATGGAAGA
GCGTTTAATGCATTGGTACATAATATAGATCCAACACTCGTAAATATGGA
AGAAATAGAGAAAGGAACAAACAAAGAAAGATTAGAAAATGCTTTTAATA
TTGCTGAAAATGAATTGGGGATTCCTAAATTACTGGATTCTGAAGACGTC
GATGTTGAAAAACCGGACGAGAAATCTATCATGACATATGTTGCTCAATT
TTTAAAATCATATCCTGAAGGTAAAAAACCAGAAAACATAAGTGAAGAAA
TTACAGCGGAAATAAACAGTGGCTTAATGTCAATGGTACAGCCCCCAAAT
GAACTTGATATAGTCAAAGATTTCAATGACAAAGTTGATAAAAACTTTGA
AAATCTCAATTCTAAAAATAATTATGACATCTTCGCTGATTTAATGTCTC
AAAGAGATGACATGAAATTGTTACTTGATAAAATGTCCACAGATAATTAT
CTAGATCTTGATGCTAATGACGTAAGACAAGTTATAGGAGATTTTGATAA
AACCGAAATGAAATTGAATGAATGGCAATGGGATTTAGATAAAGTTTTAC
CGGGAATTCTAGGTTCTGAAATTGGAAGCTGGCTACAAGATGCAGAGGAA
AGTTTAATGGAACCATTTCCAAATGTACACGACAAGACATTCAATGATAA
AGTTTTACAAAAGTTAAAAGAACATGAGAGTATATTCAATAAAAAAAATG
ATGTATTAGCAAAGTTCAGAGAGGTTTTACAGAATCCACCAGCAAATATT
TCTCCAAAGCAATTGGAGGCTATGAAAACTAGAATGGAAAATGTATGCAA
AGCAGAAGGACCTGTTCGAGAGAAGCTAAATATTTTCGGAATTCAAGCAA
ATTTGAAAAATAAAGCACAAAAATGGGCAGTTGATTTGAACTCGTGGGAT
TCTCCGATTCAGTCAAAACAAGATTTACTTGATAAAATAGAACAATTTAA
TATTTCAATGGAAAATGGAACTTCTATGGATAAATTTACAAGCCAGTTAG
ATGAGCTTGTTAAACGGAAAGTGAAATTTTGTAAAGAAAATCCTGTTCTT
GACGAAGACTTGTTAAATTTCATCAATAAAGCCATCAATGAGTGTGAAGA
AGAGAATGACATTTTGCCAGAAAAATTTGAATCCACATTAATGAAACTTG
AGAATCTTTCAAGTGAATGGGACGAAATAAGTGATGGAGAACAAAAAATA
GAAACATTTTCAAGAAGATTAAGTAAAGCTCTTCAATTAGATGATTTTCA
ACAACAAAGATCCCTTGTTGATCAATTGCCCGAAGTACTTGATCTATTAA
ATGATGTTAAATATAAAATACAAAATGACTTAACTCCTCATTGTTCGGAA
AAGTTACTATATACGATGAAAGAAAACTTAAATGAATTGGAAATTAATTT
GAAGGAACTTGGCGCTCAGGTAGTTGATAAGGTAGAAAAACAAAAACAAA
AAATTGAACAGCAGCAGCAAGCTGCTCGGGATACTTTGATTGATGAAATT
TTTTCTTGTGGACAAGCAAATGTAGATTCCATTAAACAATGGATGAATGA
TCTAGATCAATGTATGGAAACTCCAATTAATGGATCATCAGCAGATTTGC
AATATGTACTATCAAAGTTAAAAGATTTGGATAAAGAGTCACCAAAAATT
CAGAAACTAATCGATCAAGGATATCAAAAGGTTGATGATTTAGAAAATGA
GAATTCTCCAGAAAAAGCCCAAGAACTTAAGGAATCTTTGAATGAATTTC
AAAAAAAATTTAAAAGATATACGGAAAAAGAAATACCTAAAAATCTACAG
AATTTAAAGACTTTTATTGATACTTTGAATATCGTCGAAAATGACATTAA
TGATTTGGAAAAAACCATGAAAGAAGGCGAATTCATAAAGAACCATTTGG
ACGATTTAGAGTTCTCCAATGGTACTGATGACATCATCTTTAAAGAACAA
GAATTTTTAGAAAAAGAAAATGAAATTTCCAAGTCTCTCATCAAAGACAA
AGACTTGTTGAAACATATCAAAAAACTGGTTGAAAGTACAGACTTAAAAA
TTGATCTAAAACCATTGGAAAAAAGAATATTTGATTCTGAAAACGTTCTA
CAAGATTTATTGACAAATGCAAAAGAGAACTTGACTGCCAATAATCAATG
CAACGAAGCTTGTACAAGTGCAGATCAATCATTAGAATGTTTATTAGATC
AAATCGAAAAGAATTCTTCAATAAATAATGATGAAGAAGGTCAAAAGACA
AAATTGAAAAACATCCAAAATTTTGAAGAGGAAATAGAGGAAGTGGAAAA
ACAAATAAATGCAGCAGTGGCTCTAAGAAATAATTTATTATCGAATCTGA
ATAAATCAAATTTAGACAAAATTGACAATTCAATTTCAAAAATAAAACAA
AAGACCGTTAGCATAAAAGAAAATTTGCAAAAAACCAAAGTTAATTTGTC
AAACAATTTAAATGATTGGCAGGATTTCAAACAAACAAAAGATTTAATGA
CAAAATGTTTCGATGATATAATTGATGATTTAAAAGAATCACATCAAAAA
CGAAAAGGAGTGCATGGCGAAAATTTAACTGACAAAGCAGATCTTTTGGA
AGAAAACAAAGAACGATTGGAAAATTTGATAAAACAGGAAGACAAACTTA
AGGATCTCAACAAAAAGGCTTTAAAACTTGGTTTAGAAAAACCCATCAAT
GAGGTGAAAAACCTAAAAGATCAGATTCTTAAACAAAAAGCAAATTTAGA
AGAAGAAATACAACAAAATGAAAAAGATCTTGAAAACCATCAACAATTTA
ATAACGATATTCAGTCTTTACATGATTGGTTAGCACAAACAGAACTCCTG
ACCAATCAAATTCAAAATCTTCCTAATACGAAAGAAGGCTTAATTGAAAA
ACAAAAACTATTAGAAGATCTCAATTCATTAAAATCAACTGGTGATAAAA
