Spectrin beta chain

Overview
NameSpectrin beta chain
Smed IDSMED30021590
Length (bp)7230
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Spectrin beta chain (SMED30021590) t-SNE clustered cells

Violin plots show distribution of expression levels for Spectrin beta chain (SMED30021590) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Spectrin beta chain (SMED30021590) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Spectrin beta chain (SMED30021590) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021590

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30021590SMESG000081696.1 PL05015A2H05ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30021590SMESG000081696.1 dd_Smed_v4_1122_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30021590SMESG000081696.1 dd_Smed_v4_1122_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30021590SMESG000081696.1 dd_Smed_v4_1122_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021590SMESG000081696.1 dd_Smed_v4_1122_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30021590SMESG000081696.1 dd_Smed_v4_1122_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30021590SMESG000081696.1 dd_Smed_v6_1122_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021590SMESG000081696.1 dd_Smed_v6_1122_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30021590SMESG000081696.1 dd_Smed_v6_1122_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30021590SMESG000081696.1 dd_Smed_v6_1122_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30021590SMESG000081696.1 dd_Smed_v6_1122_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021590SMESG000081696.1 dd_Smed_v6_1122_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30021590SMESG000081696.1 dd_Smed_v6_1122_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30021590SMESG000081696.1 dd_Smed_v6_1122_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021590SMESG000081696.1 dd_Smed_v4_1122_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Spectrin beta chain vs. Ensembl Human
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1444.1 bits (3737), Expect = 0.000e+0
Identity = 874/2348 (37.22%), Postives = 1378/2348 (58.69%), Query Frame = 2
Query:   56 DVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRI---DDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLI---RKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFP-SSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKV----------ETIK--QLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKT-----------------------GTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPT 6958
            D  +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL  ++    + DL+ DL+DG+ L+KLLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVNI NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI VD P+EKSI+TYV +     +++K+   + KR+G V++ AI  EK+I  YE L+ +LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+ A+  +A +L++ENY+ I  +      ++ +W+ LL+ L+ RR +L+    +Q I QE  Y+MDWM E+ + + S+D+GKHLLGVE+LL+KH ++ +DI     R+   + +++K  T        D   +  +   +   YQEL  L+ +R   L   + +W++  ++  ++ WI+E  ++  S D G DL SV RL+   R FE  +S  +   +  + + + ++ +        R+ II+     I E   NL+Q    R+ +L ++   HQ  AD +D DA +L+  ++  +SDVG     T+  +K+H++   ++      +  L  + + L  +  +  D       ++  ++++ +L   RK  L +    + +FS  +  E WI  KE+ L  +   E+L++L VI+HRF+  E +M   + +V+  NQI+R L++  HP  + I  +Q+ LN  W+Q  +L ++KK  L  A+    + LE  ET+SWI++K K++E T DL +DL G+M LQR+L  ++RD+ AIEAK+  L KEA+KL+   P     I S +  ++++WEE+K  L++R+A L  +++LQ+F +DLD F  WL + Q  +A++D+P  L EAE+  T H  +K EI  +E +Y ++   G  V+  + D QY+   +RL  L+  WN L KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +E+P   E  +A  ++ E F  ++ +N+ KI+AVV  G  L++  N  SD+I+ K + I  R    ++        L+D+  L +F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N+E +D++ ++G +LI EKP  E+ ++ K+  L   W  L +T   K+++L +AN+  +F ++   +  W+  + SQI + +     YG  L  +N  +K Q+  + Q++ ++K + +++  A+ L  Q  +  DE +  +  V+ K  E+  PL +R++ LL  K + QF RDVEDE  W+ E++   T        LQ     I++ +T   EI  H  RI D+    + ++ +    S++     L +L +LW  LI   E   +  EE    Q+Y  +A E E WMSE+E  +M E+KAKDE  A++ ++KH+ L   + +Y   V +L+     ++    P S  ++ +Q +VDK+YA L ++  E++ K+++  + + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   + + D+LI  GH ++  IA WKD +NEAWADLLELI+TR Q+L A+Y+  KF  D+ E+   I +K + +PE +G+D  +V T QR H  F  +I+ L   +      A +L   Y G+K  +I  R+ E+ + W SL    E+R   L+D  D ++F++MVR+L+ WM ++  QI A +K RDV  VEL+++NH+ +KAEID+R+++ + CI LG++L+ RKH  + ++++K  ++  K   +++ W +R E+L +ILEV+QF+R+A+VAEAWL+ QE  L++ + G +++E   L+++H   E++ A   +RF                +A ++   L+  E R +    E    PP+PEP  KV          +T K  Q+S++ + P +  S + A  +D S       E +  SKE+  +    S  + KT                       G L RKHEWE   KKA +R W+ +Y VI N +M  YK+ K          Y  E P+ L  A+   A +YKK+ +VF++R+ +G EYLF+A D  EMN W++ I+     D      ST            T ASS  +  PT
Sbjct:   28 DDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--ARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIY-----IREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDD-----YGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALS-QEGKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHG-HNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERF----------------SALERLTTLELLEVRRQQEEEERKRRPPSPEPSTKVSEEAESQQQWDTSKGEQVSQNGL-PAEQGSPRMAETVDTSEMVNGATEQRTSSKESSPIPSPTSDRKAKTALPAQSAATLPARTQETPSAQMEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKTAASGI---PYHSEVPVSLKEAVCEVALDYKKKKHVFKLRLNDGNEYLFQAKDDEEMNTWIQAISSAISSDKHEVSAST----------QSTPASSRAQTLPT 2331          
BLAST of Spectrin beta chain vs. Ensembl Human
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1440.25 bits (3727), Expect = 0.000e+0
Identity = 870/2350 (37.02%), Postives = 1375/2350 (58.51%), Query Frame = 2
Query:   56 DVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGR---IDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLI---RKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELN--XXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFP-SSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKV----------ETIK--QLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKT-----------------------GTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPT 6958
            D  +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL  ++    + DL+ DL+DG+ L+KLLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVNI NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI VD P+EKSI+TYV +     +++K+   + KR+G V++ AI  EK+I  YE L+ +LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+ A+  +A +L++ENY+ I  +      ++ +W+ LL+ L+ RR +L+    +Q I QE  Y+MDWM E+ + + S+D+GKHLLGVE+LL+KH ++ +DI     R   ++ +++K  T        D   +  +   +   YQEL  L+ +R   L   + +W++  ++  ++ WI+E  ++  S D G DL SV RL+   R FE  +S  +   +  + + + ++ +        R+ II+     I E   NL+Q    R+ +L ++   HQ  AD +D DA +L+  ++  +SDVG     T+  +K+H++   ++      +  L  + + L  +  +  D       ++  ++++ +L   RK  L +    + +FS  +  E WI  KE+ L  +   E+L++L VI+HRF+  E +M   + +V+  NQI+R L++  HP  + I  +Q+ LN  W+Q  +L ++KK  L  A+    + LE  ET+SWI++K K++E T DL +DL G+M LQR+L  ++RD+ AIEAK+  L KEA+KL+   P     I S +  ++++WEE+K  L++R+A L  +++LQ+F +DLD F  WL + Q  +A++D+P  L EAE+  T H  +K EI  +E +Y ++   G  V+  + D QY+   +RL  L+  WN L KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +E+P   E  +A  ++ E F  ++ +N+ KI+AVV  G  L++  N  SD+I+ K + I  R    ++        L+D+  L +F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N+E +D++ ++G +LI EKP  E+ ++ K+  L   W  L +T   K+++L +AN+  +F ++   +  W+       + ++   ++YG  L  +N   K +     + Q++ ++K + +++  A+ L  Q  +  DE +  +  V+ K  E+  PL +R++ LL  K + QF RDVEDE  W+ E++   T        LQ     I++ +T   EI  H  RI D+    + ++ +    S++     L +L +LW  LI   E   +  EE    Q+Y  +A E E WMSE+E  +M E+KAKDE  A++ ++KH+ L   + +Y   V +L+     ++    P S  ++ +Q +VDK+YA L ++  E++ K+++  + + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   + + D+LI  GH ++  IA WKD +NEAWADLLELI+TR Q+L A+Y+  KF  D+ E+   I +K + +PE +G+D  +V T QR H  F  +I+ L   +      A +L   Y G+K  +I  R+ E+ + W SL    E+R   L+D  D ++F++MVR+L+ WM ++  QI A +K RDV  VEL+++NH+ +KAEID+R+++ + CI LG++L+ RKH  + ++++K  ++  K   +++ W +R E+L +ILEV+QF+R+A+VAEAWL+ QE  L++ + G +++E   L+++H   E++ A   +RF                +A ++   L+  E R +    E    PP+PEP  KV          +T K  Q+S++ + P +  S + A  +D S       E +  SKE+  +    S  + KT                       G L RKHEWE   KKA +R W+ +Y VI N +M  YK+ K          Y  E P+ L  A+   A +YKK+ +VF++R+ +G EYLF+A D  EMN W++ I+     D      ST            T ASS  +  PT
Sbjct:   28 DDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--ARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIY-----IREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWL-----HGLESQIQSDDYGKDLTSVNILLKKQQATMLENQMEVRKKEIEELQSQAQALS-QEGKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHG-HNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHFTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERF----------------SALERLTTLELLEVRRQQEEEERKRRPPSPEPSTKVSEEAESQQQWDTSKGEQVSQNGL-PAEQGSPRMAETVDTSEMVNGATEQRTSSKESSPIPSPTSDRKAKTALPAQSAATLPARTQETPSAQMEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKTAASGI---PYHSEVPVSLKEAVCEVALDYKKKKHVFKLRLNDGNEYLFQAKDDEEMNTWIQAISSAISSDKHEVSAST----------QSTPASSRAQTLPT 2333          
BLAST of Spectrin beta chain vs. Ensembl Human
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1347.03 bits (3485), Expect = 0.000e+0
Identity = 790/2097 (37.67%), Postives = 1260/2097 (60.09%), Query Frame = 2
Query:  101 SRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGR---IDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLI---RKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFP-SSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKV 6355
             R K L ++REAVQKKTFTKWVNSHL  ++    + DL+ DL+DG+ L+KLLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVNI NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI VD P+EKSI+TYV +     +++K+   + KR+G V++ AI  EK+I  YE L+ +LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+ A+  +A +L++ENY+ I  +      ++ +W+ LL+ L+ RR +L+    +Q I QE  Y+MDWM E+ + + S+D+GKHLLGVE+LL+KH ++ +DI     R   ++ +++K  T        D   +  +   +   YQEL  L+ +R   L   + +W++  ++  ++ WI+E  ++  S D G DL SV RL+   R FE  +S  +   +  + + + ++ +        R+ II+     I E   NL+Q    R+ +L ++   HQ  AD +D DA +L+  ++  +SDVG     T+  +K+H++   ++      +  L  + + L  +  +  D       ++  ++++ +L   RK  L +    + +FS  +  E WI  KE+ L  +   E+L++L VI+HRF+  E +M   + +V+  NQI+R L++  HP  + I  +Q+ LN  W+Q  +L ++KK  L  A+    + LE  ET+SWI++K K++E T DL +DL G+M LQR+L  ++RD+ AIEAK+  L KEA+KL+   P     I S +  ++++WEE+K  L++R+A L  +++LQ+F +DLD F  WL + Q  +A++D+P  L EAE+  T H  +K EI  +E +Y ++   G  V+  + D QY+   +RL  L+  WN L KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +E+P   E  +A  ++ E F  ++ +N+ KI+AVV  G  L++  N  SD+I+ K + I  R    ++        L+D+  L +F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N+E +D++ ++G +LI EKP  E+ ++ K+  L   W  L +T   K+++L +AN+  +F ++   +  W+       + ++   ++YG  L  +N  +K Q+  + Q++ ++K + +++  A+ L  Q  +  DE +  +  V+ K  E+  PL +R++ LL  K + QF RDVEDE  W+ E++   T        LQ     I++ +T   EI  H  RI D+    + ++ +    S++     L +L +LW  LI   E   +  EE    Q+Y  +A E E WMSE+E  +M E+KAKDE  A++ ++KH+ L   + +Y   V +L+     ++    P S  ++ +Q +VDK+YA L ++  E++ K+++  + + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   + + D+LI  GH ++  IA WKD +NEAWADLLELI+TR Q+L A+Y+  KF  D+ E+   I +K + +PE +G+D  +V T QR H  F  +I+ L   +      A +L   Y G+K  +I  R+ E+ + W SL    E+R   L+D  D ++F++MVR+L+ WM ++  QI A +K RDV  VEL+++NH+ +KAEID+R+++ + CI LG++L+ RKH  + ++++K  ++  K   +++ W +R E+L +ILEV+QF+R+A+VAEAWL+ QE  L++ + G +++E   L+++H   E++ A   +RF                +A ++   L+  E R +    E    PP+PEP  KV
Sbjct:   30 GRFKQLQDEREAVQKKTFTKWVNSHL--ARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIY-----IREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWL-----HGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALS-QEGKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHG-HNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERF----------------SALERLTTLELLEVRRQQEEEERKRRPPSPEPSTKV 2096          
BLAST of Spectrin beta chain vs. Ensembl Human
Match: SPTBN2 (spectrin beta, non-erythrocytic 2 [Source:HGNC Symbol;Acc:HGNC:11276])

HSP 1 Score: 1284.63 bits (3323), Expect = 0.000e+0
Identity = 792/2311 (34.27%), Postives = 1271/2311 (55.00%), Query Frame = 2
Query:   83 ALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSR---KLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKD---LIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPP------------------PTPEPVRKVETIKQLSED--IIVPL--QSRSVQSAV------AIDDSAEAP------------PKQEVKEKSKEN------PKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKIN 6844
            A L+ERSRIKAL+++REAVQKKTFTKWVNSHL  ++    V DL+ DL+DG+ LL+LLE+LSGE +P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGL+WTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVN+ NFT+SW+DGLAFNA++HKHRP+++D+ +L K N   NL  AF  AE+E G+ +LLD  D+ VDQP+EKSI+TYV +     +++K+   + KR+G V++ A+ AE+L+  YE L+ ELL+WI+  I  + + +L  SL GV+ QL  F++YR  EKPPKF ++G LE+  F IQSKLRA+N+K+Y P EG+LIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG +L  + AA++KHEA+E DI A+  R+ A+  +A +L +E Y+ I  +      +  +W  L   +  RR++L    ++Q + Q+  YLMDWM E+  RLQS+D G+HL GVE+LL+ H+++ +DI     R+   S    +      +    D   V  +  +L  +Y+ L  L+  R   L   + +W ++ ++   + W++E   L  S D+G DL    RL+ K   +  +++ R     L +++   +V      P   +      E+    E L+ L +    R  +L Q+   +Q  AD  D +A +++  RL  + ++G     T+   +QH     ++      +  L  +   L     +  +       ++  +E+L   A  R   L      + + S       W+  KE+ L  L   E L++L V++ RF+  E +M   + +++  N I+  L+    P  + I   Q  LN  W Q   LA+ KK  L  A+    + LE  ETQ+W+++K K++E T  L +DL G++ LQR+L   +RD++AI A+V  L +EA+ L    PA    I++ +  V   WE+L+  ++ R+  L  +  LQ F + LD F  WL + Q  VA+++ P  L EAE     H  ++ E+   + EY RL   G +V+  + DPQ L   +RL  L   W  L +MW+ +   L ++   Q F+RD+ Q +G+L+ QE  LS +E+P   +A  A  ++ E F +++ +N  +I  ++  G  L++  N  +DKIR K + I  R    QD   +    L+D+     F  D   L+ W+ EKM+ A D SY + +++ T++ + + F  EL AN++ +D+V ++G +L  EKP  ++ +  K+ +L  +W EL  T   K++ L +ANR  +F ++  ++ SW+     + +  +   ++YG  L  +N  +K Q+  + ++  + K +  I+  A+ L ++    G E E   + V+ K   +  P+ +R   L   +   QF RDVEDE  W+ E+L   +  +   +   V L  +++ +T   EI  H  RI DL        R     +      L EL ++W  L    E   +  E+    Q++  +A E E WM E+E  +M ++KAKDE  A   ++KH+ L   + +Y   + +LA     +++ + P S  ++ +Q +VDK+YA L E+  E++ ++++ ++   L R +  LE+WI ER  VA S+E+G + EH  +LR++F EF+  T+ +G  RV  A+ + + LIA GH     +A WKD +NEAWADLLEL++TR Q+L AAY+  +F+  + + L  +  K + +P+  G+D  +    QR+H A+  +I+ L P +        +L   Y G+K +EI      + + W  LQ     R   L+D +D ++F+  VREL+ WM E+ +Q++A ++ RDV   +L+I N + +KAEI++R +  S CI +G+ L+ R H  A ++ +K  ++  +     E W+E+ ++L+++LEV  F R+A +AEAWL +QE  + + + G T++E  +L+++H   +++     +RF  L+KLT+ EE +K    +++ E+ + +    E T    + PP                  P P P  +  ++  +  D     PL  Q R   S+          D A  P            P    + +S E+      P      S  E   G L RK E E   KKA NR W  +Y V+    +  YK+ K          Y  E P+ L  A  S A +Y+KR +VF++ +Q+G EYLF+A D+AEM+ W+  +N
Sbjct:   40 ARLFERSRIKALADEREAVQKKTFTKWVNSHL--ARVTCRVGDLYSDLRDGRNLLRLLEVLSGEILPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNAFNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHAMEAERLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFTEKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQEKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGRVQAVDAVAAELAAERYHDIKRIAARQHNVARLWDFLRQMVAARRERLLLNLELQKVFQDLLYLMDWMEEMKGRLQSQDLGRHLAGVEDLLQLHELVEADIAVQAERVRAVSASALRFCNPGKEYRPCDPQLVSERVAKLEQSYEALCELAAARRARLEESRRLWRFLWEVGEAEAWVREQQHLLASADTGRDLTGALRLLNKHTALRGEMSGRLGPLKLTLEQGQQLV--AEGHPGASQASARAAELQAQWERLEALAE---ERAQRLAQAASLYQFQADANDMEAWLVDALRLVSSPELGHDEFSTQALARQHRALEEEIRSHRPTLDALREQAAALPPTLSRTPEVQSRVPTLERHYEELQARAGERARALEAALALYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQRFETLEPEMNTLAAQITAVNDIAEQLLKANPPGKDRIVNTQEQLNHRWQQFRRLADGKKAALTSALSIQNYHLECTETQAWMREKTKVIESTQGLGNDLAGVLALQRKLAGTERDLEAIAARVGELTREANALAAGHPAQAVAINARLREVQTGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAWLGRTQTAVASEEGPATLPEAEALLAQHAALRGEVERAQSEYSRLRALGEEVTRDQADPQCLFLRQRLEALGTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEYVLSHTEMPGTLQAADAAIKKLEDFMSTMDANGERIHGLLEAGRQLVSEGNIHADKIREKADSIERRHKKNQDAAQQFLGRLRDNREQQHFLQDCHELKLWIDEKMLTAQDVSYDEARNLHTKWQKHQAFMAELAANKDWLDKVDKEGRELTLEKPELKALVSEKLRDLHRRWDELETTTQAKARSLFDANRAELFAQSCCALESWL-----ESLQAQLHSDDYGKDLTSVNILLKKQQMLEWEMAVREKEVEAIQAQAKALAQEDQGAG-EVERTSRAVEEKFRALCQPMRERCRRLQASREQHQFHRDVEDEILWVTERLPMASSMEHGKDLPSVQL-LMKKNQTLQKEIQGHEPRIADLRE------RQRALGAAAAGPELAELQEMWKRLGHELELRGKRLEDALRAQQFYRDAAEAEAWMGEQELHMMGQEKAKDELSAQAEVKKHQVLEQALADYAQTIHQLAASSQDMIDHEHPESTRISIRQAQVDKLYAGLKELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSRDTSTIGQERVDSANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAAYELQRFLHGARQALARVQHKQQQLPDGTGRDLNAAEALQRRHCAYEHDIQALSPQVQQVQDDGHRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELMLWMDEVNLQMDAQERPRDVSSADLVIKNQQGIKAEIEARADRFSSCIDMGKELLARSHYAAEEISEKLSQLQARRQETAEKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAELGCTVDEVESLIKRHEAFQKSAVAWEERFCALEKLTALEEREKERKRKREEEERRKQPPAPEPTA---SVPPGDLVGGQTASDTTWDGTQPRPPPSTQAPSVNGVCTDGEPSQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGERQTRTRGPAPSAMPQSRSTESAHAATLPPRGPEPSAQEQMEGMLCRKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDAKAASAGV---PYHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVN 2324          
BLAST of Spectrin beta chain vs. Ensembl Human
Match: SPTBN2 (spectrin beta, non-erythrocytic 2 [Source:HGNC Symbol;Acc:HGNC:11276])

