Cyclin-dependent kinase 2-associated protein 2
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30021597 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 6
Homology
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Human
Match: CDK2AP2 (cyclin dependent kinase 2 associated protein 2 [Source:HGNC Symbol;Acc:HGNC:30833]) HSP 1 Score: 67.0106 bits (162), Expect = 1.491e-15 Identity = 32/60 (53.33%), Postives = 43/60 (71.67%), Query Frame = 1 Query: 28 QPPVGENT-SKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELER 204 +PP + + S Y +LL VI+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER Sbjct: 63 KPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETER 122
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Human
Match: CDK2AP1 (cyclin dependent kinase 2 associated protein 1 [Source:HGNC Symbol;Acc:HGNC:14002]) HSP 1 Score: 64.3142 bits (155), Expect = 5.638e-15 Identity = 31/55 (56.36%), Postives = 40/55 (72.73%), Query Frame = 1 Query: 52 SKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 SKY LL +I+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER +S Sbjct: 33 SKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS 87
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Human
Match: CDK2AP1 (cyclin dependent kinase 2 associated protein 1 [Source:HGNC Symbol;Acc:HGNC:14002]) HSP 1 Score: 64.3142 bits (155), Expect = 5.638e-15 Identity = 31/55 (56.36%), Postives = 40/55 (72.73%), Query Frame = 1 Query: 52 SKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 SKY LL +I+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER +S Sbjct: 33 SKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS 87
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Human
Match: CDK2AP1 (cyclin dependent kinase 2 associated protein 1 [Source:HGNC Symbol;Acc:HGNC:14002]) HSP 1 Score: 64.3142 bits (155), Expect = 5.638e-15 Identity = 31/55 (56.36%), Postives = 40/55 (72.73%), Query Frame = 1 Query: 52 SKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 SKY LL +I+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER +S Sbjct: 33 SKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS 87
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Human
Match: CDK2AP1 (cyclin dependent kinase 2 associated protein 1 [Source:HGNC Symbol;Acc:HGNC:14002]) HSP 1 Score: 64.3142 bits (155), Expect = 5.638e-15 Identity = 31/55 (56.36%), Postives = 40/55 (72.73%), Query Frame = 1 Query: 52 SKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 SKY LL +I+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER +S Sbjct: 33 SKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS 87
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Celegans
Match: Y43F4B.10 (pep chromosome:WBcel235:III:13314011:13314721:1 gene:WBGene00012807.1 transcript:Y43F4B.10.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y43F4B.10) HSP 1 Score: 65.0846 bits (157), Expect = 1.981e-15 Identity = 28/67 (41.79%), Postives = 43/67 (64.18%), Query Frame = 1 Query: 1 MNNSIPVLPQPPVGENTSKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELE 201 + I ++P + E T Y LL++I+EIG+D++P Y NK+ ERLK+NI A++L+R C E E Sbjct: 7 LQTLISIVPNLQMQEGTPYYEVLLKLIEEIGKDVRPTYTFNKLTCERLKRNIQAAKVLIRACQQEAE 73
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Celegans
Match: Y43F4B.10 (pep chromosome:WBcel235:III:13314068:13314721:1 gene:WBGene00012807.1 transcript:Y43F4B.10.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y43F4B.10) HSP 1 Score: 65.0846 bits (157), Expect = 1.981e-15 Identity = 28/67 (41.79%), Postives = 43/67 (64.18%), Query Frame = 1 Query: 1 MNNSIPVLPQPPVGENTSKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELE 201 + I ++P + E T Y LL++I+EIG+D++P Y NK+ ERLK+NI A++L+R C E E Sbjct: 7 LQTLISIVPNLQMQEGTPYYEVLLKLIEEIGKDVRPTYTFNKLTCERLKRNIQAAKVLIRACQQEAE 73
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Fly
Match: CDK2AP1 (gene:FBgn0030269 transcript:FBtr0073437) HSP 1 Score: 70.0922 bits (170), Expect = 4.544e-16 Identity = 34/68 (50.00%), Postives = 44/68 (64.71%), Query Frame = 1 Query: 10 SIPVLPQPPVGENTSKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMK 213 S LP G +KY LL VI+E+GRDI+P Y G++ ++ERLK+ I ARILVREC E ER + Sbjct: 213 STASLPSVGPGNGLTKYAQLLAVIEEMGRDIRPTYTGSRSSTERLKRGIVHARILVRECLMETERAAR 280