AGTTGAAAGAATTAAAAAATTTACAAAAAGTCGTATTGAATGAAACAGCT
CCCGATGAGAAAGAAAATATTAATATTCAACTCAATGCAGAAATTGAAAA
ATTCAATGAAGTTTTCGTAAATCTAGATAAACAAGGCGGAATTAATGAGA
CAATTGAAAAAATTGAAGACCTAGGAGAAAAGTCAGATCAGATTTCTGAA
AACATTAATGAAATTAATAAAAGGTTAGAAAAGTGTTTGAATTTACCGAG
CAATACCTTAAATGAAAAAGAAAAATTGGCTAAAGAGTTGAATAACACAA
TTCGTTTAGTAGATCAACAATTAGCTCAAATAAATGATTTGAAATCTCAA
TGTGGATCTTTAGAACATAGTGCAGCTTTAGAGGATCTTCTGAATAAATT
GGAATCTTTAGAAGAACATTGCTTTGAGATAAAAACGAAAATTGAGGAGA
GAATAAAGGAGGTTGATTCAGATATAAAATTTCAGTCGGCTCTTGAAGAA
AAATTAAACGATTTGTCTGAAATAATGAACGAAGTTGAAATTGAGTTTGA
CTATTCGAAGCCCAAAGAATCGAGTGAAGCAGCTATCAATGAATCGCTTT
CTCAACTTCAAAAATTAAAAGCTCAACATGAACCAGGTAAAAATATTTTA
AAAACTATGATAAAACTACGTAATGAATTCAACGCGCCCGAACAATGCGT
AACTGCTTGCAATGACTTAGAACAGAAATACTTTGATATTGAAGATGATA
TTAAAAACTTACAAAAAGAACTTGAGATGAAAACGACTGTTTGGCAGAAA
TTTAATGCTTTGAAAGCCGATTTAGACAAAACTTGTAACACTGCTATTCT
TGAAATTGGAAACGAGCATAAAAAGAGGAGTGGTATTCATGGAGGAGATT
GCGAAGACAAATTTAATCTATTGGAAGACAAAAAGAAAATTTTGAGTAAT
ATGACAAACAAAGATCCGCAGGTAGATGCACTGATAGAAGTCTCCGGTAA
ACTTGGATTTGATAAAGCTTTATTTGATGCTCAAAACATTAAAAGAAAAT
ATTTGAAGCTAATTGATGATTTACAACAAGAAATTTCTCAGAATGAAATC
GATTTAGACAATCATAAAAAATTTGATCAAAGTCTTTTTGAATTTGAAGA
TTGGATGAAAAATACGGAAAAAATCGTCAAACAAATTGCTAACTTACCAA
ACGATAAAAATGGTTTGCTGGAAAAACAAAACCGACTCGAAGAGATGAAA
ACTTTAAAATCAAACGGCAATGAAATGATTAAAAATATTAAACATTTGCA
AAATGTTGTCATCAACGAAACAGCTGGGAATTTCAAAACAACTCTCAATG
AAAAGGTAAAAAACAAAATAGAAAACTTCGAGAGAGTTTTCGGAGATTTA
GATCAAGAAACCGACAATATTAAAGAAACAATTGATAAACTTAAAGTAAT
AGATGAAAAATCAAATGAAATGGAAAGAAACATCAGAGAAATTGAAAATA
CAATTAATAAATGCTCAATAGTTCCCAGTGAAAGTGTCGGGGATAAAGAA
AAATTGGGAAAAATATATAGAAGCCTTGAGCATGACATAGAACAACATTT
AATAGATTTAGATTCATTAAAACAACAATGCAATGCCCTTAATGCAACAA
CAGCGAATTCAGCAATGATAAACAAACTTAACAAAATGACAGATGAATGC
AAATCCATGAAAGCAGACATTTCGCAATTATTTTCCAAAAATGTTTCCGA
CTTAAAAAACCTTAAAACATTTCAAGACAAAATGAATGAATTCAATGAAA
GCATGGATAGAATTGAAACAGAAATTGAGAAATGTTCTCCCAATGGATGC
AATGAAGCTGCCATAAAAGATAACATCAAAAAGCTCAAAAAATTTAGATC
TCTTCACGAGAATAGCAAAGATGTGTTGACTGATCTTTTGCGAATAGGAT
TTGAATTGAGTGGCTTAAGTCAAATTTCTGAAGCTTCAGATCAAGCTGAA
CAAAAATATTCGGACGTGGAAGATGAAATTACAAAATTAGAGAGTAAATT
AGAAATGCAGAAAAACGACTGGTCAAATTTTAATTCGGATAAAAATGATC
TGGAAAAATGGTTAAATGAAATAACTAAAAAAGTTGAAAATTTGGAACAG
ATATCTGATGGTATACATGGTGGAAAATTATCTGAAAAAGAAAAGGTTTT
AGACAGTCACCAAAAACTTTTACAAGAAGCTCTCAATCGTGAAGCTGATA
TTAAATTGTTTTTAGACAGATCTACACCACTGTTCTCTGCAGTAAATCAA
GACTCACCGAAAAGAGTTACCAATACTCTGTGTAAGAAATACGAAAAACT
ATTGGAAACCTTAACTAACCGTATTCAAAAAAATGAAGAAGATATAAACT
TGCATGAAAATTATGCAAAACAAATTGACAATTTTAAAGAGGAAAATAAT
ATAATAATAAAAAGAATGAATGAAGAAATAGCTTCGTTGCCTAACACAAA
AGAAGGTCTTAAGCGAAAAGTCGATCTTCTAGGAAATTTAAAAGATTTGT
ACAATCAACGAAAAATGATTTTAGTTAATCTTGAAAATTTAAAAAATGCT
GTCATTGACCACTCATCTTCAAATTATTACTCAAACCTAGAGCAAGAATG
GGATCAAATAATTGACAGTTTTGAGAAAAGTTTCAATCCATCAATTGAAA
ATCAGTCAAAACTTTTATTGGCGGTTCAACAAATAGAAAAAACCGAATCT
ATTTGCCAAGATCTTCAGCACCAATTGGAAAATTTAGAAAGACGTTTACA
GGAGGCTGTGGATCAACACATTTCTTCTTTGAATGATATTGATATGAAGT
TAGAAACATTAAAAGAACTTCGGTATGAGTTGAGGGATCTTCAAACTCCG