HSP 1 Score: 1284.63 bits (3323), Expect = 0.000e+0
Identity = 792/2311 (34.27%), Postives = 1271/2311 (55.00%), Query Frame = 2
Query:   83 ALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSR---KLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKD---LIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPP------------------PTPEPVRKVETIKQLSED--IIVPL--QSRSVQSAV------AIDDSAEAP------------PKQEVKEKSKEN------PKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKIN 6844
            A L+ERSRIKAL+++REAVQKKTFTKWVNSHL  ++    V DL+ DL+DG+ LL+LLE+LSGE +P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGL+WTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVN+ NFT+SW+DGLAFNA++HKHRP+++D+ +L K N   NL  AF  AE+E G+ +LLD  D+ VDQP+EKSI+TYV +     +++K+   + KR+G V++ A+ AE+L+  YE L+ ELL+WI+  I  + + +L  SL GV+ QL  F++YR  EKPPKF ++G LE+  F IQSKLRA+N+K+Y P EG+LIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG +L  + AA++KHEA+E DI A+  R+ A+  +A +L +E Y+ I  +      +  +W  L   +  RR++L    ++Q + Q+  YLMDWM E+  RLQS+D G+HL GVE+LL+ H+++ +DI     R+   S    +      +    D   V  +  +L  +Y+ L  L+  R   L   + +W ++ ++   + W++E   L  S D+G DL    RL+ K   +  +++ R     L +++   +V      P   +      E+    E L+ L +    R  +L Q+   +Q  AD  D +A +++  RL  + ++G     T+   +QH     ++      +  L  +   L     +  +       ++  +E+L   A  R   L      + + S       W+  KE+ L  L   E L++L V++ RF+  E +M   + +++  N I+  L+    P  + I   Q  LN  W Q   LA+ KK  L  A+    + LE  ETQ+W+++K K++E T  L +DL G++ LQR+L   +RD++AI A+V  L +EA+ L    PA    I++ +  V   WE+L+  ++ R+  L  +  LQ F + LD F  WL + Q  VA+++ P  L EAE     H  ++ E+   + EY RL   G +V+  + DPQ L   +RL  L   W  L +MW+ +   L ++   Q F+RD+ Q +G+L+ QE  LS +E+P   +A  A  ++ E F +++ +N  +I  ++  G  L++  N  +DKIR K + I  R    QD   +    L+D+     F  D   L+ W+ EKM+ A D SY + +++ T++ + + F  EL AN++ +D+V ++G +L  EKP  ++ +  K+ +L  +W EL  T   K++ L +ANR  +F ++  ++ SW+     + +  +   ++YG  L  +N  +K Q+  + ++  + K +  I+  A+ L ++    G E E   + V+ K   +  P+ +R   L   +   QF RDVEDE  W+ E+L   +  +   +   V L  +++ +T   EI  H  RI DL        R     +      L EL ++W  L    E   +  E+    Q++  +A E E WM E+E  +M ++KAKDE  A   ++KH+ L   + +Y   + +LA     +++ + P S  ++ +Q +VDK+YA L E+  E++ ++++ ++   L R +  LE+WI ER  VA S+E+G + EH  +LR++F EF+  T+ +G  RV  A+ + + LIA GH     +A WKD +NEAWADLLEL++TR Q+L AAY+  +F+  + + L  +  K + +P+  G+D  +    QR+H A+  +I+ L P +        +L   Y G+K +EI      + + W  LQ     R   L+D +D ++F+  VREL+ WM E+ +Q++A ++ RDV   +L+I N + +KAEI++R +  S CI +G+ L+ R H  A ++ +K  ++  +     E W+E+ ++L+++LEV  F R+A +AEAWL +QE  + + + G T++E  +L+++H   +++     +RF  L+KLT+ EE +K    +++ E+ + +    E T    + PP                  P P P  +  ++  +  D     PL  Q R   S+          D A  P            P    + +S E+      P      S  E   G L RK E E   KKA NR W  +Y V+    +  YK+ K          Y  E P+ L  A  S A +Y+KR +VF++ +Q+G EYLF+A D+AEM+ W+  +N
Sbjct:   40 ARLFERSRIKALADEREAVQKKTFTKWVNSHL--ARVTCRVGDLYSDLRDGRNLLRLLEVLSGEILPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNAFNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHAMEAERLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFTEKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQEKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGRVQAVDAVAAELAAERYHDIKRIAARQHNVARLWDFLRQMVAARRERLLLNLELQKVFQDLLYLMDWMEEMKGRLQSQDLGRHLAGVEDLLQLHELVEADIAVQAERVRAVSASALRFCNPGKEYRPCDPQLVSERVAKLEQSYEALCELAAARRARLEESRRLWRFLWEVGEAEAWVREQQHLLASADTGRDLTGALRLLNKHTALRGEMSGRLGPLKLTLEQGQQLV--AEGHPGASQASARAAELQAQWERLEALAE---ERAQRLAQAASLYQFQADANDMEAWLVDALRLVSSPELGHDEFSTQALARQHRALEEEIRSHRPTLDALREQAAALPPTLSRTPEVQSRVPTLERHYEELQARAGERARALEAALALYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQRFETLEPEMNTLAAQITAVNDIAEQLLKANPPGKDRIVNTQEQLNHRWQQFRRLADGKKAALTSALSIQNYHLECTETQAWMREKTKVIESTQGLGNDLAGVLALQRKLAGTERDLEAIAARVGELTREANALAAGHPAQAVAINARLREVQTGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAWLGRTQTAVASEEGPATLPEAEALLAQHAALRGEVERAQSEYSRLRALGEEVTRDQADPQCLFLRQRLEALGTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEYVLSHTEMPGTLQAADAAIKKLEDFMSTMDANGERIHGLLEAGRQLVSEGNIHADKIREKADSIERRHKKNQDAAQQFLGRLRDNREQQHFLQDCHELKLWIDEKMLTAQDVSYDEARNLHTKWQKHQAFMAELAANKDWLDKVDKEGRELTLEKPELKALVSEKLRDLHRRWDELETTTQAKARSLFDANRAELFAQSCCALESWL-----ESLQAQLHSDDYGKDLTSVNILLKKQQMLEWEMAVREKEVEAIQAQAKALAQEDQGAG-EVERTSRAVEEKFRALCQPMRERCRRLQASREQHQFHRDVEDEILWVTERLPMASSMEHGKDLPSVQL-LMKKNQTLQKEIQGHEPRIADLRE------RQRALGAAAAGPELAELQEMWKRLGHELELRGKRLEDALRAQQFYRDAAEAEAWMGEQELHMMGQEKAKDELSAQAEVKKHQVLEQALADYAQTIHQLAASSQDMIDHEHPESTRISIRQAQVDKLYAGLKELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSRDTSTIGQERVDSANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAAYELQRFLHGARQALARVQHKQQQLPDGTGRDLNAAEALQRRHCAYEHDIQALSPQVQQVQDDGHRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELMLWMDEVNLQMDAQERPRDVSSADLVIKNQQGIKAEIEARADRFSSCIDMGKELLARSHYAAEEISEKLSQLQARRQETAEKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAELGCTVDEVESLIKRHEAFQKSAVAWEERFCALEKLTALEEREKERKRKREEEERRKQPPAPEPTA---SVPPGDLVGGQTASDTTWDGTQPRPPPSTQAPSVNGVCTDGEPSQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGERQTRTRGPAPSAMPQSRSTESAHAATLPPRGPEPSAQEQMEGMLCRKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDAKAASAGV---PYHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVN 2324          
BLAST of Spectrin beta chain vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 1477.23 bits (3823), Expect = 0.000e+0
Identity = 875/2330 (37.55%), Postives = 1391/2330 (59.70%), Query Frame = 2
Query:   35 NQFMQTKDVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDG--KRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDT---SRKLQTADFDRAA----IDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDL--IVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFE--ETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDT--SLAKYSTLPNIKSDFEMPVTEASSEKKKFPTLGRKQK 6976
            N    T+D   +DN+SA L+ERSRIKAL+++RE VQKKTFTKWVNSHL++      V DL++D++DGK LL+LL +LSGE++P  T GK+RIHC+ENV K + FL +QHV  ENLG+HDIVDGN  L LGLIWTIILRFQIQD   ++ D    R++KE+LLLWCQMKTAGY NVN++NF++SW+DGLAFNAL+HKHRP++VDY  L K+N + NL  AF+TAE + G+ + LDA D+ VDQP+EKSI+TYV +     N++K +  Q KR+G VINE +  +K+IN YE LS +LLEWI  KI  +       +L GV+ QL +F++YR  EKPPKF ++G LE+  F +QS +RA+N++ +VP EGKLI+ INRAW +LEK+EH  EL L EELIRQ+KLEQL   FNRKA+MR+ WL EN  LV Q  FG+DL ++ AA KKHEA+E DIFA+EER+ A+  +A +L++ENY+   ++ +    ++++W  L   L  RR +L+    IQ I  +    +D M +I  RL S D G HL+ VE+LL+KH +L SDI  +  R++++   +++ +  D    +    ++   +D +   L   Y+EL+ L+ +R+  L   K + ++  D+   +  IKE  Q+  S D+G D+ +V  L+ K +   +++   +DL   +D+LD    +  ++  P    I  R + EI + ++ L +   +R+ +L    +++Q   D +D D  + +  R+  + DVG      +  LK+H++   +++  ++ I  L  +   L  ++++  D  +  +       +L +L+  RK  L++    + L+S+ +++E+WI  K KLL TLVP  +++E+ ++KHRFD  E DMK    KV+  N ++R L+N +HP  + I  +QN LN  W QL D+ +QK+ EL+ A     F ++ QET +WI+DK ++LE +D L +DL G+M+LQRRL  ++RD+ AI+AK+  L+KEAD ++  +P +   I  +I  ++++W+ L   +++ +A+L+ + +LQ+F +DLD F  WL   Q QVA+++ P+ L EAE+    H  ++EEI  +  +Y ++   G +V+  + DPQY+   +RL  L+  W  L++MW ++   L +  + Q F+RD+ Q + +L+QQE++L+K ++P + E  +   +  + F  ++ +N  KI AV  FG+ L    +  +DKI  K   I  R  A ++K       L+D L L +F  D   L EW+ EKMI A D +YRD K I++++ R + F+ EL AN+E +D++      L D+KP +   I+P++ EL  QW EL  T  EK ++L +ANR+ ++ ++   M  W T++ +++   ++  +   L  +N  M+ Q   + ++ +K + +  + +   +L+E +P+  +  +  +  V+ +L  ++APL DRR  L +KK   QF RDV+DEK WI E+L  + K +   E+L  C +  + L+  + EIDNH   I  + N G+E+I     +   F   + EL   W +L  A +D +    E+ +  ++L +  E E WMSE+E  +M++++ KDE    N ++KHE L S I+ +   +  LA K H  +    P +  +  +Q +++K+YA L ++  E++ ++E+ ++ Y L+R I  L +WIA++  VA S E G + EH  +L+ERF +FA  T  +GS RV +A++ CD LI  GH ++P IA WKD +NEAW +LLEL++TR Q+L+A+    KF  D  + L  I EK   +P+ +G+D+ SV    RKH  +  +I  +   ++     A +L   Y G+K  +I  R+ E+ K W  L+   + R + LMD SDL+KF  MVR+L+ WM E++ ++N+ ++ +DV GVEL+++NH+SLKAEID+R+EN + CI+LGR L+NRKH  ++++ KK  ++  +   ++  W +R E+L++ILEVYQFAR+AAVAE+WL AQE  L + ++G  L ET+ L++KH   E++   Q +RF  L+KLT+FE  ETQ       KR                    P    P  +     Q  E  +   +S S + ++A        PK + K     +PK  +     E   GTL RKH +E+  +KA NR W +LY V+  +++S      Y +   + ++   E P+ L G   + A++Y+K+ NV  +R+  GAEYLF+   + +M +W+ ++    G       ++  TLP           E S+ KKK     R +K
Sbjct:    7 NSGAYTQDEDYDDNSSARLFERSRIKALADERELVQKKTFTKWVNSHLVRV--SCKVQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRNQHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQDITFEDADNHETRSAKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYYHYFNKLKQDNIQGKRIGKVINELMENDKMINRYETLSSDLLEWINAKIQLLNERHFENNLEGVQRQLTEFNDYRTQEKPPKFDEKGELEVLLFTLQSAMRANNQRPFVPREGKLIADINRAWQSLEKAEHERELVLKEELIRQEKLEQLAARFNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVAGELEAENYHDQAKINERKENVLQLWNYLFQLLLARRVRLELSMAIQKIFHDMLLTLDLMDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQAQRFRNPDGPDGSGYKPVEPGTIDERSDVLQKRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNL---RDLEKYLDRLDVSGKELQDESIPGSDNIPPR-LAEIRDYINKLKELSASRKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQHIKVLHAKAESLPQEAREHPDIRQRLDTTLKQKAELENLSQLRKQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADDIERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMGDRVTQDQTDPQYMFLRQRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQAEVMLSQQENYLAKDDIPQSLEQAENQLKRHQDFITTMDANDEKIRAVGMFGDQLCQDGHYAADKIHKKARNIDERRGANREKAQEVLKKLKDALSLQQFLSDCDELREWIEEKMIRAQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEELATQWDELEKTTEEKGQKLFDANRQQLYVQSIADMKEWATQLENEMTREDQPGD---LTTVNVAMQKQHLIETEMIKKAQHIDQLMEMEPQLEELHPDELENIKAHRLAVQEQLQRLQAPLDDRRKALERKKAAFQFGRDVDDEKLWISERL-VLAKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNGQELIDEGHANGPAFEKKIQELRSAWQELKEAVKDRKGDLGESEKAHQFLYDCGEAEAWMSEQELYMMQDERGKDEFSTKNQIKKHERLQSDIDKFADTIRALATKAHKFVEEKSPLTEQIQVRQAQIEKLYAGLQDLSKERRKRLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGSERVANANDGCDTLIGHGHTDAPTIALWKDSLNEAWENLLELMDTRAQILEASRLLHKFYHDCRDCLSRIMEKTHAMPDDLGRDSSSVGALSRKHQNYLKDIAAIGEQVAQIERDAAELRDGYAGDKALDIGSRESEVVKAWRHLRGLCDARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEIDAREENFNACISLGRDLLNRKHYASSEIEKKLIKLTTERAEMMRRWEDRWEYLQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLEETIKLIKKHEAFEKSAFAQEERFLALEKLTTFELKETQHREEETAKRRGPAHI------------GSPSRSTPAAETSFGAQDDEKRLAHSESSSWRKSLA------RAPKFDSK-----DPKGAKQGEAFE---GTLIRKHTYESLDRKAANRSWEKLYAVLRQNELSF-----YKDPKHRDESVHGEPPMALPGCSVNVASDYQKKKNVLSLRLPIGAEYLFQCGSEEDMQRWLTELQVATGQAQLEEASRSQTLP----------AEGSATKKKGGFFSRGKK 2285          
BLAST of Spectrin beta chain vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 1472.99 bits (3812), Expect = 0.000e+0
Identity = 880/2357 (37.34%), Postives = 1397/2357 (59.27%), Query Frame = 2
Query:   35 NQFMQTKDVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDG--KRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDT---SRKLQTADFDRAA----IDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDL--IVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFE--ETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSA----VAIDDSAEAPPKQ-EVKEKSKENPKLIETKSTT--------------EPKT--------GTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDT--SLAKYSTLPNIKSDFEMPVTEASSEKKKFPTLGRKQK 6976
            N    T+D   +DN+SA L+ERSRIKAL+++RE VQKKTFTKWVNSHL++      V DL++D++DGK LL+LL +LSGE++P  T GK+RIHC+ENV K + FL +QHV  ENLG+HDIVDGN  L LGLIWTIILRFQIQD   ++ D    R++KE+LLLWCQMKTAGY NVN++NF++SW+DGLAFNAL+HKHRP++VDY  L K+N + NL  AF+TAE + G+ + LDA D+ VDQP+EKSI+TYV +     N++K +  Q KR+G VINE +  +K+IN YE LS +LLEWI  KI  +       +L GV+ QL +F++YR  EKPPKF ++G LE+  F +QS +RA+N++ +VP EGKLI+ INRAW +LEK+EH  EL L EELIRQ+KLEQL   FNRKA+MR+ WL EN  LV Q  FG+DL ++ AA KKHEA+E DIFA+EER+ A+  +A +L++ENY+   ++ +    ++++W  L   L  RR +L+    IQ I  +    +D M +I  RL S D G HL+ VE+LL+KH +L SDI  +  R++++   +++ +  D    +    ++   +D +   L   Y+EL+ L+ +R+  L   K + ++  D+   +  IKE  Q+  S D+G D+ +V  L+ K +   +++   +DL   +D+LD    +  ++  P    I  R + EI + ++ L +   +R+ +L    +++Q   D +D D  + +  R+  + DVG      +  LK+H++   +++  ++ I  L  +   L  ++++  D  +  +       +L +L+  RK  L++    + L+S+ +++E+WI  K KLL TLVP  +++E+ ++KHRFD  E DMK    KV+  N ++R L+N +HP  + I  +QN LN  W QL D+ +QK+ EL+ A     F ++ QET +WI+DK ++LE +D L +DL G+M+LQRRL  ++RD+ AI+AK+  L+KEAD ++  +P +   I  +I  ++++W+ L   +++ +A+L+ + +LQ+F +DLD F  WL   Q QVA+++ P+ L EAE+    H  ++EEI  +  +Y ++   G +V+  + DPQY+   +RL  L+  W  L++MW ++   L +  + Q F+RD+ Q + +L+QQE++L+K ++P + E  +   +  + F  ++ +N  KI AV  FG+ L    +  +DKI  K   I  R  A ++K       L+D L L +F  D   L EW+ EKMI A D +YRD K I++++ R + F+ EL AN+E +D++      L D+KP +   I+P++ EL  QW EL  T  EK ++L +ANR+ ++ ++   M  W T++ +++   ++  +   L  +N  M+ Q   + ++ +K + +  + +   +L+E +P+  +  +  +  V+ +L  ++APL DRR  L +KK   QF RDV+DEK WI E+L  + K +   E+L  C +  + L+  + EIDNH   I  + N G+E+I     +   F   + EL   W +L  A +D +    E+ +  ++L +  E E WMSE+E  +M++++ KDE    N ++KHE L S I+ +   +  LA K H  +    P +  +  +Q +++K+YA L ++  E++ ++E+ ++ Y L+R I  L +WIA++  VA S E G + EH  +L+ERF +FA  T  +GS RV +A++ CD LI  GH ++P IA WKD +NEAW +LLEL++TR Q+L+A+    KF  D  + L  I EK   +P+ +G+D+ SV    RKH  +  +I  +   ++     A +L   Y G+K  +I  R+ E+ K W  L+   + R + LMD SDL+KF  MVR+L+ WM E++ ++N+ ++ +DV GVEL+++NH+SLKAEID+R+EN + CI+LGR L+NRKH  ++++ KK  ++  +   ++  W +R E+L++ILEVYQFAR+AAVAE+WL AQE  L + ++G  L ET+ L++KH   E++   Q +RF  L+KLT+FE  ETQ                                    R+ ET K+     I    SRS  +A     A DD A+      E   KS    +L  ++S++              +PK         GTL RKH +E+  +KA NR W +LY V+  +++S      Y +   + ++   E P+ L G   + A++Y+K+ NV  +R+  GAEYLF+   + +M +W+ ++    G       ++  TLP           E S+ KKK     R +K
Sbjct:    7 NSGAYTQDEDYDDNSSARLFERSRIKALADERELVQKKTFTKWVNSHLVRV--SCKVQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRNQHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQDITFEDADNHETRSAKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYYHYFNKLKQDNIQGKRIGKVINELMENDKMINRYETLSSDLLEWINAKIQLLNERHFENNLEGVQRQLTEFNDYRTQEKPPKFDEKGELEVLLFTLQSAMRANNQRPFVPREGKLIADINRAWQSLEKAEHERELVLKEELIRQEKLEQLAARFNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVAGELEAENYHDQAKINERKENVLQLWNYLFQLLLARRVRLELSMAIQKIFHDMLLTLDLMDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQAQRFRNPDGPDGSGYKPVEPGTIDERSDVLQKRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNL---RDLEKYLDRLDVSGKELQDESIPGSDNIPPR-LAEIRDYINKLKELSASRKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQHIKVLHAKAESLPQEAREHPDIRQRLDTTLKQKAELENLSQLRKQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADDIERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMGDRVTQDQTDPQYMFLRQRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQAEVMLSQQENYLAKDDIPQSLEQAENQLKRHQDFITTMDANDEKIRAVGMFGDQLCQDGHYAADKIHKKARNIDERRGANREKAQEVLKKLKDALSLQQFLSDCDELREWIEEKMIRAQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEELATQWDELEKTTEEKGQKLFDANRQQLYVQSIADMKEWATQLENEMTREDQPGD---LTTVNVAMQKQHLIETEMIKKAQHIDQLMEMEPQLEELHPDELENIKAHRLAVQEQLQRLQAPLDDRRKALERKKAAFQFGRDVDDEKLWISERL-VLAKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNGQELIDEGHANGPAFEKKIQELRSAWQELKEAVKDRKGDLGESEKAHQFLYDCGEAEAWMSEQELYMMQDERGKDEFSTKNQIKKHERLQSDIDKFADTIRALATKAHKFVEEKSPLTEQIQVRQAQIEKLYAGLQDLSKERRKRLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGSERVANANDGCDTLIGHGHTDAPTIALWKDSLNEAWENLLELMDTRAQILEASRLLHKFYHDCRDCLSRIMEKTHAMPDDLGRDSSSVGALSRKHQNYLKDIAAIGEQVAQIERDAAELRDGYAGDKALDIGSRESEVVKAWRHLRGLCDARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEIDAREENFNACISLGRDLLNRKHYASSEIEKKLIKLTTERAEMMRRWEDRWEYLQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLEETIKLIKKHEAFEKSAFAQEERFLALEKLTTFELKETQH-----------------------------------REEETAKRRGPAHIGS-PSRSTPAAETSFGAQDDDADITHSSLEGHRKSSHEKRLAHSESSSWRKSLARAPKFDSKDPKGAKQGEAFEGTLIRKHTYESLDRKAANRSWEKLYAVLRQNELSF-----YKDPKHRDESVHGEPPMALPGCSVNVASDYQKKKNVLSLRLPIGAEYLFQCGSEEDMQRWLTELQVATGQAQLEEASRSQTLP----------AEGSATKKKGGFFSRGKK 2302          
BLAST of Spectrin beta chain vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 1471.83 bits (3809), Expect = 0.000e+0
Identity = 868/2330 (37.25%), Postives = 1384/2330 (59.40%), Query Frame = 2
Query:   35 NQFMQTKDVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDG--KRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDT---SRKLQTADFDRAA----IDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDL--IVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFE--ETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDT--SLAKYSTLPNIKSDFEMPVTEASSEKKKFPTLGRKQK 6976
            N    T+D   +DN+SA L+ERSRIKAL+++RE VQKKTFTKWVNSHL++      V DL++D++DGK LL+LL +LSGE++P  T GK+RIHC+ENV K + FL +QHV  ENLG+HDIVDGN  L LGLIWTIILRFQIQD   ++ D    R++KE+LLLWCQMKTAGY NVN++NF++SW+DGLAFNAL+HKHRP++VDY  L K+N + NL  AF+TAE + G+ + LDA D+ VDQP+EKSI+TYV +     N++K +  Q KR+G VINE +  +K+IN YE LS +LLEWI  KI  +       +L GV+ QL +F++YR  EKPPKF ++G LE+  F +QS +RA+N++ +VP EGKLI+ INRAW +LEK+EH  EL L EELIRQ+KLEQL   FNRKA+MR+ WL EN  LV Q  FG+DL ++ AA KKHEA+E DIFA+EER+ A+  +A +L++ENY+   ++ +    ++++W  L   L  RR +L+    IQ I  +    +D M +I  RL S D G HL+ VE+LL+KH +L SDI  +  R++++   +++ +  D    +    ++   +D +   L   Y+EL+ L+ +R+  L   K + ++  D+   +  IKE  Q+  S D+G D+ +V  L+ K +   +++   +DL   +D+LD    +  ++  P    I  R + EI + ++ L +   +R+ +L    +++Q   D +D D  + +  R+  + DVG      +  LK+H++   +++  ++ I  L  +   L  ++++  D  +  +       +L +L+  RK  L++    + L+S+ +++E+WI  K KLL TLVP  +++E+ ++KHRFD  E DMK    KV+  N ++R L+N +HP  + I  +QN LN  W QL D+ +QK+ EL+ A     F ++ QET +WI+DK ++LE +D L +DL G+M+LQRRL  ++RD+ AI+AK+  L+KEAD ++  +P +   I  +I  ++++W+ L   +++ +A+L+ + +LQ+F +DLD F  WL   Q QVA+++ P+ L EAE+    H  ++EEI  +  +Y ++   G +V+  + DPQY+   +RL  L+  W  L++MW ++   L +  + Q F+RD+ Q + +L+QQE++L+K ++P + E  +   +  + F  ++ +N  KI AV  FG+ L    +  +DKI  K   I  R  A ++K       L+D L L +F  D   L EW+ EKMI A D +YRD K I++++ R + F+ EL AN+E +D++      L D+KP +   I+P++ EL  QW EL  T  EK ++L +ANR+ ++ ++   M  W T++ +++   ++  +   L  +N  M+ Q   + ++ +K + +  + +   +L+E +P+  +  +  +  V+ +L  ++APL DRR  L +KK   QF RDV+DEK WI E+L  + K +   E+L  C +  + L+  + EIDNH   I  + N G+E+I     +   F   + EL   W +L  A +D +    E+ +  ++L +  E E WMSE+E  +M++++ KDE    N ++KHE L S I+ +   +  LA K H  +    P +  +  +Q +++K+YA L ++  E++ ++E+ ++ Y L+R I  L +WIA++  VA S E G + EH  +L+ERF +FA  T  +GS RV +A++ CD LI  GH ++P IA WKD +NEAW +LLEL++TR Q+L+A+    KF  D  + L  I EK   +P+ +G+D+ SV    RKH  +  +I  +   ++     A +L   Y G+K  +I  R+ E+ K W  L+   + R + LMD SDL+KF  MVR+L+ WM E++ ++N+ ++ +DV GVEL+++NH+SLKAEID+R+EN + CI+LGR L+NRKH  ++++ KK  ++  +   ++  W +R E+L++ILEVYQFAR+AAVAE+WL AQE  L + ++G  L ET+ L++KH   E++   Q +RF  L+KLT+FE  ETQ                                    R+ ET K+              +    I   + + P  E    ++++          E   GTL RKH +E+  +KA NR W +LY V+  +++S      Y +   + ++   E P+ L G   + A++Y+K+ NV  +R+  GAEYLF+   + +M +W+ ++    G       ++  TLP           E S+ KKK     R +K
Sbjct:    7 NSGAYTQDEDYDDNSSARLFERSRIKALADERELVQKKTFTKWVNSHLVRV--SCKVQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRNQHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQDITFEDADNHETRSAKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYYHYFNKLKQDNIQGKRIGKVINELMENDKMINRYETLSSDLLEWINAKIQLLNERHFENNLEGVQRQLTEFNDYRTQEKPPKFDEKGELEVLLFTLQSAMRANNQRPFVPREGKLIADINRAWQSLEKAEHERELVLKEELIRQEKLEQLAARFNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVAGELEAENYHDQAKINERKENVLQLWNYLFQLLLARRVRLELSMAIQKIFHDMLLTLDLMDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQAQRFRNPDGPDGSGYKPVEPGTIDERSDVLQKRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNL---RDLEKYLDRLDVSGKELQDESIPGSDNIPPR-LAEIRDYINKLKELSASRKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQHIKVLHAKAESLPQEAREHPDIRQRLDTTLKQKAELENLSQLRKQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADDIERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMGDRVTQDQTDPQYMFLRQRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQAEVMLSQQENYLAKDDIPQSLEQAENQLKRHQDFITTMDANDEKIRAVGMFGDQLCQDGHYAADKIHKKARNIDERRGANREKAQEVLKKLKDALSLQQFLSDCDELREWIEEKMIRAQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEELATQWDELEKTTEEKGQKLFDANRQQLYVQSIADMKEWATQLENEMTREDQPGD---LTTVNVAMQKQHLIETEMIKKAQHIDQLMEMEPQLEELHPDELENIKAHRLAVQEQLQRLQAPLDDRRKALERKKAAFQFGRDVDDEKLWISERL-VLAKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNGQELIDEGHANGPAFEKKIQELRSAWQELKEAVKDRKGDLGESEKAHQFLYDCGEAEAWMSEQELYMMQDERGKDEFSTKNQIKKHERLQSDIDKFADTIRALATKAHKFVEEKSPLTEQIQVRQAQIEKLYAGLQDLSKERRKRLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGSERVANANDGCDTLIGHGHTDAPTIALWKDSLNEAWENLLELMDTRAQILEASRLLHKFYHDCRDCLSRIMEKTHAMPDDLGRDSSSVGALSRKHQNYLKDIAAIGEQVAQIERDAAELRDGYAGDKALDIGSRESEVVKAWRHLRGLCDARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEIDAREENFNACISLGRDLLNRKHYASSEIEKKLIKLTTERAEMMRRWEDRWEYLQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLEETIKLIKKHEAFEKSAFAQEERFLALEKLTTFELKETQH-----------------------------------REEETAKR--------------RGPAHIGSPSRSTPAAETSFGAQDD-----GAKQGEAFEGTLIRKHTYESLDRKAANRSWEKLYAVLRQNELSF-----YKDPKHRDESVHGEPPMALPGCSVNVASDYQKKKNVLSLRLPIGAEYLFQCGSEEDMQRWLTELQVATGQAQLEEASRSQTLP----------AEGSATKKKGGFFSRGKK 2257          
BLAST of Spectrin beta chain vs. Ensembl Celegans
Match: unc-70 (Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:E0AHA7])