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Fly
Match: CDK2AP1 (gene:FBgn0030269 transcript:FBtr0330387) HSP 1 Score: 70.0922 bits (170), Expect = 6.151e-16 Identity = 34/69 (49.28%), Postives = 44/69 (63.77%), Query Frame = 1 Query: 7 NSIPVLPQPPVGENTSKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMK 213 S LP G +KY LL VI+E+GRDI+P Y G++ ++ERLK+ I ARILVREC E ER + Sbjct: 212 TSTASLPSVGPGNGLTKYAQLLAVIEEMGRDIRPTYTGSRSSTERLKRGIVHARILVRECLMETERAAR 280
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Zebrafish
Match: CDK2AP1 (cyclin dependent kinase 2 associated protein 1 [Source:NCBI gene;Acc:108191561]) HSP 1 Score: 66.6254 bits (161), Expect = 7.352e-16 Identity = 35/67 (52.24%), Postives = 44/67 (65.67%), Query Frame = 1 Query: 22 LPQPPVGENT--SKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 PQ P G SKY LL +I+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER +S Sbjct: 42 FPQGPNGGQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS 108
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Zebrafish
Match: CDK2AP1 (cyclin dependent kinase 2 associated protein 1 [Source:NCBI gene;Acc:108191561]) HSP 1 Score: 66.6254 bits (161), Expect = 9.214e-16 Identity = 35/67 (52.24%), Postives = 44/67 (65.67%), Query Frame = 1 Query: 22 LPQPPVGENT--SKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 PQ P G SKY LL +I+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER +S Sbjct: 50 FPQGPNGGQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS 116
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Zebrafish
Match: CDK2AP1 (cyclin dependent kinase 2 associated protein 1 [Source:NCBI gene;Acc:108191561]) HSP 1 Score: 66.2402 bits (160), Expect = 1.302e-15 Identity = 35/67 (52.24%), Postives = 44/67 (65.67%), Query Frame = 1 Query: 22 LPQPPVGENT--SKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 PQ P G SKY LL +I+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER +S Sbjct: 49 FPQGPNGGQVPQSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS 115
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Zebrafish
Match: cdk2ap2 (cyclin-dependent kinase 2 associated protein 2 [Source:ZFIN;Acc:ZDB-GENE-040718-35]) HSP 1 Score: 64.3142 bits (155), Expect = 6.741e-15 Identity = 32/63 (50.79%), Postives = 41/63 (65.08%), Query Frame = 1 Query: 28 QPPVGENTSKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 QP S Y+ LL VI+E+ R+I+P YAG+K A ERLK+ I AR LVREC E ER ++ Sbjct: 49 QPVKVSQGSTYSELLSVIEEMSREIRPTYAGSKSAMERLKRGIIHARALVRECLAETERSART 111
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Xenopus
Match: cldn15.1 (claudin 15, gene 1 [Source:Xenbase;Acc:XB-GENE-994817]) HSP 1 Score: 65.4698 bits (158), Expect = 4.773e-15 Identity = 32/61 (52.46%), Postives = 44/61 (72.13%), Query Frame = 1 Query: 28 QPPVGENTSK--YNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELER 204 +P V + S+ Y++LL VI+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER Sbjct: 57 KPAVSQAVSQGTYSDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETER 117
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Xenopus
Match: sult4a1 (sulfotransferase family 4A member 1 [Source:Xenbase;Acc:XB-GENE-979812]) HSP 1 Score: 64.6994 bits (156), Expect = 9.755e-15 Identity = 31/55 (56.36%), Postives = 40/55 (72.73%), Query Frame = 1 Query: 52 SKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 SKY LL +I+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER +S Sbjct: 66 SKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS 120
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Mouse
Match: Cdk2ap2 (CDK2-associated protein 2 [Source:MGI Symbol;Acc:MGI:1098779]) HSP 1 Score: 67.0106 bits (162), Expect = 1.094e-15 Identity = 32/60 (53.33%), Postives = 43/60 (71.67%), Query Frame = 1 Query: 28 QPPVGENT-SKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELER 204 +PP + + S Y +LL VI+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER Sbjct: 64 KPPGSQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETER 123
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Mouse