ATAAATGATGTACAGCGAAAGCATTGCCAAAATCCCAGTGATGTTGAATT
GATTCAAGAAAGAATCGAACAAATTGCTAAACAGCACAAAGTTTTGAATG
AATCAATTAGTCAGAATATCAACGAAACAGAAAATCATCATAAACAATTG
TGCAATCTCACGACGAGTCTCAATAATTTCAAAACTTGGTTAGATTATTC
TTCCAGTCAAATAGAAGAGAAAGGTAAACCCGGAAATCTGGAGATGAATA
ACTTGAAAAAGAACCTCACCTCATTAAAACAACTTGCAGACTCAATCAGT
TGCCAATGTGACGATCAACTTTCTAAAATCAGAGAACATATGTTAAAGAT
CCATAAATTTTCATCAGAAAAGCTTAAAGATGACTTACAAAAAGAACTGA
ATATCATGAATGGAAATGTAAATTCTTTGAAAGACAAAATTCAAACAACT
ACCGAACATGAAATTAACAGAATAAATGAAGTTGAAAAAATTGACATTCT
CAAAAATGAAATCAAAGAAAATTTTTTAAAATTTGAAAGTCAAATCAATA
TTAATTTTAAAAATTTCGATTTAAATGAAAAACAAAACTATATAACTCAA
TTGAGAAATGTGCAGAACTTAATGAAAGAAAACGAGAAAAAAATAGAATT
TTTAGAAACTTCAATTCAAAATATAATAAAACATTCTCATGGCAAAATGC
TTGACATAAATGCTAATAAAATAATTAATAAAAGAAATTCAATTAAAATT
CAATTAAATGAATTAATTAATAAATTAACGCAAATGTCCGATGAACAAAT
GCAGTTCACCGATCTTTTAAATGACACGAAAATCTGTATTGAAAATCAGC
ACAATGAAATCAATATTGAAATATCTTTTGATAATAATATTGATCAAGAT
AAAAATAATTTAAATATTGTAAATGAATATTTAAATATCAACTCTAAACT
GAGTGAAAATAAAATCGAGATCCTTCGACAAAAGTTCAAGACCGTCAGTA
GATACGTTAATGAACAGGAGAATTTGAAATTGGAAGCAGAGGTGGATAAA
TTGGAAAAGAAATTCCATGAAACAATAGAGTTAAGTAAAGATAATCAGTC
TGCTTTATTGTTAAATATAAATAACGTAACTGAAGCCGACTTGTTTTACG
AGAGAACGATTAAATGGCTAAACTCAAAAGTCAGTGAATTAGAACAATTT
TATGTAAAACCAGAAACTTTAAGGGAAAAAGAAAATCGTTTGAGAATATT
AAATAAAATAAAATTTGAAACAGAAGAAAATACATCAATGATAAAAAGAC
AGATGGATAATTTACCTGTTTTATTGACGGTGCAAAACAAAAATGTAGAT
AATAAAATCAACACTTTAAAAATTCAATTGAAGGAAATCTTTGAACGTGT
CAGTGAAGAATTTAATATCCACGAAGAATTTTCTGAGAATTTTCACAGTT
TGATTAACAATATGGAGTCTTGCAAATATCAATTAATACAATGTGTAGAA
TCGATTGAATTCGACAAAGAAAATAAAATCATTAAGAAAAATTCAGAAGA
AATATTTACAGAAAATATTAGCAACAATAATAAACAATTAAATAAAGTAA
ATGAATTATATCAAACAGTAAAATATCAAACCTCTCCTGGCGGTATTGCG
ATTCTTGATACAGAAATGCAACTGGCCCAGACACTGTCAAAAGACATTGA
CGAGTTATTTCTCAAATTAAAAACAAAAGAACAAAAATTTGAAAACCTAC
AAAACAAATTTGAATCTCTCATTAATTCCATAGAAAATTCTTTGACGGAA
AATGAAGACGAAATGAAAAAGCTATCAGAACTGAAAAGAGATTTGAAACA
AAAAGCATCGACTAAGCAACATTTAGTAGAAAATATTTTACCAGAAATCC
ATGGCACTCAAAGTTTAATCGATGAACTGAAAGAAGTGTGCTATGAATAT
CTTTCGGAGATTATTGATAGAAATAAAAGTAGACGTGCAAATGACATCTT
TTATCGATTTTCTGAATTATCGAGACTTGCAGAATCGTCGATTAAAAAAG
TTCAAAAAGCTTGTGAAGATCATGAGTTATTTGATAAGTTTTATAAGGAA
GCTGTCGAATATTTCAATGAAATTAATGATGAAATTGAGTTTGTTTCAAA
TCTGCTTGATGTCGAAACGAACACGTTTCATGAATTGACAAAATTGACAG
CAAAGTTAAGCAGTTATGAAACACAGAGAACAGAGTTTTTCCAGTCTATG
CATAATGTTGAAAGTCAGGGTCAAATCACAATGGAACTGTCAAACAAGGA
AGGTAGAGATTTAGTAAGACGACAAATAAAAGAGATAAATGAACATTGCA
ATAAACTGGTGGACAAAATAAATAGCACCAAAATAAAACTTGACCGAAAT
ATTGACAATTATAACGCAACAAAAGAAAAATTGGATAAAATTAATGAATT
CACCAATGAAATTAATGATCGATTAAATATTATCAAATCAGAAGTGCGCG
ATTTTAATGAAAAGAACCAATCAATAATTTGGCTTGGAAATTGCAAAGAC
GAATGTGATTCGAATTTAAAAAATTTAAAGTTAATAAAATCAAGTTCCGT
TTTTCCCGATTTAAATAAAGGCATTGAAACAATAGAATTGAAATTAGAAA
AGCTCAATAAAAAAATAAAAGATTTAACAAGTAATTTAAAAACTGAATTA
AGAAGAATAAATGAATTTGAAAATGAAAAATTAACAATTAACAAATGGTT
GGAATCGTTAGAAAAACAGTATGAAACATTAATAACCTCGTTTTCAATTT
CGGATAATCTTGATTTAAAAATAAATCTTATTAAAAATTTCGAAACAACT
TCTATAGATCAAGTAAAAATATCTAAATTCGAAGAAATCCAAAACCAATT
ACAAATCCAAAAAACTATTGTTACAAATTTAATGTATATGAATCAGGAAT