HSP 1 Score: 1450.26 bits (3753), Expect = 0.000e+0
Identity = 854/2307 (37.02%), Postives = 1366/2307 (59.21%), Query Frame = 2
Query:  104 RIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDG--KRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDT---SRKLQTADFDRAA----IDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDL--IVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFE--ETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDT--SLAKYSTLPNIKSDFEMPVTEASSEKKKFPTLGRKQK 6976
            R + L ++RE VQKKTFTKWVNSHL++      V DL++D++DGK LL+LL +LSGE++P  T GK+RIHC+ENV K + FL +QHV  ENLG+HDIVDGN  L LGLIWTIILRFQIQD   ++ D    R++KE+LLLWCQMKTAGY NVN++NF++SW+DGLAFNAL+HKHRP++VDY  L K+N + NL  AF+TAE + G+ + LDA D+ VDQP+EKSI+TYV +     N++K +  Q KR+G VINE +  +K+IN YE LS +LLEWI  KI  +       +L GV+ QL +F++YR  EKPPKF ++G LE+  F +QS +RA+N++ +VP EGKLI+ INRAW +LEK+EH  EL L EELIRQ+KLEQL   FNRKA+MR+ WL EN  LV Q  FG+DL ++ AA KKHEA+E DIFA+EER+ A+  +A +L++ENY+   ++ +    ++++W  L   L  RR +L+    IQ I  +    +D M +I  RL S D G HL+ VE+LL+KH +L SDI  +  R++++   +++ +  D    +    ++   +D +   L   Y+EL+ L+ +R+  L   K + ++  D+   +  IKE  Q+  S D+G D+ +V  L+ K +   +++   +DL   +D+LD    +  ++  P    I  R + EI + ++ L +   +R+ +L    +++Q   D +D D  + +  R+  + DVG      +  LK+H++   +++  ++ I  L  +   L  ++++  D  +  +       +L +L+  RK  L++    + L+S+ +++E+WI  K KLL TLVP  +++E+ ++KHRFD  E DMK    KV+  N ++R L+N +HP  + I  +QN LN  W QL D+ +QK+ EL+ A     F ++ QET +WI+DK ++LE +D L +DL G+M+LQRRL  ++RD+ AI+AK+  L+KEAD ++  +P +   I  +I  ++++W+ L   +++ +A+L+ + +LQ+F +DLD F  WL   Q QVA+++ P+ L EAE+    H  ++EEI  +  +Y ++   G +V+  + DPQY+   +RL  L+  W  L++MW ++   L +  + Q F+RD+ Q + +L+QQE++L+K ++P + E  +   +  + F  ++ +N  KI AV  FG+ L    +  +DKI  K   I  R  A ++K       L+D L L +F  D   L EW+ EKMI A D +YRD K I++++ R + F+ EL AN+E +D++      L D+KP +   I+P++ EL  QW EL  T  EK ++L +ANR+ ++ ++   M  W T++ +++   ++  +   L  +N  M+ Q   + ++ +K + +  + +   +L+E +P+  +  +  +  V+ +L  ++APL DRR  L +KK   QF RDV+DEK WI E+L  + K +   E+L  C +  + L+  + EIDNH   I  + N G+E+I     +   F   + EL   W +L  A +D +    E+ +  ++L +  E E WMSE+E  +M++++ KDE    N ++KHE L S I+ +   +  LA K H  +    P +  +  +Q +++K+YA L ++  E++ ++E+ ++ Y L+R I  L +WIA++  VA S E G + EH  +L+ERF +FA  T  +GS RV +A++ CD LI  GH ++P IA WKD +NEAW +LLEL++TR Q+L+A+    KF  D  + L  I EK   +P+ +G+D+ SV    RKH  +  +I  +   ++     A +L   Y G+K  +I  R+ E+ K W  L+   + R + LMD SDL+KF  MVR+L+ WM E++ ++N+ ++ +DV GVEL+++NH+SLKAEID+R+EN + CI+LGR L+NRKH  ++++ KK  ++  +   ++  W +R E+L++ILEVYQFAR+AAVAE+WL AQE  L + ++G  L ET+ L++KH   E++   Q +RF  L+KLT+FE  ETQ                                    R+ ET K+              +    I   + + P  E    ++++          E   GTL RKH +E+  +KA NR W +LY V+  +++S      Y +   + ++   E P+ L G   + A++Y+K+ NV  +R+  GAEYLF+   + +M +W+ ++    G       ++  TLP           E S+ KKK     R +K
Sbjct:   99 RFRGLRDERELVQKKTFTKWVNSHLVRV--SCKVQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRNQHVHLENLGSHDIVDGNSRLTLGLIWTIILRFQIQDITFEDADNHETRSAKEALLLWCQMKTAGYPNVNVKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAEDVNVDQPDEKSIITYVVTYYHYFNKLKQDNIQGKRIGKVINELMENDKMINRYETLSSDLLEWINAKIQLLNERHFENNLEGVQRQLTEFNDYRTQEKPPKFDEKGELEVLLFTLQSAMRANNQRPFVPREGKLIADINRAWQSLEKAEHERELVLKEELIRQEKLEQLAARFNRKAEMRETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVAGELEAENYHDQAKINERKENVLQLWNYLFQLLLARRVRLELSMAIQKIFHDMLLTLDLMDDIKSRLLSEDLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQAQRFRNPDGPDGSGYKPVEPGTIDERSDVLQKRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDIVTVSHLLAKHKNAENNL---RDLEKYLDRLDVSGKELQDESIPGSDNIPPR-LAEIRDYINKLKELSASRKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVHDELQNFDQHIKVLHAKAESLPQEAREHPDIRQRLDTTLKQKAELENLSQLRKQRLIDALSLYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQEAKVTNVNDLARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTWIEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADDIERERPQEAQAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEEPQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMGDRVTQDQTDPQYMFLRQRLAGLQEGWEELQRMWDNRQHLLSQGLNLQMFLRDAKQAEVMLSQQENYLAKDDIPQSLEQAENQLKRHQDFITTMDANDEKIRAVGMFGDQLCQDGHYAADKIHKKARNIDERRGANREKAQEVLKKLKDALSLQQFLSDCDELREWIEEKMIRAQDETYRDAKTITSKFVRHQAFQSELAANKERLDQLKHAAINLGDDKPEYHGTIDPQIEELATQWDELEKTTEEKGQKLFDANRQQLYVQSIADMKEWATQLENEMTREDQPGD---LTTVNVAMQKQHLIETEMIKKAQHIDQLMEMEPQLEELHPDELENIKAHRLAVQEQLQRLQAPLDDRRKALERKKAAFQFGRDVDDEKLWISERL-VLAKAQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNGQELIDEGHANGPAFEKKIQELRSAWQELKEAVKDRKGDLGESEKAHQFLYDCGEAEAWMSEQELYMMQDERGKDEFSTKNQIKKHERLQSDIDKFADTIRALATKAHKFVEEKSPLTEQIQVRQAQIEKLYAGLQDLSKERRKRLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENIGSERVANANDGCDTLIGHGHTDAPTIALWKDSLNEAWENLLELMDTRAQILEASRLLHKFYHDCRDCLSRIMEKTHAMPDDLGRDSSSVGALSRKHQNYLKDIAAIGEQVAQIERDAAELRDGYAGDKALDIGSRESEVVKAWRHLRGLCDARTSRLMDTSDLFKFMNMVRDLLLWMDEVKREMNSQERPKDVSGVELLMNNHQSLKAEIDAREENFNACISLGRDLLNRKHYASSEIEKKLIKLTTERAEMMRRWEDRWEYLQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLEETIKLIKKHEAFEKSAFAQEERFLALEKLTTFELKETQH-----------------------------------REEETAKR--------------RGPAHIGSPSRSTPAAETSFGAQDD-----GAKQGEAFEGTLIRKHTYESLDRKAANRSWEKLYAVLRQNELSF-----YKDPKHRDESVHGEPPMALPGCSVNVASDYQKKKNVLSLRLPIGAEYLFQCGSEEDMQRWLTELQVATGQAQLEEASRSQTLP----------AEGSATKKKGGFFSRGKK 2326          
BLAST of Spectrin beta chain vs. Ensembl Celegans
Match: sma-1 (SMAll [Source:UniProtKB/TrEMBL;Acc:G5EFW3])