Match: Cdk2ap2 (CDK2-associated protein 2 [Source:MGI Symbol;Acc:MGI:1098779]) HSP 1 Score: 67.0106 bits (162), Expect = 1.094e-15 Identity = 32/60 (53.33%), Postives = 43/60 (71.67%), Query Frame = 1 Query: 28 QPPVGENT-SKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELER 204 +PP + + S Y +LL VI+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER Sbjct: 64 KPPGSQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETER 123
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Mouse
Match: Cdk2ap1 (CDK2 (cyclin-dependent kinase 2)-associated protein 1 [Source:MGI Symbol;Acc:MGI:1202069]) HSP 1 Score: 65.0846 bits (157), Expect = 2.291e-15 Identity = 31/55 (56.36%), Postives = 40/55 (72.73%), Query Frame = 1 Query: 52 SKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 SKY LL +I+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER +S Sbjct: 33 SKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARSLVRECLAETERNARS 87
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Mouse
Match: Cdk2ap1 (CDK2 (cyclin-dependent kinase 2)-associated protein 1 [Source:MGI Symbol;Acc:MGI:1202069]) HSP 1 Score: 65.0846 bits (157), Expect = 2.291e-15 Identity = 31/55 (56.36%), Postives = 40/55 (72.73%), Query Frame = 1 Query: 52 SKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 SKY LL +I+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER +S Sbjct: 33 SKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARSLVRECLAETERNARS 87
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Mouse
Match: Cdk2ap1 (CDK2 (cyclin-dependent kinase 2)-associated protein 1 [Source:MGI Symbol;Acc:MGI:1202069]) HSP 1 Score: 65.0846 bits (157), Expect = 2.291e-15 Identity = 31/55 (56.36%), Postives = 40/55 (72.73%), Query Frame = 1 Query: 52 SKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 SKY LL +I+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER +S Sbjct: 33 SKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARSLVRECLAETERNARS 87
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. UniProt/SwissProt
Match: sp|O75956|CDKA2_HUMAN (Cyclin-dependent kinase 2-associated protein 2 OS=Homo sapiens OX=9606 GN=CDK2AP2 PE=1 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 7.158e-15 Identity = 32/60 (53.33%), Postives = 43/60 (71.67%), Query Frame = 1 Query: 28 QPPVGENT-SKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELER 204 +PP + + S Y +LL VI+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER Sbjct: 63 KPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETER 122
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. UniProt/SwissProt
Match: sp|Q58CN7|CDKA2_BOVIN (Cyclin-dependent kinase 2-associated protein 2 OS=Bos taurus OX=9913 GN=CDK2AP2 PE=2 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 7.168e-15 Identity = 32/60 (53.33%), Postives = 43/60 (71.67%), Query Frame = 1 Query: 28 QPPVGENT-SKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELER 204 +PP + + S Y +LL VI+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER Sbjct: 64 KPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETER 123
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. UniProt/SwissProt
Match: sp|Q9CPY4|CDKA2_MOUSE (Cyclin-dependent kinase 2-associated protein 2 OS=Mus musculus OX=10090 GN=Cdk2ap2 PE=1 SV=1) HSP 1 Score: 67.0106 bits (162), Expect = 7.650e-15 Identity = 32/60 (53.33%), Postives = 43/60 (71.67%), Query Frame = 1 Query: 28 QPPVGENT-SKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELER 204 +PP + + S Y +LL VI+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER Sbjct: 64 KPPGSQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETER 123
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. UniProt/SwissProt
Match: sp|O35207|CDKA1_MOUSE (Cyclin-dependent kinase 2-associated protein 1 OS=Mus musculus OX=10090 GN=Cdk2ap1 PE=1 SV=2) HSP 1 Score: 65.4698 bits (158), Expect = 2.340e-14 Identity = 31/55 (56.36%), Postives = 40/55 (72.73%), Query Frame = 1 Query: 52 SKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 SKY LL +I+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER +S Sbjct: 60 SKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARSLVRECLAETERNARS 114
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. UniProt/SwissProt