TCGAAGTGAAAGATCAAATAAAAAAAGTGAACCTTTTTCACGAAATGATA
AAACGTTCAATTGCGATTTTTGAAGAAACATCCACCAAAATCAACGAAAA
TAAAACAATAATTAATAAAATTGAAAAATGGATTATCAATGCCAAAAGTA
TTCTACAAACAAAACAAAATTCTGAACACAATTTAAAGGAGTTAAAAATA
AACGTAGAAAATTTATTTGAAGAGTTTTCTAAATTAAACGGAGAAATAGA
TATCGAAAAATTTGTAATCACATCGGTTTTGTCGTCAGAAAATGTCGAAC
CTTTTTTTAATATTCTTTCAAATAATCTTTCAAATATCAATCAGCTGAAA
TCTGAAATGGAAATAATTTCAAAAGATATCGAAAGACGATTAAAACAAAT
TCAAATTGAAGAAGAAATTCAAAACAAGTTTTTAGAAAATTCTGAAAGAT
TTTATTTATTTGCAAACGAAATAAATGTGAATATTGATGAATTTGATCTT
CAGTCAATAAATAATTTCAACCAAATCGATACAATCACTAATAAAATCAT
TGAAATTCAGAAATTATTTGAAAATATCAAAGAGACTTCAGTGAAACAAA
TCAATCAAACAAAAGATCTTCAAATTGAAAATGAAGTAAAACTTGCGAGA
AAAAAACTGAGCGAATTGAATGAAAAATATGAAAACCTTTTTCAAGTGGT
ACAAGAAAAAGTTAAACAAGTCGATGCATTTTCTAAACTCGAAACCGATC
TTGAAAACTGGCTTAAATATGCAGATAACTACATGGAAAGATATTCAGAA
AATAAACCATATTCAACACATTTACAATGTGAAACAAATCTGGAGAATAT
GAAAGAGTTTTTCCATGAGTTTGAAGATAAGGAGTATTTATTGGATAAAT
TAAAACAAATGCATTGTGCAAATAATTTCCCATATATTGAAAAAATCGAA
ATATTAACCGAGTCCTTTAAAAAATTGAAAACTGAAATTGAGAATCAAAT
AAATCATTTGAACAAAAAAACTAGCGGAGTTCTAGAAATGGCAGAATCAA
TGGAATCGTTCAATCAATATTTAAGGCAGGATTATTTAGAATATGAAAAA
CTTGAAGAGATTTTCAACAAATGCAAAAATCAGTTCAATCAAACAGCAAT
GAATAAGTTAAGATTGTGTTTAAACGATAATGCATTTTCCATTCGTCAAG
AAACTCTTTGGAATTTACTGCAGAATGTTAGAAAATTTTCAAAACTGGTA
GAAAGATCTAGAATAGACATTGCTGGTAATTTATTGGATCAAAAAGAAAC
GGCCGAAAATGAATTGGAAACCCTAAAAGCTAATTGGAGTAAATTATCTA
AACGCATCAATGAGTTGAATAATTTAAAAATGGATCTTGATAAAGCTTTA
GAACATTTTAATATCTGGTTAAATAATTCATGTAAATGGTTTGTAAATAT
TACTGAAACTCGCAAAAAAGTATTTGAATCCAACGAAACTCTTCAAATGA
AAAATAATTTACAAGCTTTGAAAGATGACATCACAGAACATAAAGTGGAT
TTATCTCGACTTCAAACATTCGTTGATTCGTTGATGAAAATATGTAACGA
TGAAACCTTTCAGAAGACGTTGGATGAAATAACTAAGGAATATAATGTTC
TATTTAATAAGTGTCAGAATGAGTGTGATAAATGTGATCATCTTATAAAA
CTGATGACTAAATATGAGATTTCAAGAGCCGATGTATTGCATTGGATTGA
AGCAAGCACTCAGACGTTATTAAAATGTTCAGATTATACTTTAAAACAAT
CACAAATGAAATCCAAGTTACTTATGATTGATAATCTGGAAAAGGAGCTT
GAAAATTATGGCCAATCAAAATTTGTTGAAGCTATTCAAGATGGTGAAGA
ACTTCTGGGTGAATTGGCAGGAATGCCAATGCAAATAGTTCAACAGCAAA
TGGCAGATTTGAAATCTGACTGGATGGAAATATCAAGACAATTAAATCAA
CTTTCCAGCAACCTCAGGAACACAACCTCTCGGTCAGAAGCATTTAAAGA
AATGAGCAATAGACTGTCAAATTGGTTGGATGACATTGAACATACAGGTC
TTATGGATCTATCACACATTGAGCATCAATGTGAAATCCCTTTTGAAAGT
GGAAACTCTTCGAGTAAACATGATCGTGCAAAGACTCTTCTAACTGAATT
GAATCGACACAAACAAGACTTCCTTCAATTAGCAAATCTTGCAACCGAAT
TGGCAAATCCGTCATTTGATATTGAAAATTCTCAAATCCAAAATCGGTAC
ATCAGATTGTCAAACAATCTAAAAGATAAAATTGAGAAACTGAATAAGCA
ACAAGCAGATTATGACCAAATTAAGCAGGATATTGAAGAAATGGAAAAAT
GGGTCTTTCAAACCAGTATCAGAATCATTAATGAAAATGCTGAGCAAGGA
AAGACGACAAATAACACTATTCAAGAAATTGAAACTCTCATCAAGCATAG
TAACGAAATAATTGCAAATATTTTGTCACAAGAGCCTGAAATCGTTAAAA
TTGGTCAAGCCGTCGACTCGTTGATAAATATAAGTAACAATAAAAATTCT
GATAAAGAAAAAGAACTTCAAGATGACTTATCTAAACTCATTGAAAATTT
TAATAACCTTAAAAGTTCATCAATTCATAAGCGGGATCATTTAAAAGACA
GTGTTAAAAAGTGGGACACTTATCAGGATTTTCTCCAATCGACAAAACTG
TTTTTGGACAACGAGTTGCCGAATTGGTGGAGAGAAAGAAATCAAGATCA
AATGAAGTCTGCCTATTCAAATTTCAATAATGAACCTATTCTTAAAGAAA
TTCTTGATATGGACAATAAGTTAAATGGATTGAAGACTACAATGGAATTA
GAAGCAAAAGCATGTGATGGAATTTTACCCACTATTGCAATCACGGCTTC