HSP 1 Score: 426.017 bits (1094), Expect = 1.742e-119
Identity = 268/760 (35.26%), Postives = 446/760 (58.68%), Query Frame = 2
Query:   74 NNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAID---EKDGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTA-DFDRAAIDQ-DYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVER---LIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQH 2329
            NN  L +ERSRI+ L ++R  +QKKTFTKW NS L  ++    + DLF D+ DG  L+KLLEI+SG+K+    +G++R+  +EN+ K ++FL  + +  EN+GA DI+D N  LILGLIWTIILRFQI    I+   E+  ++ +K++LLLWCQ KTAGY NV I NFT+SW++GLAFNAL+H HRP++VD+  L     V+NLN AF+ AE++  + +LLDA D+ V +P+EKSI+TYV        + K+     +R+ N++ + + +E + ++YE ++ ELL WI++ I  +E+ +   SL G+RE+   F+ +R +EKPPK++++G LE  FF IQ+K +A +RK Y PP+G  +  I  AW  L+ +E+  ++ +  EL RQ+KLEQL   F++KA++R  WL    +++ +   G     +   +KK +A+  DI A E+R   L  + ++L +E Y++  +V      I++ W +LL  L+ R+  L    D+  +L++ D L + +  +   +++RD GKHL+GVE+LL KH +L + I N  G +   S+  Q+A ++ R   +Q D +  K  ++   Y  L+ L   R   L   + ++++++D   +  W+ E  +L  +  +  D+ +V +   L +  E  +     R   ++   + +V       + Q +E I R + ++N   + L  A+    N L+++    Q   D  +A++ I E+  L ++ D+G      E  L++H
Sbjct:   31 NNETLYFERSRIRTLQDERVHIQKKTFTKWCNSFL--NRASLEIVDLFEDVGDGIMLMKLLEIISGDKLGKPNRGRMRVQKVENLNKVLDFLKKKKIQLENIGAEDILDRNERLILGLIWTIILRFQIDTIVIEDEEERGERKHAKDALLLWCQRKTAGYPNVRIENFTTSWRNGLAFNALIHSHRPDLVDFNRLNPNEHVDNLNHAFDVAEKKLEIARLLDAEDVDVTRPDEKSIITYVSLYYHHFAKQKTEMTGARRIANIVGKLMVSETMEDDYEHIASELLNWIRVTIKTLESRRFPNSLNGMREEHAKFNQFRTSEKPPKYKEKGELEALFFTIQTKRKAMSRKQYQPPQGLFMHDIESAWAQLDYAENERQVAIIAELQRQEKLEQLAQRFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQI-NAHGSL--LSKLSQSANNYIRHKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISAVPQTTLLYKNVEMEMQTHWARSKGMIAGGERLVQ------NGQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRH 779          

HSP 2 Score: 280.026 bits (715), Expect = 5.831e-75
Identity = 369/1663 (22.19%), Postives = 727/1663 (43.72%), Query Frame = 2
Query: 1307 VHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDL---KSENY----YKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMRE----ITIRLQSRDFGKHLLGVENLLEKH--KILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQI-------LSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSG-KVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWT-DDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDI-PKDLQEAERYCTNHLEVKEEIL--CWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLL-ASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEK--MIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFES-EIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETL 6208
            V  +  G  L+ +   + KH+ L+  I AH   ++ L   A++    K E +     K+ EV   Y  +VE+        ++RR  L+R R +   +Q+ +  M W+ E     T  L S D     +    LL K+    + +     +G I    R +Q          ++ +  +  Q+ + ++ L +  +   + L+  +   +Y +D N  + WI+E + L +S D G D  + E L+++  ++        SD++  +++     +S  H  +   S Q       E +E+N               Q+  S+++      +   + + L E+   E      K   TE Y+  +  +++  E +    T        LE +  + +   +   ++ ND+ +L  LA+ R+ LL +N      +   +  E W  AKE + V+L      + +   + +FD  E DMK + G ++   N I+ DLI+E H +   I  +Q+ +N  W+ L  L +Q+   L+       F    +  + W+  K + L+   +D+K            L +L+RD++ +E K+  L K A  +K   P + A I+ +I  +  L  +L    Q++      +   + F   L     W++K + +V  +D+ P D+ EAE     H E+ E+I    +E EY +  + GR++     +P+     E+L  L +E  +L  +++ +D  L +  D Q F R+S +ID      E+FL    L ++ E+ +   +     +  + + + +++A     + ++ A +A S  I  +   + +R +A++    +R   L+  L   E   +   +  WM EK  ++++ D S      I  R  + + FE E+ AN   + ++  +G+ L+ +K H+ES  +E  V ++  QW +L      K  +L +A  +   D   +   + + E+ + + + ++ ++   + +L   ++     ++++      LSDIE   +K+        D       ++  +   ++ P   R+  L + +   Q + DV+ E +WI EK + I   +    TL   L  +++ +    E++ H G+I  +  +  E+I+    +S +      EL   W +L       +   +   + Q+YL +A E E WM+E+   L  ED   DE  A   + KH  L   +  Y   + KL  K   ++  + P      ++Q+ + + +  L ++  +++  +ED +  Y   R    L + I E  +VA S E   + EH   L+ +F EF  Q  + GS R    +   + ++      + ++ + ++ +  AW  L E IE R   L  A +  +F  D  E    + +K+  +P  +G+D K V +  + H A   EI   +P ++  +  A++L   Y G   ++I  R+  L++ W  L+   ++R + L  A DL+ F   VR+L+ W       I +D    D+   E + + H  L  E+D+R+   +  +  G  +I  +H  + +++ K   +      +   W  R  FL   ++ + F REA    A + ++   L +   G ++ +  +  ++    E+ L+   +R  TL
Sbjct:  549 VRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRHKEEQFDVLQRKLDEVTAQYNTLVEL-------CRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALNSGDISA--VPQTTLLYKNVEMEMQTHWARSKGMIAGGERLVQNGQ------SKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAYKSDISRLEEMQSQLANSAFHTATTSQSVQ-------ETEEVNV-------------PQVEMSYNYEGNGMRVSKGEVLALLEKSTPEWWRAL-KRDGTEGYVPANYCKIVPGETVTVTQTTQK-TTTTLEGNETKSSVVADRQHKISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERW--AKE-IEVSLADEPSPEHVAAFRRKFDKLEADMKTNGGTQLKHINDIANDLISEGHGQSRKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSKFEQLDRNPNDVKS-----------LQNLERDLKPLEDKIAALEKLAAAVKKDHPEEAAAIERKIAELRALHADLLRRAQEKMLLAEQTQGKEMFESALRDMIGWIEKTR-KVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQ--ELGRRLLER--NPRMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQRRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKK-HYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDL---LQKHAVLEQEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEK-KPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFK-QKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANMPRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATL 2149          

HSP 3 Score: 268.47 bits (685), Expect = 2.251e-71
Identity = 359/1666 (21.55%), Postives = 727/1666 (43.64%), Query Frame = 2
Query: 1283 WLIENDILVHQKIFGDDLVTIVAAIK----KHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRD---IQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRK---DLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHE---EQMLQ----VEELEKLITELF-GRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNF-ETIETWIIAKEKLLVTLVP--SEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEA-TIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALSDK-IRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDIST----------RYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQK-QERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNL 6178
            W+ E   LV   + GDD     +AI     KHEA E +I A+E RI  +    D L S+ +Y+   VE     +   W  L   +  +  +L +  D   +  IL++    +D   E+   L S+D G  L  V++LL+KH +L  ++     ++ D   + +    D    D D +     QL+  Y  +   +++R+ +L+  ++  + + D++ + +WI E   +  S D G  L     +++K EQ+ ++V       D ++ +   ++ K  +  S Q    I  +  E+      L + +R RR  ++      Q L D  + ++ + E+R    + D G+        L +H    E M      +E+LE    EL    +  +E   ++Q++       +  +F+ L  LA  R++ L   +D   L+    E+ +     +E L V +    +E+ + L  ++ +FD F+  +K  S + +     +  ++    P    + +KQ  L   WN L +  E +  +L +A + ++F  +  E + W+ DKM  +    DL  D++ +  L +   +L +++   + ++  L +EA++LK   P   A  I      + + WEELK    DR   L ++ +L  F   +     W       + +     DLQ+AE   T H  +  E+   EPE+ RL+  G ++  ++      + N + ++L++    L   W  ++  L ++     F R++ QI   +  + + L    +  +    ++  +  + F+ ++++   +   + +    L+ +  +  K I      +H     ++  I+ R++ L+D   L  F  DV  +E W+ EK         R  +D+S+          R    +  E E+ AN+  VD+++++GN+L  +  H   +I  +  EL  +W++L     ++S  LEEA   + F +  +++++W+ E    + T +   +   +      ++  +          + L +I +  EKL +Q     D+ +  QQ +  K   +   L   R  LL    V  F RDVED  E I EK+  +       +   V L  +R+      ++     ++   + + ++++    P  +    +L +L + W+ L  A E   +    + ++ +YL +  + E W ++    +      KD  GA   + +H E  + I+     + +L  +    LN + P      Q+  +RV      L +    +K  ++ L+++          E+W++++       E+G   +   +L +  S F  +T    S ++    +  D L++ G+    +I    + +    A LL+ +E R  +L+ +  + +F+    EL+  I  K++L  +    D  ++ +  +KH AF +E+   E  +S      ++L+       EQ +  + +EL+  W  L+     +   L +A +L+     V ++  W+ ++E ++++DD  RD+   EL+I    +L+ EI  R +     +   R L  +    A+D  K+A++V  ++  + E  + R+E L      +Q+ + A     WL  + +  ++ + GD+L   L+L +KH  LE+ L
Sbjct: 1362 WMYEKAKLV---MSGDDSALAPSAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLKKQVWNKGLRLRQAADQKGLDRILEDAHAKLD---EMQTALNSKDQGLDLRSVKDLLQKHAVLEQEMGLYGNKLSDIENRGKKMAVD-GHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESRLWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVLLQAGELI-KRHHSASSQ----IKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVESWMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHVERFQKRQDE-------LVREFDALSKLAEDRRNAL---EDAVCLYEYMRESADLGQSIEENLRVAMSEEFAEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAWNTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANM--PRDLGRDVKHVHSLWQHHEALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDMLRAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEFARLVNDGEKMITAQHYASEEIKN-KTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAKQIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKARHMESKNISMWQSNVHEELKLLRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKT-----NGVRKAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQL--KNLHRNPKIANRCDELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKD---MEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELL-VRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEEL-RLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFE-ETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQ-VKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKEL 2988          