Match: sp|P49119|CDKA1_MESAU (Cyclin-dependent kinase 2-associated protein 1 OS=Mesocricetus auratus OX=10036 GN=CDK2AP1 PE=2 SV=1) HSP 1 Score: 65.4698 bits (158), Expect = 2.340e-14 Identity = 31/55 (56.36%), Postives = 40/55 (72.73%), Query Frame = 1 Query: 52 SKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 SKY LL +I+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER +S Sbjct: 60 SKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARSLVRECLAETERNARS 114
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. TrEMBL
Match: Q5BSD1 (Cyclin-dependent kinase 2-associated protein OS=Schistosoma japonicum OX=6182 GN=EWB00_011294 PE=2 SV=1) HSP 1 Score: 99.7525 bits (247), Expect = 6.492e-26 Identity = 50/72 (69.44%), Postives = 59/72 (81.94%), Query Frame = 1 Query: 4 NNSIPV-LPQPPVGENTSKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 N SIPV P P ++ +KY++LLQVI+E+GRDIKP YA NK A+ERLKKNIHTARILVREC ELERVMK+ Sbjct: 4 NTSIPVNYPMMPPMDDLNKYSHLLQVIEEMGRDIKPTYANNKNAAERLKKNIHTARILVRECVSELERVMKA 75
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. TrEMBL
Match: C1L483 (Cyclin-dependent kinase 2-associated protein 2 OS=Schistosoma japonicum OX=6182 PE=2 SV=1) HSP 1 Score: 99.7525 bits (247), Expect = 6.528e-26 Identity = 50/72 (69.44%), Postives = 59/72 (81.94%), Query Frame = 1 Query: 4 NNSIPV-LPQPPVGENTSKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 N SIPV P P ++ +KY++LLQVI+E+GRDIKP YA NK A+ERLKKNIHTARILVREC ELERVMK+ Sbjct: 5 NTSIPVNYPMMPPMDDLNKYSHLLQVIEEMGRDIKPTYANNKNAAERLKKNIHTARILVRECVSELERVMKA 76
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. TrEMBL
Match: A0A183JIP0 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS2565 PE=4 SV=1) HSP 1 Score: 98.9821 bits (245), Expect = 1.430e-25 Identity = 50/72 (69.44%), Postives = 58/72 (80.56%), Query Frame = 1 Query: 4 NNSIPV-LPQPPVGENTSKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 N SIPV P P ++ +KY +LLQVI+E+GRDIKP YA NK A+ERLKKNIHTARILVREC ELERVMK+ Sbjct: 4 NTSIPVSYPMMPPMDDLNKYAHLLQVIEEMGRDIKPTYANNKNAAERLKKNIHTARILVRECVSELERVMKA 75
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. TrEMBL
Match: A0A183M052 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS9427 PE=4 SV=1) HSP 1 Score: 98.9821 bits (245), Expect = 1.430e-25 Identity = 50/72 (69.44%), Postives = 58/72 (80.56%), Query Frame = 1 Query: 4 NNSIPV-LPQPPVGENTSKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 N SIPV P P ++ +KY +LLQVI+E+GRDIKP YA NK A+ERLKKNIHTARILVREC ELERVMK+ Sbjct: 4 NTSIPVSYPMMPPMDDLNKYAHLLQVIEEMGRDIKPTYANNKNAAERLKKNIHTARILVRECVSELERVMKA 75
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. TrEMBL
Match: A0A5K4FCR2 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1) HSP 1 Score: 98.5969 bits (244), Expect = 1.579e-25 Identity = 50/72 (69.44%), Postives = 58/72 (80.56%), Query Frame = 1 Query: 4 NNSIPV-LPQPPVGENTSKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 N SIPV P P ++ +KY +LLQVI+E+GRDIKP YA NK A+ERLKKNIHTARILVREC ELERVMK+ Sbjct: 4 NTSIPVNYPMMPPMDDLNKYAHLLQVIEEMGRDIKPTYANNKNAAERLKKNIHTARILVRECVSELERVMKA 75
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Cavefish
Match: CDK2AP1 (cyclin-dependent kinase 2-associated protein 1-like [Source:NCBI gene;Acc:103046776]) HSP 1 Score: 65.4698 bits (158), Expect = 2.229e-15 Identity = 34/63 (53.97%), Postives = 43/63 (68.25%), Query Frame = 1 Query: 28 QPPVGENTSKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 QPP SKY LL +I+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER +S Sbjct: 61 QPP----QSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS 119
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000039422.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000873.1:121163:125488:1 gene:ENSAMXG00000035299.1 transcript:ENSAMXT00000039422.1 gene_biotype:protein_coding transcript_biotype:protein_coding) HSP 1 Score: 63.929 bits (154), Expect = 2.750e-15 Identity = 30/54 (55.56%), Postives = 41/54 (75.93%), Query Frame = 1 Query: 55 KYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 KY+ LL +I+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER ++S Sbjct: 16 KYSELLGIIEELGKEIRPTYAGSKTAMERLKRGIIHARGLVRECLAETERNVRS 69
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Cavefish