TCGTTCACAAACTCCGAATTTCAAGTCAAATCGCTCTCTGTATTCTCCTT
CAAGTAATTGGAGTACGAATAAATCAGATGTTACCCCCAATGACGAGTTA
ATTCCGAATATTTTATCTAAATCTATTTATGAAGATCTTGATGAAAACAT
TAAAAAGGTTTCAAATCTAAAAAAAGAAATTATTGAAAAGATCACAGATT
GGAATAATTTCAACAGAGAAAAGACAAGCTTTAAAAACTGGATGGATAAT
GAAATGCTGAAATTTTCCAGTGTTCTGTACACTGAGCCAGGAATTTCAAA
TTTTGCATCCTTACAAAAGAGTAAATTAAAAGAGATTCAAGAGGAAATGA
ATTACAAGAAACAGGCTCTTTTGAACCTTAATACTCACTTCAAAGAATTA
ACTTCGAATGTTTCTGGAGCTGCTGATTTGGTTTTGAAGAATTTAAATCA
AGACTTTGATGAGACTGAGAAAAAAATTAGTAAGCTTTTAAATAGAGAAG
ACAAAGGAGTTGAAGCCGATTTTACGGACGAGGAATCAAATATGGATATA
ATCCAAGAGAGGAAAGTTCCAAAATTAAATTTAAAAAATCTAGAAAGTCC
TCAGTTGTTTAGATATGAATCGCCAGAAAATTTAAATCGTTTTACCCAAA
CAAATATTTCTAAAGACGAAACAGATTATAAATTCAAGAAAACGAATTTT
AGTAGCCAAACACCAGGAACCAAAACTACACAGACTAATTTTAATGATAT
GAGCAATTTTGGTACTCAAACTAATGACAAGTATCAGAAAAAACGAGAAA
GAAAACTCGAAAGCGAATTGCAGATATTGAATTCTTTAAAGAATATGAAT
TCTGAATTCGAACGTTCTAAACCATTTCCTGAATATAATAACATTTCAAG
TGTCCCAATGTCAGCAAAACCAAGATCTTCAGCTTTGGAATCAGTTCGAA
GAAATATATATCCATCATATTCGCAAACTCGTCAAACTACATGTTCACCA
TTGATGCAAAGAATAGAAAACGGTTACAAATCCCGCAGACCTCTGTCTCC
GAGTACACACTCTCAGAACTTATTAAATAAGCCATTATCTCAAAATTCCA
ATTTAAATCTGACAAAGTCTTCTGGTGACAATTTGGACGATTTAATTCCA
ACAAAGAACAAGTGGGTAGATTTAGAAATAAATGCGCAGCTGATAAATAG
TTCCTTGAAATCTTATCCATTTGATGTCCCAAGCCGAGAATTTCATATTG
ATTACAATACTAAGTTTGAAGGTTTTCCTGTGTCTTTAAGAAAGAAATCT
CCCCAGAGACGTAGTTCAGGAAGTCCAAAGCGAAACAGAAGTAAAAGTGC
AAGAAATTCTCGAATTACCGATAGTATAAATCGTATTACCGAGGATGCAA
ACGAATTGCGTAACTTGTCTCAAAAATTAAGATCAGTTAAATAATCACGT
TCTCTTACAATTTATAATTTTTATCATGTTTTTGTGGTTTTTTTTAAATG
TTTCTTAGAGAAATTATGATTTTACTATAGTTTGATTTGAATTATATATT
TTTATATACACGTAACATTTGTTTAAACAAATAATTCGTGATTGA
back to top

protein sequence of SMED30021613-orf-1

>SMED30021613-orf-1 ID=SMED30021613-orf-1|Name=SMED30021613-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=4583bp
MDRKDTVVKKGVLLKDEQEKMQKKTFTKWMNSYLCQKKPPIIIKDLMKDL
SDGLLLLDLLEILTKTTLKKEKPKNMQKIHCLSNIRTALEFMENDKKIKL
VNINPSDVVDGKPAIVLGLVWTAILHFQIEEQEEFLLQALGMANDPNAKV
KGQAKKGLMAWTNNALSDKYGLNIKDFGESWCDGRAFNALVHNIDPTLVN
MEEIEKGTNKERLENAFNIAENELGIPKLLDSEDVDVEKPDEKSIMTYVA
QFLKSYPEGKKPENISEEITAEINSGLMSMVQPPNELDIVKDFNDKVDKN
FENLNSKNNYDIFADLMSQRDDMKLLLDKMSTDNYLDLDANDVRQVIGDF
DKTEMKLNEWQWDLDKVLPGILGSEIGSWLQDAEESLMEPFPNVHDKTFN
DKVLQKLKEHESIFNKKNDVLAKFREVLQNPPANISPKQLEAMKTRMENV
CKAEGPVREKLNIFGIQANLKNKAQKWAVDLNSWDSPIQSKQDLLDKIEQ
FNISMENGTSMDKFTSQLDELVKRKVKFCKENPVLDEDLLNFINKAINEC
EEENDILPEKFESTLMKLENLSSEWDEISDGEQKIETFSRRLSKALQLDD
FQQQRSLVDQLPEVLDLLNDVKYKIQNDLTPHCSEKLLYTMKENLNELEI
NLKELGAQVVDKVEKQKQKIEQQQQAARDTLIDEIFSCGQANVDSIKQWM
NDLDQCMETPINGSSADLQYVLSKLKDLDKESPKIQKLIDQGYQKVDDLE
NENSPEKAQELKESLNEFQKKFKRYTEKEIPKNLQNLKTFIDTLNIVEND
INDLEKTMKEGEFIKNHLDDLEFSNGTDDIIFKEQEFLEKENEISKSLIK
DKDLLKHIKKLVESTDLKIDLKPLEKRIFDSENVLQDLLTNAKENLTANN
QCNEACTSADQSLECLLDQIEKNSSINNDEEGQKTKLKNIQNFEEEIEEV
EKQINAAVALRNNLLSNLNKSNLDKIDNSISKIKQKTVSIKENLQKTKVN
LSNNLNDWQDFKQTKDLMTKCFDDIIDDLKESHQKRKGVHGENLTDKADL
LEENKERLENLIKQEDKLKDLNKKALKLGLEKPINEVKNLKDQILKQKAN
LEEEIQQNEKDLENHQQFNNDIQSLHDWLAQTELLTNQIQNLPNTKEGLI
EKQKLLEDLNSLKSTGDKKLKELKNLQKVVLNETAPDEKENINIQLNAEI