HSP 4 Score: 266.159 bits (679), Expect = 9.820e-71
Identity = 309/1487 (20.78%), Postives = 671/1487 (45.12%), Query Frame = 2
Query: 2546 ETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNV-LENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLAS-NALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESE-IEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIE--QHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEK----IRLIPEVVGK-DAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNIL-ENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHL----DLERNLAVQADRFETLKKLTSFEETQKSLTAXX-XXXXXXXXXXXXXXTIR-----------------------EFNTPPPTPEPVRKVETIKQLSED---IIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGT-------------LTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKI 6841
            E +  WI  KE L+ T    ++++   ++  R D    D  +    + E N++   L+ +     + + ++Q  LN  W  L       + EL  A++ + F  + ++T   I +K+  ++ +DD   D   +  L R+  +L+RD+ AI  K+   +K+A K+   +P    T+   +  + E WE+L    + R+ +LN S +L K+  D+   + W  +V+ ++ +   PKD   A +    H E K EI     E +RLL    Q + +++ P++    +R +  ++N  + L + W+ +  +L +  +   +  +++Q +  L+ +E+ +++ EL +  +A +   +   AF+ +V     KIDA+    ++L++  N     I  + E++ +R   +   +++R   L+D     EF      L  W++ K+ +A D S+ D  ++ ++  +   F+ EL  N + +  V  +G +L+ +  HF SE ++ ++VEL + W EL   +  K+++L EA          + +  W+ ++  ++ + +     +G   L+ ++  ++    Q +   +  + +E  + A +L+ Q     D+     ++V+ + + ++ P+  RR  L+  +   Q+++  E++ EW+ +++   +  + + ++LQ  L   ++  T   E+D     + D    G++MIR    +S      LD L+     L  +C   +   +E  +  EY +E  E E W+ E+    M ++  +D+ GA + +R+   L   +  + + + +L  +   +L  +   +  +A KQ +++ ++ DL   C  ++ +I D  +++   R    L +W+ E+ + A + + G +LE C  + E+F E  ++       RV       + L+  GH     I      +   W  + E+   R Q L  A    +F  ++ ++L+ + +K    + +  E + + D  SV    ++H+ F   ++ +E  ++     A++L   +   +   +  R++++++    + +  +     L     L  ++   RE++ WM  ++  + ++   RDV   E ++  H     E+  R          GR +I   H  + ++++K  ++L K + +L E W++R E  E  ++V ++ + A   ++WL  +   L  DD+   + +++ + + HL    D    L  Q+++ + +K+LT  E+    L +++  R ++ + +++   TI+                           P P+ E        ++  +D       L   ++Q    +  S+   P Q   E +K  P    T+ T   + G+               RK   ++  K+A  R W   Y ++    +  +K+ + +      +      P+ + GA       Y KR N FR+ +Q+G+E++F   D+ +M +WV KI
Sbjct: 2314 ENVLAWINEKEVLVSTADMGKDMEHCRLLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMK-SDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDG-RSEELRLLHEEGQ-ALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIVTRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLDHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDN-HFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDD-----HGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGE-SGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQF-ESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTR-HHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKV-DILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWL-EERAGLLGDDW--RMVDSVEMAETHLRDFDDFLVTLEAQSEKCDMVKRLTLVEQNFSRLRSKEIDRARIAEDDQKRRDTIKIVEKGNILANRRQERERRKTQEISLLRPSPSGEEFSTHTMPRKERKDRAKTTADLAPGAIQIGDILASSSTVAPLQSGVEMTK-TPSF-NTRRTQSIRKGSRWEDMGAIDMKGFFDRKQCQQSGGKRATIRSWKNYYGILCGQLLCFFKDEQQFL-----ENVAAAPPVYIYGAQCEQYPEYAKRKNSFRLLLQDGSEFIFSCPDERQMLEWVAKI 3777          

HSP 5 Score: 119.398 bits (298), Expect = 2.879e-26
Identity = 160/792 (20.20%), Postives = 348/792 (43.94%), Query Frame = 2
Query: 1331 DLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRN-------RRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKND--FEDLVDLANTRKHLLLNNKDKFHLF-SNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKL---LEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLL---FNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKS-ELPNNYEATKATEREFEAFKNSVASNKPKIDAV 3655
            D   + + ++KH A + ++  +E+R++ +    + L ++N++   +V+     +   W +L      +  +L    ++  + ++ + +  W+ ++   L S D G+ +L  E L++K   L ++I      + +  +K +      +A   D +   E Q+   Y  L    + R + L   +  +++++    D EW+ + + L  S +SG  L+S   L +K   +  ++  R+  + D       +   D   QR    H     I ++LD L  AM         RR+ L ++ D H+   +  +A+  + E+  L  + ++G   +  E +L++      +VE  +  I  L  R + L L  +  +    A ++ K +  F DL      R+  +++   K+H F    + +  W+  KE+        ++L++   I  +F+    ++     +V+   +   DL+   HP    I+ K   +   W  + ++A ++K+ L  A   ++F  E+ +  +W+QDK      +E  D  + DL  +    +R       ++A+E +V  L  EA++L  + P     ++     + E  +++    +    +L     LQ +F++      W+K +Q  + ++ +P+D+   E     H E   E+   +P      + GR++  S     ++L     E++++LE  W  L ++WKD+     E+ D Q + +++ Q+D  L ++   L     + ++ E  +   R+F+ F  ++ +   K D V
Sbjct: 2758 DHTNLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRTKSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAE-QVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMND-----TEQRGKDMIRQR----HFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGL-LAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVD-ASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSS----HVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLLGDDWRMVDSVEMAETHLRDFDDFLVTLEAQSEKCDMV 3533          

HSP 6 Score: 114.39 bits (285), Expect = 1.165e-24
Identity = 118/495 (23.84%), Postives = 227/495 (45.86%), Query Frame = 2
Query: 4775 SEAIECEYWMSEREF------DLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIE---DLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLL-ELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLI-PEVVGKDAKSVATAQRKHNAFATEIERL-EPLIS---NALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKK 6214
            S+  + E W+ E+        DL  E  + DE   +  ++ H+ L + +     +V ++  + + + N  L  +  +A + + +   +  L   C ++ L +E   DL++F  L   ++ +  WI E+  +  + ++G ++EHC LL ER  +     + V    + + + + +KL+  G     ++ + +  +NE W  LL +L   R +LL AA +   F  D  +  + IHEK+  +  +  GKD  SV    RK +A   ++  + + LI+   +A  I +K  P+      + + D   +L++ W  L K  E R+  L  +  LYK+   V+++  W  ++  ++ +    +D  G   I+  H   KAEID R E   +    G+ L   +     +V++  K V      + + W   +  L+ +LE   +  EA   E WL  +E Q+   + GDT +    L++ H   E  +  Q+++ + L K
Sbjct: 2203 SDVAQIEAWIDEKTNGVRKAQDLSSESISIDE--KMKRLQTHQALEAEVTANKPVVDQILQRGNQLKN--LHRNPKIANRCDELSYKWNQLSGACADQSLALEEARDLLRFKQL---VENVLAWINEKEVLVSTADMGKDMEHCRLLLERL-DGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLAHYRTELL-AAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMSAIHQKLIAHDKDAQKILEKRPPL-----RETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYKYLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSDKETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTK 2683          

HSP 7 Score: 89.3521 bits (220), Expect = 3.744e-17
Identity = 100/417 (23.98%), Postives = 182/417 (43.65%), Query Frame = 2
Query: 4976 SHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAA---YDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKI-ELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKK 6214
            S +VA +Q ++   Y +L  +   ++  + D I+    YR     E W A+  +V+ ++E   E  H    R +F +        G  ++K  +++ + LI+ GH +S +I   + +IN  W +L  L + R   L+A     DF      + E +    E++   P     D KS+   +R       +I  LE L +       K  P     +E    +RKI EL+ L   L +  + +            F + +R+++ W+ +    +  D    DV   E ++  H  L  +I  +      C  LGR L+ R +P+ + V ++ + ++ +  ++ + +R R   L+  L++  F RE+   +A     E  L  D+ GD++    NLL++H DLE  L  Q  R E   +
Sbjct:  903 SSVVADRQHKISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERW-AKEIEVSLADEPSPE--HVAAFRRKFDKLEADMKTNGGTQLKHINDIANDLISEGHGQSRKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSKFEQLDRNP----NDVKSLQNLERDLKPLEDKIAALEKLAA----AVKKDHP-----EEAAAIERKIAELRALHADLLRRAQEKMLLAEQTQGKEMFESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGRRLLER-NPRMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGHEAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSR 1302          

HSP 8 Score: 75.0998 bits (183), Expect = 9.349e-13
Identity = 124/645 (19.22%), Postives = 267/645 (41.40%), Query Frame = 2
Query: 2267 LFENSDVGDKLSLTEYYLKQHEE---QMLQVEELEKLITELFGRKNDLELDSQQQNDADEACER-MKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVS----HSKDDPQYLLFNERLNVLE------NEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRES-VDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWV 4156
            + E  + G   S  E  LK+ +     +L  E+  K++T +    N+L  +   ++D     ER + + +  L+ L   RK  L++  D   L  + +T+   + + E  +      + L  +  +  + D  +  +  H   +S+ +Q + + I  +  + +++  K + +   +N L +L   ++  L+ A    QF+ + +E  +W+ +K KL   T     D+  + Q      +++ ++Q   A+ K +    ++L V     +  I   +T +N  WE L++ +      L+ +   Q++F+D +  + W+++    V + D+ +D   AE     H  ++EEI  ++ +  RL +   Q++    H+    Q +   E +NV +       E N + ++ K + ++L E    + +   +L+ DG         ++  +P NY             K                  +L  +   S  + ++  +I +    ++   D R   L D++ LL F  +    E W  E  +  +D      + ++    +F   E +++ N  + +  + +  N LI E      +IE +  ++   W  L     ++  +LE   R   FD T +S   W+
Sbjct:  442 VLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLTAMC---NELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSNELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRHKEEQFDVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCT-TALNSGDISAVPQTTLLYKNVEMEMQTHWARSKGMIAGGERL-VQNGQSKEDIQRRLTQMNHRWERLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHARLEEEIRAYKSDISRLEEMQSQLANSAFHTATTSQSVQETEEVNVPQVEMSYNYEGNGM-RVSKGEVLALLEKSTPEWW--RALKRDG---------TEGYVPANY------------CKIVPGETVTVTQTTQKTTTTLEGNETKSSVVADRQHKISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIEVSLADEP--SPEHVAAFRRKFDKLEADMKTNGGTQLKHINDIANDLISEGHGQSRKIEVRQHKINAMWDNLERLRKQRGVRLEATERVADFDTTCESAREWM 1055          

HSP 9 Score: 64.6994 bits (156), Expect = 1.157e-9
Identity = 111/580 (19.14%), Postives = 226/580 (38.97%), Query Frame = 2
Query: 1280 DWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTAD--FDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSND----PSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFH-------QLLADIEDADAMILEERRLFENSDVGDK-LSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKD------------KFHL------------FSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLL 2905
            +WL +  +L      GD L + ++  KKH  LE ++   +  +N       D+  + ++  T ++     +      L +    RRD L    D      E      W+RE      S++ G+   G E+ L +  +L  ++   +  ID   ++   AD    R   D   +  K+++L   + +L     +R  ++       +++   ++  +W++E  +   + D G DL   +++I +FE      TVR+     +  + V +   D      P    I  +  D +  L  ++++    R+  LN +   H       Q+L  ++D +A  +      E  D+    L+  +  L++H+E M  ++ +EK + EL                     ER+ N F D      TR HL +   D            K HL            F  +  +  W+   +  + +     ++     +  R D +  +M+     V +  +  R +I   H   + I EK +IL   W  L ++ + + +  +  +D  ++   +++  SW++++  LL
Sbjct: 2953 EWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKR---ADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQIIEQFES-----TVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGAD-VQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGV----AMEQEDLSRADLASVKAQLQRHDEFMHGMKAVEKQVAELC-----------------HEAERLWNSFPD------TRHHLEVRRLDMEEQLKDILEAAKKHLEKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQNAEQLDSWLEERAGLL 3496          

HSP 10 Score: 61.6178 bits (148), Expect = 1.060e-8
Identity = 120/665 (18.05%), Postives = 282/665 (42.41%), Query Frame = 2
Query: 2165 AMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLEL-DSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQ---KKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQI---------DGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLAS-----NALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSE-KMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEE 4102
            A++ +R  L ++ + H L   +ED +  + +      + D G  +  TE  +K+ +    ++      + E+  +  +L +  S   +D  +  E+++  +  L +    R+  L++ +  F      E    W+  +  L  +    + L     ++ +    E ++      +++  Q  +D+I ++H     I   Q IL+   + +  L E    ++  LQ A+D +++  E  E + W++++M L   + ++  D  G     RRL  L ++V+  + ++  L K AD L   +  D  +I ++   +  L+ +L      R  ++  +++  KF +  D    WL++ +   + +D  +DL++ ++      E     L    E V  +Q  ++       P       +   ++  W  + ++  ++  +L+ ++    F +++ QI          G+  +QE  LS+++L     + KA  +  + F + + + + ++  + +  E L  S     + L  +  +  EQ+    +A +  +++    L+    L  +  +   + +WM   +  + S+   RD     +   R  ++  E++  +  VD+   +G ++I        EI+ KV  LE  W+ L     ++++  EE
Sbjct: 2823 ALKTQR--LREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQTEIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQAFFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQRGKDMIRQRHFASTHI---QKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQWLREQMPLA-MSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAMSIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYGQDLEDCQQ-IIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWTHVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQED-LSRADLA----SVKAQLQRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRHHLEVRRLDMEEQLKDILEAAKKHLEK----LRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRKPFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEE 3471          
BLAST of Spectrin beta chain vs. Ensembl Fly
Match: beta-Spec (gene:FBgn0250788 transcript:FBtr0334404)