Match: cdk2ap2 (cyclin-dependent kinase 2-associated protein 2-like [Source:NCBI gene;Acc:103032531]) HSP 1 Score: 64.3142 bits (155), Expect = 6.165e-15 Identity = 32/63 (50.79%), Postives = 41/63 (65.08%), Query Frame = 1 Query: 28 QPPVGENTSKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 QP S Y+ LL VI+E+ R+I+P YAG+K A ERLK+ I AR LVREC E ER ++ Sbjct: 49 QPVKVSQGSTYSELLSVIEEMSREIRPTYAGSKSAMERLKRGIIHARALVRECLAETERSART 111
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Cavefish
Match: CDK2AP1 (cyclin-dependent kinase 2-associated protein 1-like [Source:NCBI gene;Acc:103046776]) HSP 1 Score: 46.9802 bits (110), Expect = 3.220e-8 Identity = 22/42 (52.38%), Postives = 30/42 (71.43%), Query Frame = 1 Query: 28 QPPVGENTSKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKN 153 QPP SKY LL +I+E+G++I+P YAG+K A ERLK+ Sbjct: 61 QPP----QSKYAELLAIIEELGKEIRPTYAGSKSAMERLKRG 98
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Nematostella
Match: EDO47489 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLV5]) HSP 1 Score: 69.3218 bits (168), Expect = 6.903e-18 Identity = 34/56 (60.71%), Postives = 41/56 (73.21%), Query Frame = 1 Query: 46 NTSKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMK 213 + SKY LL VI+E+G+DI+P YAG+K ASERLKK I AR LVREC E ER + Sbjct: 7 SQSKYGELLAVIEELGKDIRPTYAGSKNASERLKKGIMHARALVRECLIETERCAR 62
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Medaka
Match: cdk2ap2 (cyclin dependent kinase 2 associated protein 2 [Source:NCBI gene;Acc:101168841]) HSP 1 Score: 64.6994 bits (156), Expect = 4.097e-15 Identity = 32/63 (50.79%), Postives = 41/63 (65.08%), Query Frame = 1 Query: 28 QPPVGENTSKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 QP S Y+ LL VI+E+ R+I+P YAG+K A ERLK+ I AR LVREC E ER ++ Sbjct: 49 QPVKVSQGSTYSELLSVIEEMSREIRPTYAGSKSAMERLKRGIIHARALVRECLAETERSART 111
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Medaka
Match: cdk2ap2 (cyclin dependent kinase 2 associated protein 2 [Source:NCBI gene;Acc:101168841]) HSP 1 Score: 64.6994 bits (156), Expect = 4.097e-15 Identity = 32/63 (50.79%), Postives = 41/63 (65.08%), Query Frame = 1 Query: 28 QPPVGENTSKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 QP S Y+ LL VI+E+ R+I+P YAG+K A ERLK+ I AR LVREC E ER ++ Sbjct: 49 QPVKVSQGSTYSELLSVIEEMSREIRPTYAGSKSAMERLKRGIIHARALVRECLAETERSART 111
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Medaka
Match: CDK2AP1 (cyclin dependent kinase 2 associated protein 1 [Source:NCBI gene;Acc:101170282]) HSP 1 Score: 63.1586 bits (152), Expect = 2.189e-14 Identity = 30/54 (55.56%), Postives = 39/54 (72.22%), Query Frame = 1 Query: 55 KYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 KY LL +I+E+G++I+P YAG+K A ERLK+ I AR LVREC E ER +S Sbjct: 67 KYAELLAIIEELGKEIRPTYAGSKSAMERLKRGIIHARGLVRECLAETERNARS 120
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Planmine SMEST
Match: SMESG000041391.1 (SMESG000041391.1) HSP 1 Score: 148.673 bits (374), Expect = 6.711e-49 Identity = 72/72 (100.00%), Postives = 72/72 (100.00%), Query Frame = 1 Query: 1 MNNSIPVLPQPPVGENTSKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 216 MNNSIPVLPQPPVGENTSKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS Sbjct: 1 MNNSIPVLPQPPVGENTSKYNNLLQVIDEIGRDIKPAYAGNKMASERLKKNIHTARILVRECAGELERVMKS 72 The following BLAST results are available for this feature:
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 5
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 2
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 2
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 4
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 2
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 5
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 5
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 5
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 4
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 1
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 3
BLAST of Cyclin-dependent kinase 2-associated protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 1
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30021597 ID=SMED30021597|Name=Cyclin-dependent kinase 2-associated protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=219bpback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|