EKFNEVFVNLDKQGGINETIEKIEDLGEKSDQISENINEINKRLEKCLNL
PSNTLNEKEKLAKELNNTIRLVDQQLAQINDLKSQCGSLEHSAALEDLLN
KLESLEEHCFEIKTKIEERIKEVDSDIKFQSALEEKLNDLSEIMNEVEIE
FDYSKPKESSEAAINESLSQLQKLKAQHEPGKNILKTMIKLRNEFNAPEQ
CVTACNDLEQKYFDIEDDIKNLQKELEMKTTVWQKFNALKADLDKTCNTA
ILEIGNEHKKRSGIHGGDCEDKFNLLEDKKKILSNMTNKDPQVDALIEVS
GKLGFDKALFDAQNIKRKYLKLIDDLQQEISQNEIDLDNHKKFDQSLFEF
EDWMKNTEKIVKQIANLPNDKNGLLEKQNRLEEMKTLKSNGNEMIKNIKH
LQNVVINETAGNFKTTLNEKVKNKIENFERVFGDLDQETDNIKETIDKLK
VIDEKSNEMERNIREIENTINKCSIVPSESVGDKEKLGKIYRSLEHDIEQ
HLIDLDSLKQQCNALNATTANSAMINKLNKMTDECKSMKADISQLFSKNV
SDLKNLKTFQDKMNEFNESMDRIETEIEKCSPNGCNEAAIKDNIKKLKKF
RSLHENSKDVLTDLLRIGFELSGLSQISEASDQAEQKYSDVEDEITKLES
KLEMQKNDWSNFNSDKNDLEKWLNEITKKVENLEQISDGIHGGKLSEKEK
VLDSHQKLLQEALNREADIKLFLDRSTPLFSAVNQDSPKRVTNTLCKKYE
KLLETLTNRIQKNEEDINLHENYAKQIDNFKEENNIIIKRMNEEIASLPN
TKEGLKRKVDLLGNLKDLYNQRKMILVNLENLKNAVIDHSSSNYYSNLEQ
EWDQIIDSFEKSFNPSIENQSKLLLAVQQIEKTESICQDLQHQLENLERR
LQEAVDQHISSLNDIDMKLETLKELRYELRDLQTPINDVQRKHCQNPSDV
ELIQERIEQIAKQHKVLNESISQNINETENHHKQLCNLTTSLNNFKTWLD
YSSSQIEEKGKPGNLEMNNLKKNLTSLKQLADSISCQCDDQLSKIREHML
KIHKFSSEKLKDDLQKELNIMNGNVNSLKDKIQTTTEHEINRINEVEKID
ILKNEIKENFLKFESQININFKNFDLNEKQNYITQLRNVQNLMKENEKKI
EFLETSIQNIIKHSHGKMLDINANKIINKRNSIKIQLNELINKLTQMSDE
QMQFTDLLNDTKICIENQHNEINIEISFDNNIDQDKNNLNIVNEYLNINS
KLSENKIEILRQKFKTVSRYVNEQENLKLEAEVDKLEKKFHETIELSKDN
QSALLLNINNVTEADLFYERTIKWLNSKVSELEQFYVKPETLREKENRLR
ILNKIKFETEENTSMIKRQMDNLPVLLTVQNKNVDNKINTLKIQLKEIFE
RVSEEFNIHEEFSENFHSLINNMESCKYQLIQCVESIEFDKENKIIKKNS
EEIFTENISNNNKQLNKVNELYQTVKYQTSPGGIAILDTEMQLAQTLSKD
IDELFLKLKTKEQKFENLQNKFESLINSIENSLTENEDEMKKLSELKRDL
KQKASTKQHLVENILPEIHGTQSLIDELKEVCYEYLSEIIDRNKSRRAND
IFYRFSELSRLAESSIKKVQKACEDHELFDKFYKEAVEYFNEINDEIEFV
SNLLDVETNTFHELTKLTAKLSSYETQRTEFFQSMHNVESQGQITMELSN
KEGRDLVRRQIKEINEHCNKLVDKINSTKIKLDRNIDNYNATKEKLDKIN
EFTNEINDRLNIIKSEVRDFNEKNQSIIWLGNCKDECDSNLKNLKLIKSS
SVFPDLNKGIETIELKLEKLNKKIKDLTSNLKTELRRINEFENEKLTINK
WLESLEKQYETLITSFSISDNLDLKINLIKNFETTSIDQVKISKFEEIQN
QLQIQKTIVTNLMYMNQEFEVKDQIKKVNLFHEMIKRSIAIFEETSTKIN
ENKTIINKIEKWIINAKSILQTKQNSEHNLKELKINVENLFEEFSKLNGE
IDIEKFVITSVLSSENVEPFFNILSNNLSNINQLKSEMEIISKDIERRLK
QIQIEEEIQNKFLENSERFYLFANEINVNIDEFDLQSINNFNQIDTITNK
IIEIQKLFENIKETSVKQINQTKDLQIENEVKLARKKLSELNEKYENLFQ
VVQEKVKQVDAFSKLETDLENWLKYADNYMERYSENKPYSTHLQCETNLE
NMKEFFHEFEDKEYLLDKLKQMHCANNFPYIEKIEILTESFKKLKTEIEN
QINHLNKKTSGVLEMAESMESFNQYLRQDYLEYEKLEEIFNKCKNQFNQT
AMNKLRLCLNDNAFSIRQETLWNLLQNVRKFSKLVERSRIDIAGNLLDQK
ETAENELETLKANWSKLSKRINELNNLKMDLDKALEHFNIWLNNSCKWFV
NITETRKKVFESNETLQMKNNLQALKDDITEHKVDLSRLQTFVDSLMKIC
NDETFQKTLDEITKEYNVLFNKCQNECDKCDHLIKLMTKYEISRADVLHW
IEASTQTLLKCSDYTLKQSQMKSKLLMIDNLEKELENYGQSKFVEAIQDG
EELLGELAGMPMQIVQQQMADLKSDWMEISRQLNQLSSNLRNTTSRSEAF
KEMSNRLSNWLDDIEHTGLMDLSHIEHQCEIPFESGNSSSKHDRAKTLLT
ELNRHKQDFLQLANLATELANPSFDIENSQIQNRYIRLSNNLKDKIEKLN
KQQADYDQIKQDIEEMEKWVFQTSIRIINENAEQGKTTNNTIQEIETLIK
HSNEIIANILSQEPEIVKIGQAVDSLINISNNKNSDKEKELQDDLSKLIE
NFNNLKSSSIHKRDHLKDSVKKWDTYQDFLQSTKLFLDNELPNWWRERNQ
DQMKSAYSNFNNEPILKEILDMDNKLNGLKTTMELEAKACDGILPTIAIT