HSP 1 Score: 1485.7 bits (3845), Expect = 0.000e+0
Identity = 877/2303 (38.08%), Postives = 1375/2303 (59.70%), Query Frame = 2
Query:   65 ENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGKRT--SKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRID---DTSRKLQTADFDR-AAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREI------------DEINELLDNLDQAM---RNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSH---SKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNAL-SDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKV-KLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKIN-EIGGVDTSLAKYSTLP 6892
            +  N+S+ L+ERSRIKAL+E+RE+VQKKTFTKWVNSHL +      + DL+VD++DGK L+KLLE+LSGE++P  TKGK+RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN +L LGLIWTIILRFQIQD  I+E D K T  +K++LLLWCQMKTAGY+NVN+RNFT+SW+DGLAFNA++HKHRP++V +  L+K N + NLN AF+ AE + G+ +LLDA D+ V+ P+EKSI+TYV +     +++K    Q KR+G V+  A+  +K++++YE  + +LL+WI+  I  +   +   SL GV+ QL  FSNYR  EKPPKF ++G LE+  F +QSK+RA+N+K Y P EGK+IS IN+AW+ LEK+EH  EL L EELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DIFA+EER+ A+  + D+L+SE Y+ +  +      ++ +W  LL+ L+ RR +L+    +Q   QE  Y++D M EI   L + D+GKHL+GVE+LL+KH ++ +DI  L  R+      S+K  + D +     D + +  + +QL + Y EL+ L+ +R   L   + +W++  D  +++ WIKE  Q+  + + GHDL +V  ++ K + + S++T                 S+DP  Q    +  E+            D + E+L+  D  +   + RR +L  + ++ QL AD +D D  +L+  R+  + DVG   +  +  LK+H++   +++   ++I  L  +   L+L+  ++ + D+  E + N +++L +LA  RK  LL+    + L S  + +E WI  K K+L T+ P ++++++ ++KHRF+ F+ +M  ++ +V+  NQ++R L++ +HP  + I E+QN LN +W+ L + AE K  +L+ A     F +E +ET SWI+DK ++L  TD L+ DL G+M LQRRL  + RD+ AI+AK+  L +EA+ ++   P +   I   I  +  +WE+L  ML++RD++L  + +L +F +DLD F  WL K Q  VA++D P  L EAE+    H  ++EEI  +  +Y  ++++G +++    + DDPQY+   ERLN L++ W  L +MW+++ V L +S D Q F RD+ Q + +L+QQE FLSK + P N E  +   +  EAF  ++ +N  KI+ ++   ++L+  +   +DKI  + E I  R D  + +   ++  L++ + L EF  D+  L EW+ EK   + D SYR  K I +++ R + FE E+ AN+E + E  +   +L  EKP F+  IEPK+ EL  Q+ +L     EK   L +ANRE++  +T   + S++T++  QI++ +       L  +N  M+ Q+    Q+  K + + +I++  E L++  PE   E  ++++   + +  +I+APL +R+  L +KK   QF RDVEDEK WI EKL              V + + ++ ++  TEIDNH  RI  + N G ++I      + KF   + +L + W +L  A E+ ++   E+ +VQ+Y  +A E E WMSE+E  +M ED+ KDE  A N M+KHE L   + +Y + + +L +        D+     VA KQ ++DK+YA L ++  E++ ++ + +Q + L R +  LE+WI +R  VA S E+G + +H  LL ERF+EFA  T  VG  RV   + + D LI  GH +S  IA WKD +NE+W DLLELIETR Q+L A+ +  KF  D  ++L  I EK   + + +G+DA SV+T QRKH  F  ++  L   +      + KL   Y G+K +EIT+R+ E+   W +LQ   + R   L D  DL++F+ MVR L+ WM ++  Q+N  +K RDV GVEL+++NH+SLKAEID+R++N   CI+LG+ L+ R H  + D++ +   +      +L  W ER E L++ILEVYQFAR+AAVAEAWLIAQE  L + + G T++E  NL++KH   E++ A Q +RF  L++LT+FE        ++ + + +  E+     I+E        E   + +   +  +D+ V           + DDSA      E +   +   +   T    E   G +TRKHEW+++TKKA NR W ++Y+  +  ++S   + +       + T++ E   DL  A    A++Y K+ +V R+++ NGA +L +AHD  EM+QWV  +  +      + ++  TLP
Sbjct:   27 DGGNSSSRLFERSRIKALAEERESVQKKTFTKWVNSHLCRVN--CRIADLYVDMRDGKHLIKLLEVLSGERLPKPTKGKMRIHCLENVDKALQFLREQRVHLENIGSHDIVDGNASLNLGLIWTIILRFQIQDITIEEVDNKETKSAKDALLLWCQMKTAGYHNVNVRNFTTSWRDGLAFNAIIHKHRPDLVQFEKLSKTNAIHNLNNAFDVAEDKLGLAKLLDAEDVFVEHPDEKSIITYVVTYYHYFSKLKQETVQGKRIGKVVGIAMENDKMVHDYENFTSDLLKWIETTIQSLGEREFENSLAGVQGQLAQFSNYRTIEKPPKFVEKGNLEVLLFTLQSKMRANNQKPYTPKEGKMISDINKAWERLEKAEHERELALREELIRQEKLEQLAARFDRKASMRETWLSENQRLVSQDNFGFDLAAVEAAAKKHEAIETDIFAYEERVQAVVAVCDELESERYHDVKRILLRKDNVMRLWTYLLELLRARRMRLEISLQLQQNFQEMLYILDNMEEIKQLLMTDDYGKHLMGVEDLLQKHSLVEADINILGERVKVVVQNSQKFLSDDPESYKPCDPEIIVSRVQQLEDAYAELVRLAVERRSRLEESRKLWQFYWDTADEENWIKEKEQIVSTDEVGHDLTTVNLMLSKHKALESEIT-----------------SHDPQLQNVAKVGSELITEGHFGADRIKDRLKEILNKWDHLLDLTKYRRQRLENAVEYFQLFADADDVDNWMLDTLRIVSSEDVGRDEANVQSLLKKHKDVADELKNYAEVIDALHKQAESLKLNEAEKANVDKRLEAIDNRYKELTELAKLRKQRLLDALSLYKLMSEADGVEQWIKEKTKMLDTMTPGKDIEDVEIMKHRFEGFDKEMNANASRVAVVNQLARQLLHVEHPNSDEILERQNHLNQEWSTLREKAEAKMDDLKSAHGVQTFYIECRETISWIEDKKRILTETDSLEMDLTGVMTLQRRLSGMDRDLAAIQAKLSSLEREANSIEDEHPEEAKIIRERIAQIELIWEQLTQMLKERDSKLEEAGDLHRFLRDLDHFQTWLTKTQTDVASEDTPTSLPEAEKLLNQHQSIREEIDNYTEDYKNMMEYGERLTSEGSTSDDPQYMFLRERLNALKDGWEELHQMWENRQVLLSQSLDQQLFNRDARQTEVLLSQQEHFLSKDDTPVNLEQAENQLKRHEAFLTTMEANDDKINTLLQVADTLVEKDHFDADKIGKRAENITGRRDDNRQRALDQHEKLKNQVKLHEFLQDLEELAEWVQEKYATSQDESYRSAKTIHSKWTRHQAFEAEIAANKERLFEAEKSAQELSKEKPEFKDVIEPKLKELAKQFDDLEVHTKEKGAMLFDANREVLVQQTCDDIDSYITDLEKQIVSGDTAN---DLTSVNILMQKQQVIQTQMAVKARQVEEIDKQTEYLQKTVPEEKIEPIVVKKTAVLERFEKIKAPLLERQKALEKKKEAFQFCRDVEDEKLWIDEKLPVANSPDYGNSLFNVHVLK-KKNQSLATEIDNHEPRINAICNNGRKLIDEGHEDAKKFEALISDLTQKWQELKDAIENRRKHLLESEKVQQYFFDAQEAESWMSEQELYMMVEDRGKDEISAQNLMKKHENLEQSVEDYANTIRQLGEVARQFSGDDISSGDAVAVKQSQLDKLYAGLKDLAGERRARLNEALQLFMLSREVDDLEQWITDREVVAGSQELGQDFDHVTLLSERFNEFARDTEAVGGERVAKVNGIADNLIQAGHSDSATIAEWKDNLNESWQDLLELIETRTQMLAASRELHKFFHDCKDVLGRILEKQHGVSDELGRDAGSVSTLQRKHYNFLQDLITLYSQVQQIQEESAKLQDAYAGDKAKEITNREQEVLHAWDNLQAMCDARKQKLADTGDLFRFFNMVRILMIWMEDLVRQMNTSEKPRDVSGVELLMNNHQSLKAEIDTREDNFGACISLGKELLTRNHYASADIKDRLMTLSNSRNALLRRWEERWENLQLILEVYQFARDAAVAEAWLIAQEPYLLSSELGHTIDEVENLIKKHEAFEKSAAAQEERFSALERLTTFE-------LKEMKRRQELAEEAERQRIKEEQEAKAASEAAEQAKREAERRDDVDV---------GASHDDSAAKDTAVEFERVVEIQTERGGTPGAGEGHEGYVTRKHEWDSTTKKASNRSWDKVYMAAKAGRISF-YKDQKGYKSNPELTFRGEPSYDLQNAAIEIASDYTKKKHVLRVKLANGALFLLQAHDDTEMSQWVTSLKAQSDSTAVAASRSQTLP 2289          
BLAST of Spectrin beta chain vs. Ensembl Fly
Match: beta-Spec (gene:FBgn0250788 transcript:FBtr0334405)

HSP 1 Score: 1427.54 bits (3694), Expect = 0.000e+0
Identity = 823/2081 (39.55%), Postives = 1275/2081 (61.27%), Query Frame = 2
Query:   65 ENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGKRT--SKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRID---DTSRKLQTADFDR-AAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREI------------DEINELLDNLDQAM---RNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSH---SKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNAL-SDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKV-KLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFE 6229
            +  N+S+ L+ERSRIKAL+E+RE+VQKKTFTKWVNSHL +      + DL+VD++DGK L+KLLE+LSGE++P  TKGK+RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN +L LGLIWTIILRFQIQD  I+E D K T  +K++LLLWCQMKTAGY+NVN+RNFT+SW+DGLAFNA++HKHRP++V +  L+K N + NLN AF+ AE + G+ +LLDA D+ V+ P+EKSI+TYV +     +++K    Q KR+G V+  A+  +K++++YE  + +LL+WI+  I  +   +   SL GV+ QL  FSNYR  EKPPKF ++G LE+  F +QSK+RA+N+K Y P EGK+IS IN+AW+ LEK+EH  EL L EELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DIFA+EER+ A+  + D+L+SE Y+ +  +      ++ +W  LL+ L+ RR +L+    +Q   QE  Y++D M EI   L + D+GKHL+GVE+LL+KH ++ +DI  L  R+      S+K  + D +     D + +  + +QL + Y EL+ L+ +R   L   + +W++  D  +++ WIKE  Q+  + + GHDL +V  ++ K + + S++T                 S+DP  Q    +  E+            D + E+L+  D  +   + RR +L  + ++ QL AD +D D  +L+  R+  + DVG   +  +  LK+H++   +++   ++I  L  +   L+L+  ++ + D+  E + N +++L +LA  RK  LL+    + L S  + +E WI  K K+L T+ P ++++++ ++KHRF+ F+ +M  ++ +V+  NQ++R L++ +HP  + I E+QN LN +W+ L + AE K  +L+ A     F +E +ET SWI+DK ++L  TD L+ DL G+M LQRRL  + RD+ AI+AK+  L +EA+ ++   P +   I   I  +  +WE+L  ML++RD++L  + +L +F +DLD F  WL K Q  VA++D P  L EAE+    H  ++EEI  +  +Y  ++++G +++    + DDPQY+   ERLN L++ W  L +MW+++ V L +S D Q F RD+ Q + +L+QQE FLSK + P N E  +   +  EAF  ++ +N  KI+ ++   ++L+  +   +DKI  + E I  R D  + +   ++  L++ + L EF  D+  L EW+ EK   + D SYR  K I +++ R + FE E+ AN+E + E  +   +L  EKP F+  IEPK+ EL  Q+ +L     EK   L +ANRE++  +T   + S++T++  QI++ +       L  +N  M+ Q+    Q+  K + + +I++  E L++  PE   E  ++++   + +  +I+APL +R+  L +KK   QF RDVEDEK WI EKL              V + + ++ ++  TEIDNH  RI  + N G ++I      + KF   + +L + W +L  A E+ ++   E+ +VQ+Y  +A E E WMSE+E  +M ED+ KDE  A N M+KHE L   + +Y + + +L +        D+     VA KQ ++DK+YA L ++  E++ ++ + +Q + L R +  LE+WI +R  VA S E+G + +H  LL ERF+EFA  T  VG  RV   + + D LI  GH +S  IA WKD +NE+W DLLELIETR Q+L A+ +  KF  D  ++L  I EK   + + +G+DA SV+T QRKH  F  ++  L   +      + KL   Y G+K +EIT+R+ E+   W +LQ   + R   L D  DL++F+ MVR L+ WM ++  Q+N  +K RDV GVEL+++NH+SLKAEID+R++N   CI+LG+ L+ R H  + D++ +   +      +L  W ER E L++ILEVYQFAR+AAVAEAWLIAQE  L + + G T++E  NL++KH   E++ A Q +RF  L++LT+FE
Sbjct:   27 DGGNSSSRLFERSRIKALAEERESVQKKTFTKWVNSHLCRVN--CRIADLYVDMRDGKHLIKLLEVLSGERLPKPTKGKMRIHCLENVDKALQFLREQRVHLENIGSHDIVDGNASLNLGLIWTIILRFQIQDITIEEVDNKETKSAKDALLLWCQMKTAGYHNVNVRNFTTSWRDGLAFNAIIHKHRPDLVQFEKLSKTNAIHNLNNAFDVAEDKLGLAKLLDAEDVFVEHPDEKSIITYVVTYYHYFSKLKQETVQGKRIGKVVGIAMENDKMVHDYENFTSDLLKWIETTIQSLGEREFENSLAGVQGQLAQFSNYRTIEKPPKFVEKGNLEVLLFTLQSKMRANNQKPYTPKEGKMISDINKAWERLEKAEHERELALREELIRQEKLEQLAARFDRKASMRETWLSENQRLVSQDNFGFDLAAVEAAAKKHEAIETDIFAYEERVQAVVAVCDELESERYHDVKRILLRKDNVMRLWTYLLELLRARRMRLEISLQLQQNFQEMLYILDNMEEIKQLLMTDDYGKHLMGVEDLLQKHSLVEADINILGERVKVVVQNSQKFLSDDPESYKPCDPEIIVSRVQQLEDAYAELVRLAVERRSRLEESRKLWQFYWDTADEENWIKEKEQIVSTDEVGHDLTTVNLMLSKHKALESEIT-----------------SHDPQLQNVAKVGSELITEGHFGADRIKDRLKEILNKWDHLLDLTKYRRQRLENAVEYFQLFADADDVDNWMLDTLRIVSSEDVGRDEANVQSLLKKHKDVADELKNYAEVIDALHKQAESLKLNEAEKANVDKRLEAIDNRYKELTELAKLRKQRLLDALSLYKLMSEADGVEQWIKEKTKMLDTMTPGKDIEDVEIMKHRFEGFDKEMNANASRVAVVNQLARQLLHVEHPNSDEILERQNHLNQEWSTLREKAEAKMDDLKSAHGVQTFYIECRETISWIEDKKRILTETDSLEMDLTGVMTLQRRLSGMDRDLAAIQAKLSSLEREANSIEDEHPEEAKIIRERIAQIELIWEQLTQMLKERDSKLEEAGDLHRFLRDLDHFQTWLTKTQTDVASEDTPTSLPEAEKLLNQHQSIREEIDNYTEDYKNMMEYGERLTSEGSTSDDPQYMFLRERLNALKDGWEELHQMWENRQVLLSQSLDQQLFNRDARQTEVLLSQQEHFLSKDDTPVNLEQAENQLKRHEAFLTTMEANDDKINTLLQVADTLVEKDHFDADKIGKRAENITGRRDDNRQRALDQHEKLKNQVKLHEFLQDLEELAEWVQEKYATSQDESYRSAKTIHSKWTRHQAFEAEIAANKERLFEAEKSAQELSKEKPEFKDVIEPKLKELAKQFDDLEVHTKEKGAMLFDANREVLVQQTCDDIDSYITDLEKQIVSGDTAN---DLTSVNILMQKQQVIQTQMAVKARQVEEIDKQTEYLQKTVPEEKIEPIVVKKTAVLERFEKIKAPLLERQKALEKKKEAFQFCRDVEDEKLWIDEKLPVANSPDYGNSLFNVHVLK-KKNQSLATEIDNHEPRINAICNNGRKLIDEGHEDAKKFEALISDLTQKWQELKDAIENRRKHLLESEKVQQYFFDAQEAESWMSEQELYMMVEDRGKDEISAQNLMKKHENLEQSVEDYANTIRQLGEVARQFSGDDISSGDAVAVKQSQLDKLYAGLKDLAGERRARLNEALQLFMLSREVDDLEQWITDREVVAGSQELGQDFDHVTLLSERFNEFARDTEAVGGERVAKVNGIADNLIQAGHSDSATIAEWKDNLNESWQDLLELIETRTQMLAASRELHKFFHDCKDVLGRILEKQHGVSDELGRDAGSVSTLQRKHYNFLQDLITLYSQVQQIQEESAKLQDAYAGDKAKEITNREQEVLHAWDNLQAMCDARKQKLADTGDLFRFFNMVRILMIWMEDLVRQMNTSEKPRDVSGVELLMNNHQSLKAEIDTREDNFGACISLGKELLTRNHYASADIKDRLMTLSNSRNALLRRWEERWENLQLILEVYQFARDAAVAEAWLIAQEPYLLSSELGHTIDEVENLIKKHEAFEKSAAAQEERFSALERLTTFE 2084          
BLAST of Spectrin beta chain vs. Ensembl Fly
Match: kst (gene:FBgn0004167 transcript:FBtr0303857)

HSP 1 Score: 433.335 bits (1113), Expect = 1.294e-121
Identity = 289/758 (38.13%), Postives = 447/758 (58.97%), Query Frame = 2
Query:   92 YERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAID-----EKDGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTL--TKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEG----RIDDTSRKLQTADF-DRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQH 2329
            +E  RIK L E+R  +QKKTFTKW+NS L+K+K    V+DLF DL DG  LLKLLEI+S EK+     G++R+H IENV KS+ FL+ + V  E++GA DIVDGNP LILGLIWTIILRFQIQ+  ID     E   KR++K++LLLWCQ KT GY  VNI +FT+SW+ GL FNAL+H HRP++ +Y T+  +K + ++NLN AF+TA  E G+P LLDA DI   +P+EKSI+TYV S      R+K+ +K  KR+ N++ + + A++    YE L+  LL WI+ K   +E   L  SL G++ +L  F  YR  EKPPK+++R  +E  +F I + L+A N+  Y P +G+L++ I +AW  LE +EH  E+ L +EL+RQ+KLEQL   F +K+ +R+ +L E   ++    +   L  + A +KKHEA+  DI A  ER N L  +A++L  ENY+    V      ++  W++LL+ L+ +R  L +  ++  +L+E     + +RE+  +  S D G HLLGVE LL+ H +    + N  G    R +  +   ++++  D A + Q   D++E      Y EL+  S  R   L   +    ++ED +N++ W+ +  ++ ++  +  DLR+V  L +K + +  ++  RK     ++ +   +   +  P+  EI  R ID + E    L+  +  RR QL  + + +Q   D  +A++ + E+  L  + D G+     +  L++H
Sbjct:   10 FENERIKTLQEERLHIQKKTFTKWMNSFLIKAK--MEVEDLFTDLADGIKLLKLLEIISSEKLGKPNSGRMRVHKIENVNKSLAFLHTK-VRLESIGAEDIVDGNPRLILGLIWTIILRFQIQEIEIDVDEENESSEKRSAKDALLLWCQRKTHGYPGVNITDFTNSWRSGLGFNALIHSHRPDLFEYSTIVNSKNSNLDNLNHAFDTAANELGIPSLLDAEDIDSARPDEKSILTYVASYYHTFARMKNEQKSGKRIANIVGQLMDADRKKMQYEGLTTNLLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTLLKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPRY---LRQVDATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQV-NTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEA-----YSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKP-KSGQMSTAGKRLIGEQHPRSSEIQSR-IDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRH 753          

HSP 2 Score: 344.354 bits (882), Expect = 1.998e-94
Identity = 393/1676 (23.45%), Postives = 739/1676 (44.09%), Query Frame = 2
Query: 1322 FGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRI----DDTSRKLQTADFDRAAIDQDYVDM--KEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRK---FEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFEN--SDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLE-----LDSQQQNDADE---ACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINE-QHP-ELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEAT-IDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNAL-SDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEF----ELIQQEVKVKLT-------EIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRL-KTNNT---EIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEK-IRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEE 6232
             G DL + +A ++KHE  E D+ A E ++  L   +  L+++     + +      +V  W  L +    R D+L    D+Q  L +   ++ W   +   LQ+ +      G   L  +H  +  +I   E +     + +   +QT  +  A +++    M  + ++L   + +  ++ EQ+ D L C+      + D                S D G  +  V+  IRK   FE+++     +  L+ +    ++ +   D S   Q I+   +    ++ D        RR +L  +  + + + D  +A   I E+++  E   +   +  +L E   K  + Q  Q E     +    GR  +++     L S+Q   + E   A E +   ++ L+     R   L   +D     S  + IE WI  KE ++       +L+  N +  + D  + DM++   +V   NQ++  LIN+ Q P + + + +++   N +W QL       +  L  A + + F  +  +T   I +K   +  TD  +D L  +  L RR  +L+RD+ A++ K+      A+ L    P   A  I+ ++  +++ W  L+ +   R + LN +    KF  D+   ++W+  +  ++     P  + + E     H E K EI   +  +  L Q G Q+S      Q     + L VLE     L + W ++   L E+   Q F     Q++  L  +E+FL+  +L ++Y A +   ++ + F+  + ++   +D +  F  S+L      +D IR K   I  R   + +  + R   L     L EF   +  ++ W+ +K+ +A D +YR+  ++ ++  +   F+ EL +N   V  VI +G +LI      + EI  +V  LE  W +L   +  K  +L++A   + F+ +     +W+ E+  Q+ + +   +   +  L             L +  ++ +D+  H E L +Q  ++ ++F      ++ E+  + T        +  PL  RR  L     +QQFLRD EDE +W+ EK     +     + L   L  ++ L K +N+   E+ +    I  L   G++MIR++  +S++     + L K    L       +    +  E Q +  EA E + WM E+   L   D  +DE       +K E L   +  +   + K+A     ++  +   S  +A+K  +V + Y DLL +  E++ ++ +  + +   R  + L EW+ ++  V  S + G ++EH   L   F  F    N     RV+   E  D+LI   +     I   +D   + W +L +L+  R   L  A     +   + E + LI+EK   LI E  G+D +S+    RKH  F +E+  ++  + + L  A KL  +Y   KE  I  ++ E  + W  L++    R N L  A  L  ++   R+L+ W+ E+  +I A + A  V G EL++++ +    EI +RDE  +     G+ LI  KH  A++V  K K +  +H  +     +R+E  E+ L+   F ++A + E W+ ++E QL     GD++ +  +LL++H D E+ +A Q ++F+ +K++T  E+
Sbjct: 1952 LGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKID-LFCF------LRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYD-SANIQTILQGVLARRQKVKD----LCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAE-----VAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRD-LAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHADH--VDTLQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNL-------------LKKHERLEADVAHHGE-LADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEK-----QLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLN-ANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEH-IEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRITMLEQ 3586          