ASRSQTPNFKSNRSLYSPSSNWSTNKSDVTPNDELIPNILSKSIYEDLDE
NIKKVSNLKKEIIEKITDWNNFNREKTSFKNWMDNEMLKFSSVLYTEPGI
SNFASLQKSKLKEIQEEMNYKKQALLNLNTHFKELTSNVSGAADLVLKNL
NQDFDETEKKISKLLNREDKGVEADFTDEESNMDIIQERKVPKLNLKNLE
SPQLFRYESPENLNRFTQTNISKDETDYKFKKTNFSSQTPGTKTTQTNFN
DMSNFGTQTNDKYQKKRERKLESELQILNSLKNMNSEFERSKPFPEYNNI
SSVPMSAKPRSSALESVRRNIYPSYSQTRQTTCSPLMQRIENGYKSRRPL
SPSTHSQNLLNKPLSQNSNLNLTKSSGDNLDDLIPTKNKWVDLEINAQLI
NSSLKSYPFDVPSREFHIDYNTKFEGFPVSLRKKSPQRRSSGSPKRNRSK
SARNSRITDSINRITEDANELRNLSQKLRSVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036872CH_dom_sf
IPR001715CH-domain
IPR018159Spectrin/alpha-actinin
IPR001589Actinin_actin-bd_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003723RNA binding
GO:0003779actin binding
GO:0005521lamin binding
GO:0019899enzyme binding
GO:0042802identical protein binding
GO:0042803protein homodimerization activity
GO:0051015actin filament binding
Vocabulary: cellular component
TermDefinition
GO:0000932P-body
GO:0005634nucleus
GO:0005635nuclear envelope
GO:0005640nuclear outer membrane
GO:0005654nucleoplasm
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005794Golgi apparatus
GO:0005856cytoskeleton
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030017sarcomere
GO:0031965nuclear membrane
GO:0034993LINC complex
GO:0045211postsynaptic membrane
Vocabulary: biological process
TermDefinition
GO:0006997nucleus organization
GO:0007030Golgi organization
GO:0007283spermatogenesis
GO:0030154cell differentiation
GO:0042692muscle cell differentiation
GO:0090286cytoskeletal anchoring at nuclear membrane
GO:0090292nuclear matrix anchoring at nuclear membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 933..967
NoneNo IPR availableCOILSCoilCoilcoord: 2261..2281
NoneNo IPR availableCOILSCoilCoilcoord: 2329..2356
NoneNo IPR availableCOILSCoilCoilcoord: 2080..2114
NoneNo IPR availableCOILSCoilCoilcoord: 3166..3200
NoneNo IPR availableCOILSCoilCoilcoord: 4145..4165
NoneNo IPR availableCOILSCoilCoilcoord: 1288..1315
NoneNo IPR availableCOILSCoilCoilcoord: 1041..1081
NoneNo IPR availableCOILSCoilCoilcoord: 3878..3919
NoneNo IPR availableCOILSCoilCoilcoord: 787..807
NoneNo IPR availableCOILSCoilCoilcoord: 1824..1858
NoneNo IPR availableCOILSCoilCoilcoord: 1084..1118
NoneNo IPR availableCOILSCoilCoilcoord: 758..778
NoneNo IPR availableCOILSCoilCoilcoord: 4247..4267
NoneNo IPR availableCOILSCoilCoilcoord: 1255..1285
NoneNo IPR availableCOILSCoilCoilcoord: 3988..4008
NoneNo IPR availableCOILSCoilCoilcoord: 2373..2400
NoneNo IPR availableCOILSCoilCoilcoord: 2217..2237
NoneNo IPR availableCOILSCoilCoilcoord: 1405..1425
NoneNo IPR availableCOILSCoilCoilcoord: 2469..2496
NoneNo IPR availableCOILSCoilCoilcoord: 1357..1377
NoneNo IPR availableCOILSCoilCoilcoord: 2542..2562
NoneNo IPR availableCOILSCoilCoilcoord: 3231..3255
NoneNo IPR availableCOILSCoilCoilcoord: 2581..2601
NoneNo IPR availableCOILSCoilCoilcoord: 3324..3358
NoneNo IPR availableCOILSCoilCoilcoord: 3434..3454
NoneNo IPR availableCOILSCoilCoilcoord: 2015..2035
NoneNo IPR availableCOILSCoilCoilcoord: 2694..2763
NoneNo IPR availableCOILSCoilCoilcoord: 1756..1776
NoneNo IPR availableCOILSCoilCoilcoord: 1216..1243
NoneNo IPR availableCOILSCoilCoilcoord: 1516..1536
NoneNo IPR availableCOILSCoilCoilcoord: 3010..3044
NoneNo IPR availableCOILSCoilCoilcoord: 1330..1350
NoneNo IPR availableCOILSCoilCoilcoord: 638..683
NoneNo IPR availableCOILSCoilCoilcoord: 1946..1973
NoneNo IPR availableCOILSCoilCoilcoord: 2150..2170
NoneNo IPR availableCOILSCoilCoilcoord: 3543..3577
NoneNo IPR availableCOILSCoilCoilcoord: 3721..3741
NoneNo IPR availableCOILSCoilCoilcoord: 1895..1915
NoneNo IPR availableCOILSCoilCoilcoord: 1988..2008
NoneNo IPR availableCOILSCoilCoilcoord: 1866..1886
NoneNo IPR availableCOILSCoilCoilcoord: 1618..1672
NoneNo IPR availableCOILSCoilCoilcoord: 1691..1718
NoneNo IPR availableCOILSCoilCoilcoord: 4561..4581
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 4529..4564
NoneNo IPR availablePANTHERPTHR47535FAMILY NOT NAMEDcoord: 3292..4267
coord: 1458..1979
coord: 16..452
coord: 2190..3261
coord: 499..1424
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 3747..3874
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1112..1207
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 3879..4017
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1540..1643
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1595..1743
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 691..774
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1825..1962
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 1752..1853
NoneNo IPR availableSUPERFAMILYSSF46966Spectrin repeatcoord: 911..1011
IPR001715Calponin homology domainSMARTSM00033ch_5coord: 22..126
e-value: 3.3E-21
score: 86.4
coord: 154..252
e-value: 8.2E-17
score: 71.8
IPR001715Calponin homology domainPFAMPF00307CHcoord: 154..256
e-value: 1.1E-19
score: 70.6
coord: 21..128
e-value: 1.6E-22
score: 79.8
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 152..257
score: 23.331
IPR001715Calponin homology domainPROSITEPS50021CHcoord: 20..128
score: 24.678
IPR001715Calponin homology domainCDDcd00014CHcoord: 154..252
e-value: 2.28951E-16
score: 75.8103
IPR018159Spectrin/alpha-actininSMARTSM00150SPEC_4coord: 4170..4273
e-value: 4.5
score: 3.1
coord: 2837..2933
e-value: 1.6
score: 8.1
coord: 1757..1853
e-value: 2.7
score: 5.7
coord: 3579..3681
e-value: 2.3
score: 6.3
coord: 3907..4017
e-value: 1.3
score: 9.3
coord: 1541..1647
e-value: 0.95
score: 10.6
coord: 3798..3900
e-value: 4.9
score: 2.8
coord: 900..995
e-value: 3.7
score: 4.1
coord: 1860..1964
e-value: 8.0
score: 0.4
coord: 1116..1245
e-value: 0.74
score: 11.8
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 143..260
e-value: 2.9E-38
score: 132.3
IPR036872CH domain superfamilyGENE3DG3DSA:1.10.418.10coord: 3..132
e-value: 2.3E-36
score: 126.4
IPR036872CH domain superfamilySUPERFAMILYSSF47576Calponin-homology domain, CH-domaincoord: 10..253
IPR001589Actinin-type actin-binding domain, conserved sitePROSITEPS00019ACTININ_1coord: 22..31