HSP 3 Score: 333.183 bits (853), Expect = 5.624e-91
Identity = 295/1270 (23.23%), Postives = 590/1270 (46.46%), Query Frame = 2
Query: 2444 ERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNF---ETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDD-PQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALSDK-IRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEA------NREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESP---EIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLK 6211
            +R+   +++L ++A  R  LL   +D  HLF  +   +  E W+  KE++    + S+E + ++  K +F+ F  D+   S +V E +        + H +L+ I  +Q  ++  W +L +   Q++K L+ A     F     E + W+ +KM  L+ T  +  DL  +  LQRR  +L+R++  +E KV  +    + +K A PA++  +++    V ++W++++    D   R+ S    Q F         W+  V+ Q+   +  +D++ A      H ++ ++I   + E+V ++Q G+Q+S  K +  + +   ERL     E +A+ + W +K   L +  D Q F R++ +ID      E+FL  + L  + +  +A  +    F+ S+ +    +    +  + L++++    K I ++  Q+  +  A++D+   R   LQ      +F+ +   L+ W+ +K  IA D +YRD  ++  +  + + FEREL AN   +  V + G  L+        E+E +V +L  +W +LL  + +K ++LE+A      NR +   E  K  +  +           ++     L+   + ++ +     Q   +     D   H      Q  E G       +E++ +  ++  P   RR  L +     +F+ +++ E +WI E L      ++  + L       ++ K    EI  H   I      G+ +I    P  ++      +L + W DL   C +  +  + + + Q+YL +A E E W+ ER   L   +  +D   A   + KH+ +   ++ Y  IV+++      ++  + P S ++A KQ+ ++KM   L ++  +++ ++ + +  +  +     +E+WI E+ Q A S + G + EH  LL+ +F +   +  EVG+ RV   + +  KLI     ESP   E+ + ++++  +W +LL+L+  R Q L AA +  +F  D +E L  I +K   + + +G+D  S     RKH  F  ++  LE  +   +  + +L   Y       I  ++ ++   W  L++    R + L  +SDL  F   VR++V+W   +   + A++   D  G   +   H ++  EI++R++       L  +++   H  A DV +K   +L +   +   W +++  LE  ++++ F R+A   +    +Q+  L++ DFG T+ +  N ++KH + ER +  Q ++   L+
Sbjct:  954 QRINQTYDELQEMAQKRHALL---EDSIHLFGFYRECDDFEKWMKEKERM----IKSDEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLD-TAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVAVIERLKA---EQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRV-PEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSL---EDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGT------KELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELG-QNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRV-EVGADRVDQCELLAKKLI---DSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNAS-AIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQ 2196          

HSP 4 Score: 218.779 bits (556), Expect = 3.623e-56
Identity = 358/1703 (21.02%), Postives = 733/1703 (43.04%), Query Frame = 2
Query: 1316 KIFGD----DLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRC---RDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTAD--FDRAAIDQDYVDMKEKQLVNNYQELILLSEQR----EDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRN-------RRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDL----ELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRL-------LQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNAL-SDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKM--IIASDTSYRDTKDISTRYNRFKD---FERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKL--KEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNI--ALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMS------------------EREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFA--IQTNEVGSLR----------VKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNIL-ENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETL 6208
            +I GD    DL  +   ++KH+A E ++ A+E ++  +      L  +   ++ EVE     + + WK LL   + +  KL++    R+    L++    +D   E+   L+S D G  L   ++L+ K +IL S+I   + ++ +    + T D        +   ++   K+L   +++L   +++R    E+ LN +K ++E    ++++ +WI E +   +S + G +L   + L +K +++ +++   + +I   L +     S           H E +++  L   L+QA ++       R  +L+ S    Q L D  + ++ + E   +  +++ G         L +H+   L+++    ++TE+      +      DS+      +  E+M    + L  LA+ R+  L+ +  K   F   + +E WI  +E+   +    ++ + L +++++FD  +  +++ + +V +   +++ LI+ + P    + ++Q  L   W  L  L  Q++++L  A + ++F  +  E    IQDK   L  + +L  DL   + L R+    + D+ A+EA+++ L +++ +L+   P++ + I  +   V   W +LK     R  RL +S++LQ F  D+     W   ++  +  ++   D   A      H  +  EI   E ++  L       +Q G   +   ++    + +ER          L   W  K + L +  D   F+RD+ QID + + Q++ LS S+     E  +   R+ + F+  + + + K+  +   G  L+      S  I+   + + +R   ++D    R   L+D LL  +F  D    + W++EK   + A   SY +  ++  +  + +    F+ E+ AN+  + E+ + G  L+ ++     EI+  +  +   W  LL    ++ + LEEA   + F+     + +W+ +    +  ++   +   L   N  M+  +D D  +    + +  I Q A+KL  + Q P      +  +++      +++  L   R +L     +  F RDV+D  + I EK   ++      + L      IRR +    ++     +I D +    E +   +P     +I   L+EL+K W +L       Q    E     +++S+  E E W++                  E + +L +E K + EG         +E  + +   G  +SK   +       D    +L+      +++++  L E   E+   + +  Q       ++ +E W+A +     ++++G        L ++  EF   +  + V +L+           KDAD + +KL          I R K +       LLEL E R Q L  ++   +F+    E+   + +K+++  +   ++  ++ +  +KH AF  E+    P + + +   ++L+      K+ EI  +   L+  W  L+   + + + L  A D   F   V E  NWM E+E+Q++++D  +D+  V  ++  H  L+A++    E               +H   +++ ++A  V I+ +N L E    R+E LE  L + QF R+A     WL  ++L   + D G +L     L +KH  LE  L  Q    + L
Sbjct: 1418 RIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQAL-VQAGNRVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVD---ELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAEL---VSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFE----LDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQ---------HPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKM---LKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAAL--SQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDER--------QKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRD---LEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRD-LAAVEALIRREEALERDMSAVKQKI-DQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEG--------RQEAFAGLKQQGEQLSKRPQQQQ----PDNVRKYLLV-----LEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHADHVDTLQKFANSILEGEPKDADLIREKLAY--------ILRRKQK-------LLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKD-EIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERAT-VSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQAL 3048          

HSP 5 Score: 181.415 bits (459), Expect = 6.953e-45
Identity = 369/1764 (20.92%), Postives = 747/1764 (42.35%), Query Frame = 2
Query:  998 GDFSNYR-LTEKPPKFQDRGLLEMNFFEIQSKLR-----------ADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNH--FNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHK-TSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLI--TELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAV-------NELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQ-FGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKD---VSLHESKDA---QTFIRDSLQIDGILTQQESFL-----SKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEK--MIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEK--PHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQH---AEKLKEQYPERGDE-FELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMI-RNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEI--GSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHE-KIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLL----PMYGGEK--EQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWR--ERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFG 6118
            GD  NYR L+  P K Q     E      + +LR           A NR   VP     ++ +N+ W +L        L L E+  R  KLEQ  +    NR  +  K  + E D  +     G+DL +    I K + LE +I   ++++  L    DD+    ++    +E     + + +K L D  Q RR KL+   +    + E D    W+ E     +S + G++L   ++L +KHK L ++I+  +  I+      Q+    +   +++ V+   +QL   +Q+L     +R  +L+      +Y+ D    + W+ E   + +S + G D  S  +L+ K + I  ++     ++ +   S      +N P  +   ++  +   I ++L +L +    R+ +L +S   H+   + ++ +  I E+ +   + D G      +    + ++   +VE     +   EL  +K  ++ +S   N+ ++  E+++  +E+L+ L N R+   L+   + H F        + I  +   ++     +L+    +  + + FE+D+     ++    + S  L  +       I+++Q+ +   WN L + +  +   L  + D   F+ + ++  SW  +    L+  + +  D  G   L+ +  ++  +++A E K +YLN+ +D +        A ++ +  A+       +  W + KIML+ +        +L  F +D    D      Q  +++ D  + +++ +     H E  E ++  + E V LLQ  GR++   +         +  N+       L +  K KD   V  ++ +DA     F+RD  +    + +++  L     S +E+ N  E  K  ++  +AF+  VA+N+ +I  + + G  LL+  +  S +I+   E +      +  ++++R   L++    LEF+  +  +E W+ +K  M+ ASDT  RD +  +    +  D + ++  + + V  + +  +KLI++   P     ++ +  +    W +L          L  AN   +F+         + E S  + +T+         +L         ++        +   I+QH   AE L ++YPERG +  E   +E+      ++A    R++IL +     +F+ DV++ + W+ + ++ +   + +P T+  C  ++   +    EI+        L  +GE++  R      D     L  L +L   L  A  +  +   E  ++Q + ++  + E W++ +E  L  +D           ++KH+E   ++  +   V  L    + IL  +   + L+ +K   + +    LLE+  E+K ++    Q     RS+  ++ W+ ++ QVA        S L+  I     F    +      S RV+      ++LI   H    EIA+    +   W  L    +T+   L+ AYD   F     E  + + E +++L  E  GKD  +V+   +KH       ERLE  +++   +AD+L       +  E     EI +R     + + +L +    R  +L D+  L +F     + + W+ E ++   + D    +  V+ +   H SL+AE+ S++      +  G+ +I   H  +  ++ K+ E+L K    L +     R   L+ + E   F  EA  A+AW+  +   L++ D+G
Sbjct: 1421 GD-ENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNR---VPEVESRVADLNKRWKDL--------LTLSEDKGR--KLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSL-ISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSK---VLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKL-IDSESPYANEVEKRQEQLRTSWENLLQLLNQREQ-KLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHV-SDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQK-------IDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEF-ERLIQTQEEKVSLLQEHGRKLIEQR-------HYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQK-HQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTG-RDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGR------DLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQ-SPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLL--HADHVDTLQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSN----SPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKH-------ERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKS-ELLQKQLVQLRDLAAIRRLRLLDAV-ESQLFYVEANEADAWMREKRPVLSSSDYG 3124          

HSP 6 Score: 174.481 bits (441), Expect = 8.135e-43
Identity = 261/1225 (21.31%), Postives = 517/1225 (42.20%), Query Frame = 2
Query: 1253 FNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDL--KSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRID--DTSRKLQTADF-DRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEE--QMLQ---VEELEKLITELF-GRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPS-EELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSE--------------ITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQV----SHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNAL-SDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSY-RDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDL 4825
            FN +    + W+ + +++V     G DL    A ++K + ++ D+   ++R+  +  +AD L  +++       V+         W++L   L   R  L    +I +  ++ D   D + E ++ + S D G+ L  VE L+ + + L  D+  ++ +ID  +T+ +     + +R A    +++ K ++L  ++  L  LS +R+  LN   +  +++ D+   + W+ ++I+   +  S   +   E  +   ++   ++  R++     L     + S  P  Q+ + + + +  + EL   L++A   R   L ++H      A +E  +  +  +     N D+GD  +  E  LK+H+E  ++L    V+ L+K    +  G   D +L         E    +    + L++L+  RK  L  +        +   I+ W++  +KL V L  +  E   L     +   F+ ++  +S +V         LI   H   + I+++  +L  DW +L   ++ KK +LQ A D   F     E  +W+ D+++L   ++D   DL  +  L ++        + +EA V +  + AD+LK     DE    +E              I   N L E L I    R   L  S  LQ+F +D +    WL + Q+   +QD+   L   +     H  ++ E+   EP    LLQ G+Q+      + +  QY     +  +L+ +   L  +   + + L ++ ++Q F  ++ + D  + ++   LS S+   +  + +  +++ E  +  + + KP I+ V      L+  N   S  I  K  Q+    + +      R S L +   L E+  +   L EW+ ++M + +   Y  D + +      F+ F   L AN   V+  +E+G++LI E   + S I+ K  E +  W EL +    +   L  A +  ++D      +  +            I E+YG  L  +    +  +  + +L   +  +  +   A KL E YP+  +  E+ + E     T+++     R+N L Q +++Q +  +  D   WI E L  IT  ++A       L  +   K ++TEI             G+++I+     + +    +  L    + L       ++ +E N + Q +L +A   E W+S RE  L
Sbjct: 2357 FNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGA---QHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAG-LKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHADHVDTLQKFANSILEGEPKDADL-------IREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLV--QKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWM-DEVELQLSSEDYGKDLAAVSNLLKKH-------ERLEADVAHHGELADQLK---QKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGI----RRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQY-----KSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLI-----NEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAEL-LLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQL 3542          

HSP 7 Score: 140.969 bits (354), Expect = 1.164e-32
Identity = 351/1756 (19.99%), Postives = 729/1756 (41.51%), Query Frame = 2
Query: 1145 AINRAWDNLEKSEHRMELRLYEEL--IRQQKLEQLGNH-----FNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDK-----EWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQH---EEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDF---EDLVDLANTRKHLLLNNKDKFHLF-SNFETIETWIIAKEKLLVTLVPSEE----LDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQH--PELEIISEKQNILNLDWNQLADLAEQKKKELQLAV---DYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEAT-------KATEREFEAFKNSVASNKPKIDAVV--NFGES--LLASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSY-RDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEW---IREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRND-FPSSD---KFNIALDELNKL---WDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVS-------KLADKYHH-ILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQV----ACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEV-VGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKE-QEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPK--ANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKK 6214
            +IN   D++EK + R+  + Y+EL  + Q++   L +      F R+    + W+ E + +    I  D+   +  A +K E    D+ A  +R+  +    D  + + + ++ ++      I ++W++L +    R   L+    +++  +  D    WM E  ++L +      L  V+ L  +H+ L  ++  +E +++  +  L  +  +    ++D V+ +++++ + +Q++    +QR  +L   ++  E  + + N+       WI  +     + +S  D+ +   L++K   +  D+       V+ +   + K  +D  P   E +   I+ +    D + +    ++  L Q  D      + +  DA         E +++G  L   E  LK+H   E+ ++  +++ K  ++     N  +L S    D+    +R        + + D A  RK LL  +KD FH F +  + ++ W+  K     T +  +E    L  L     +   FE +++ + G++    +  + L+   +  PE+E    +   LN  W  L  L+E K ++L+ A    ++N+ + ++++    +   ++    + D+ +DL     L  +   L+ ++   + KV  L    D +      +   I++    + + +++L+   Q R A+L  S    KF  +LDS   W+ +      + ++ ++L +A+     H +++ EI   +P   + L  G+ +  S+  P+          LE  W  LE+   ++   L  S  AQ ++ D+ +I+  L ++ + L  +E   + ++        K  E E + +   V        A+V  N  +S  L A   L +K+     ++ S+      +  R   +L  H   LE SD+V   E+W+ E+   AS   Y +D + +    N+F D +  +E   + VD+      KLID +  + +E+E +  +L   W  LL    ++ ++L  A     F       +  + + ++ +           L  L +    + D      Q + ++ D    + +L+ +YP         Q +V     +++   T R + L     +Q FL DV D   W   +R  L+       A     + +Q          EI+    +   LN   + M++   + ++D   K    LDE  KL   W+      E     F   R+ ++  + +   +  +S  +F    ED         N +RKH+E   +I      VS       KL ++ H+   N       ++A++Q+  D        +C  ++ K+ED + +    R     + WI E+ +     A S    + L+  I   ++   F  +       R+++  +    L++  H+ SPEI R  + + EAW  LL  +E R + L+ A D  +F S   ++   I +K  ++     G+D +      RK +   +++   +  + +   +ADKL+       + Q +  R+ +    W  LQ         L  A++++ F   V +  + + E  + +++ D  RD+  VE +I    +L+ ++ +  +      T    LI +K+P+  A  + +K +E+     N+     +RQ  L      ++F  +    E W+     ++N      T+N+    L+ H + +  +  + + F  LK+
Sbjct:  941 SINENADSVEKRQQRIN-QTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERM----IKSDEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTY-LGNSVKNAYPAEKDNVNARQQEVQDMWQQV----QQRGSDLRN-RIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQ--LGKQLSDGKPNMAETVAV-IERLKAEQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSD-----NADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKD-FHKFAAEADDLKVWLQDK-----TRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRVPEVE---SRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALR----SGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLI-SQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQ------RQGRLMESLYKHEYFLE-SDEV---EQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVED----SVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQH----DAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVED-------VQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKD--------LCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEV-AANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLI-KKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQ 2628          

HSP 8 Score: 122.865 bits (307), Expect = 4.214e-27
Identity = 357/1794 (19.90%), Postives = 725/1794 (40.41%), Query Frame = 2
Query: 1247 NHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRI------DDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDE----LNCYKV----MWEYIEDI---------------------NNDKEWIKEIIQLFQSPDSGHDLRSVER-----LIRKFEQILSDVTVRKDLIVDKLDSI--VHKTSNDPSPQRQEIIHREID--EINELLDNLDQAMRNRRNQLNQSHD--------FHQLLAD----------IEDADAMILEERRLFENSDVGDKLSLT----EYYLKQHEEQMLQVEELEKLITELFGRKNDLELDS--QQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFS-NFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMK-LLEWTDDLKD---------DLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATI------DSEITAVNELW-EELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQ-----FGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDS------LQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSE-----------KMIIASDTSYR------DTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESE-IEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDL----------PGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSL--RVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHE-KIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPM--YGG----EKEQEITDRKIELQKLWFSLQKDYENRHNSLMDAS-DLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFG----DTLNETLNLLQKHLDLERNLAVQADRFETLK 6211
            +HF       + WL++   +    I   DL  +++  +KH+ALE +I + + +   +      L  E + + +E++     + E W+ L   ++ RR +L+   +      + +    W+ E    + SRD+G      + LL++H+ L  ++    G I       D   K      + +A + +  ++++++ VN  +  ++  E  EDE    L   KV    M  +++ +                      ND  W        +     + +R VE      ++ K E++ S   V+K ++V ++  +  +   S  P P    ++ R      INE  D++++    R+ ++NQ++D         H LL D           +D +  + E+ R+ + SD G+ +       E ++        +VEE++  + + F R+   +LD    +Q    +  +R+ N        A  ++   L       LF+   +  + W+  K   L T V + +L  +  ++ R    E ++     KV+    +   + N    E + ++ +Q  +   W Q+    +Q+  +L+  +       ES+  Q    +  K LL W D +KD         D+E    L ++   L  D++A + +   + +   +L   KP    T+       +E  A++  W E+ K +LQ  D        LQ F ++ D  D   K  +  +   ++   L E E     HL+ ++ ++  +    ++L+       + +S+   D +Y+   +R N +  +  A++    ++   L  SKD   F  ++      LQ    +   E++   S LP   +  +A ERE  A       N+ ++  V   G++L+ +        N+  ++ SR   +       N   +D L L E  D    LE+  S+           K +   D++ R      D +      N+ +  E E+    + V E++  G+ +     HF ++ IE    EL+ ++ +L +    +  +LEE+     F     S   W+ E      + E     +    L++K K  E + K             Q    + +Q+PER ++ E + Q+++    ++E    +R   L    + QQ+L D  + + W+ E+   +   +   +      + + + KT   E+D ++G +T++ +    M+  + P S         + K+   L       Q    E+    EY  E+ E E W+ E+E     ED  +D           E L  + N +  +  ++      +  C+L          P ++ V ++QE++   + +LL++  +++ K+    + +  +R +      I +++  A S E+G +L   + L  +   F    N++ +L  +++   E   +L A     +  IA+ +D++  AW DL E    R   L A+ D   F++D  +++      +  L  E    DA      + +H+A   EIE  E        ++D ++    Y      EK   + D + +L   W        N+   +++   DL+ F    +++ N     +  +++ D  + V  V+  I  H   +  I +++E  S+    GR LI ++H  + +++   + VL +   + +    R+  LE  L   +F R+ A A+ W+  ++ +L  D         L+E +  LQKH   +  +A    R + ++
Sbjct:  608 HHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAGICTLELSAAEPELPEVEQEEWVNETR--LVPKEVWEDEWVEKLEHKKVTETKMLPHVKSLFPFEGQGMKMDKGEVMLLKSKTNDDWWCVRKDNGVEGFVPANYVREVEPRPVACIVPKAEKVKSLQKVKKTILVRQVVPVKRIKPVSVAPKP----LVQRRTSTQSINENADSVEK----RQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIK-SDEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAV-DTFRRQGHSQLDKIIARQRQIHQIWQRLNN--------AKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQV----QQRGSDLRNRI-------ESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVAVIERLKAEQDAIHRGWAEKQKWLLQCVD--------LQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQD----KILKGFSDNADKLISNDHYDSKYI--GDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRA-------NEGQLRNVTKDGQALVQAG-------NRVPEVESRVADL-------NKRWKDLLTLSE--DKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMA-HGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSL--ISQQHPER-EQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDR-DSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQD----------FEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKN-AALSQELGRDLNSALALLRKHEGF---ENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAW--------NKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQ 2306          

HSP 9 Score: 107.071 bits (266), Expect = 2.118e-22
Identity = 123/505 (24.36%), Postives = 232/505 (45.94%), Query Frame = 2
Query: 1583 TDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRK-----LQTADFDRAAIDQDYVDMKEKQLVNN----YQELILLSEQREDELNCYKVMWEYIEDINNDKE--------WIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKN---DFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKL 3037
            T  L+ W+R+ T+ L+ RD    L G++  L    +   + R +E       R        T +    A++Q   + ++ QLVN+    +Q L      RE  L    +  E +E +N   E        ++KE+IQ+   P     LR V+  ++K E I +D+  R +   D L ++  +   +    ++ +  RE  E+      L + + N+R  L+Q  +   LL +I      + E ++ F + DVG  L   E  L+ H  Q LQV    + +   F R+  L   S +  DA    +R+ +    + +L+  +  R+  L   ++  H   +++  E+W++ K+++  T + +++L  +  ++ +    ED++K    K  + +   + LI EQHP    I  + + L   W  L  L E ++++L+ A +  QF  ++ E +SW+ +K+ L+  + D  +D      L +R   LQ ++ A    +  LN++ADKL
Sbjct:  285 TTNLLSWIRQKTLELEQRDLPNSLEGIQREL----LAFKEYRTIEKPPKYKERSEIEALYFTINTLLKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPRY---LRQVDATLKKHEAISADILARVERFND-LTAMAEELDRENYHGKERVRRRE-QEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKR-FNRQA-LPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVN-SRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKL 777          

HSP 10 Score: 75.485 bits (184), Expect = 7.694e-13
Identity = 82/340 (24.12%), Postives = 151/340 (44.41%), Query Frame = 2
Query: 4871 MRKHEELISVI-------NNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPE-VVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDS 5866
            ++KHE + + I       N+  ++  +L  + +H       G   V ++++ V   +  LLE+   ++L +  +    +L R I    E + E  Q   S ++G  L     L +  S   +Q N  G   +K  +       +  H+++  +A+    + EA+++LL     R   L+ A +F  FM D       + +K R+    +  KD ++V + Q+KH A   EI+  +P  S  +  A K L      +  EI  R   L + W +L+   E R   L DA++ Y+FY    E  +W+ E    +N+ D   D    + ++  HR L+ E+++
Sbjct:  432 LKKHEAISADILARVERFNDLTAMAEELDRENYH-------GKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGET-LKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKP-KSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNA 762          

HSP 11 Score: 62.3882 bits (150), Expect = 7.007e-9
Identity = 44/148 (29.73%), Postives = 76/148 (51.35%), Query Frame = 2
Query: 6530 GTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKIN---------EIGGVDTSLA-KYSTLPNIK--SDFEMPVTEASS 6937
            G+L RKH  ++  KKA  R W + + V+    +  +K+   +      Q      P++++GA    A +Y K+  VFR+++ +G+E+LFEA     +N WV KI+         ++   D S+  + S+ P+IK  S  E PV+  +S
Sbjct: 3752 GSLERKHGLQSGGKKAPVRSWKQFHTVLCGQLVCFFKDENDFL-----QQKTATAPVNILGAKCERADDYTKKKYVFRLKLPDGSEFLFEAPSLDILNDWVRKISFHASLPPNMQLLSYDESMKQQSSSSPDIKVTSSVESPVSSRNS 3894          
BLAST of Spectrin beta chain vs. Ensembl Fly
Match: kst (gene:FBgn0004167 transcript:FBtr0073070)

HSP 1 Score: 433.335 bits (1113), Expect = 1.294e-121
Identity = 289/758 (38.13%), Postives = 447/758 (58.97%), Query Frame = 2
Query:   92 YERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAID-----EKDGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTL--TKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEG----RIDDTSRKLQTADF-DRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQH 2329
            +E  RIK L E+R  +QKKTFTKW+NS L+K+K    V+DLF DL DG  LLKLLEI+S EK+     G++R+H IENV KS+ FL+ + V  E++GA DIVDGNP LILGLIWTIILRFQIQ+  ID     E   KR++K++LLLWCQ KT GY  VNI +FT+SW+ GL FNAL+H HRP++ +Y T+  +K + ++NLN AF+TA  E G+P LLDA DI   +P+EKSI+TYV S      R+K+ +K  KR+ N++ + + A++    YE L+  LL WI+ K   +E   L  SL G++ +L  F  YR  EKPPK+++R  +E  +F I + L+A N+  Y P +G+L++ I +AW  LE +EH  E+ L +EL+RQ+KLEQL   F +K+ +R+ +L E   ++    +   L  + A +KKHEA+  DI A  ER N L  +A++L  ENY+    V      ++  W++LL+ L+ +R  L +  ++  +L+E     + +RE+  +  S D G HLLGVE LL+ H +    + N  G    R +  +   ++++  D A + Q   D++E      Y EL+  S  R   L   +    ++ED +N++ W+ +  ++ ++  +  DLR+V  L +K + +  ++  RK     ++ +   +   +  P+  EI  R ID + E    L+  +  RR QL  + + +Q   D  +A++ + E+  L  + D G+     +  L++H
Sbjct:   10 FENERIKTLQEERLHIQKKTFTKWMNSFLIKAK--MEVEDLFTDLADGIKLLKLLEIISSEKLGKPNSGRMRVHKIENVNKSLAFLHTK-VRLESIGAEDIVDGNPRLILGLIWTIILRFQIQEIEIDVDEENESSEKRSAKDALLLWCQRKTHGYPGVNITDFTNSWRSGLGFNALIHSHRPDLFEYSTIVNSKNSNLDNLNHAFDTAANELGIPSLLDAEDIDSARPDEKSILTYVASYYHTFARMKNEQKSGKRIANIVGQLMDADRKKMQYEGLTTNLLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTLLKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPRY---LRQVDATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQV-NTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEA-----YSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKP-KSGQMSTAGKRLIGEQHPRSSEIQSR-IDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRH 753          

HSP 2 Score: 344.354 bits (882), Expect = 1.998e-94
Identity = 393/1676 (23.45%), Postives = 739/1676 (44.09%), Query Frame = 2
Query: 1322 FGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRI----DDTSRKLQTADFDRAAIDQDYVDM--KEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRK---FEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFEN--SDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLE-----LDSQQQNDADE---ACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINE-QHP-ELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEAT-IDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNAL-SDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEF----ELIQQEVKVKLT-------EIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRL-KTNNT---EIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEK-IRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEE 6232
             G DL + +A ++KHE  E D+ A E ++  L   +  L+++     + +      +V  W  L +    R D+L    D+Q  L +   ++ W   +   LQ+ +      G   L  +H  +  +I   E +     + +   +QT  +  A +++    M  + ++L   + +  ++ EQ+ D L C+      + D                S D G  +  V+  IRK   FE+++     +  L+ +    ++ +   D S   Q I+   +    ++ D        RR +L  +  + + + D  +A   I E+++  E   +   +  +L E   K  + Q  Q E     +    GR  +++     L S+Q   + E   A E +   ++ L+     R   L   +D     S  + IE WI  KE ++       +L+  N +  + D  + DM++   +V   NQ++  LIN+ Q P + + + +++   N +W QL       +  L  A + + F  +  +T   I +K   +  TD  +D L  +  L RR  +L+RD+ A++ K+      A+ L    P   A  I+ ++  +++ W  L+ +   R + LN +    KF  D+   ++W+  +  ++     P  + + E     H E K EI   +  +  L Q G Q+S      Q     + L VLE     L + W ++   L E+   Q F     Q++  L  +E+FL+  +L ++Y A +   ++ + F+  + ++   +D +  F  S+L      +D IR K   I  R   + +  + R   L     L EF   +  ++ W+ +K+ +A D +YR+  ++ ++  +   F+ EL +N   V  VI +G +LI      + EI  +V  LE  W +L   +  K  +L++A   + F+ +     +W+ E+  Q+ + +   +   +  L             L +  ++ +D+  H E L +Q  ++ ++F      ++ E+  + T        +  PL  RR  L     +QQFLRD EDE +W+ EK     +     + L   L  ++ L K +N+   E+ +    I  L   G++MIR++  +S++     + L K    L       +    +  E Q +  EA E + WM E+   L   D  +DE       +K E L   +  +   + K+A     ++  +   S  +A+K  +V + Y DLL +  E++ ++ +  + +   R  + L EW+ ++  V  S + G ++EH   L   F  F    N     RV+   E  D+LI   +     I   +D   + W +L +L+  R   L  A     +   + E + LI+EK   LI E  G+D +S+    RKH  F +E+  ++  + + L  A KL  +Y   KE  I  ++ E  + W  L++    R N L  A  L  ++   R+L+ W+ E+  +I A + A  V G EL++++ +    EI +RDE  +     G+ LI  KH  A++V  K K +  +H  +     +R+E  E+ L+   F ++A + E W+ ++E QL     GD++ +  +LL++H D E+ +A Q ++F+ +K++T  E+
Sbjct: 1952 LGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKID-LFCF------LRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYD-SANIQTILQGVLARRQKVKD----LCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAE-----VAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRD-LAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHADH--VDTLQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNL-------------LKKHERLEADVAHHGE-LADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEK-----QLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLN-ANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEH-IEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRITMLEQ 3586          

HSP 3 Score: 333.183 bits (853), Expect = 5.624e-91
Identity = 295/1270 (23.23%), Postives = 590/1270 (46.46%), Query Frame = 2
Query: 2444 ERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNF---ETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDD-PQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALSDK-IRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEA------NREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESP---EIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLK 6211
            +R+   +++L ++A  R  LL   +D  HLF  +   +  E W+  KE++    + S+E + ++  K +F+ F  D+   S +V E +        + H +L+ I  +Q  ++  W +L +   Q++K L+ A     F     E + W+ +KM  L+ T  +  DL  +  LQRR  +L+R++  +E KV  +    + +K A PA++  +++    V ++W++++    D   R+ S    Q F         W+  V+ Q+   +  +D++ A      H ++ ++I   + E+V ++Q G+Q+S  K +  + +   ERL     E +A+ + W +K   L +  D Q F R++ +ID      E+FL  + L  + +  +A  +    F+ S+ +    +    +  + L++++    K I ++  Q+  +  A++D+   R   LQ      +F+ +   L+ W+ +K  IA D +YRD  ++  +  + + FEREL AN   +  V + G  L+        E+E +V +L  +W +LL  + +K ++LE+A      NR +   E  K  +  +           ++     L+   + ++ +     Q   +     D   H      Q  E G       +E++ +  ++  P   RR  L +     +F+ +++ E +WI E L      ++  + L       ++ K    EI  H   I      G+ +I    P  ++      +L + W DL   C +  +  + + + Q+YL +A E E W+ ER   L   +  +D   A   + KH+ +   ++ Y  IV+++      ++  + P S ++A KQ+ ++KM   L ++  +++ ++ + +  +  +     +E+WI E+ Q A S + G + EH  LL+ +F +   +  EVG+ RV   + +  KLI     ESP   E+ + ++++  +W +LL+L+  R Q L AA +  +F  D +E L  I +K   + + +G+D  S     RKH  F  ++  LE  +   +  + +L   Y       I  ++ ++   W  L++    R + L  +SDL  F   VR++V+W   +   + A++   D  G   +   H ++  EI++R++       L  +++   H  A DV +K   +L +   +   W +++  LE  ++++ F R+A   +    +Q+  L++ DFG T+ +  N ++KH + ER +  Q ++   L+
Sbjct:  954 QRINQTYDELQEMAQKRHALL---EDSIHLFGFYRECDDFEKWMKEKERM----IKSDEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLD-TAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVAVIERLKA---EQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRV-PEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSL---EDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGT------KELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELG-QNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRV-EVGADRVDQCELLAKKLI---DSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNAS-AIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQ 2196          

HSP 4 Score: 218.779 bits (556), Expect = 3.623e-56
Identity = 358/1703 (21.02%), Postives = 733/1703 (43.04%), Query Frame = 2
Query: 1316 KIFGD----DLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRC---RDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTAD--FDRAAIDQDYVDMKEKQLVNNYQELILLSEQR----EDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRN-------RRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDL----ELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRL-------LQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNAL-SDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKM--IIASDTSYRDTKDISTRYNRFKD---FERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKL--KEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNI--ALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMS------------------EREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFA--IQTNEVGSLR----------VKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNIL-ENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETL 6208
            +I GD    DL  +   ++KH+A E ++ A+E ++  +      L  +   ++ EVE     + + WK LL   + +  KL++    R+    L++    +D   E+   L+S D G  L   ++L+ K +IL S+I   + ++ +    + T D        +   ++   K+L   +++L   +++R    E+ LN +K ++E    ++++ +WI E +   +S + G +L   + L +K +++ +++   + +I   L +     S           H E +++  L   L+QA ++       R  +L+ S    Q L D  + ++ + E   +  +++ G         L +H+   L+++    ++TE+      +      DS+      +  E+M    + L  LA+ R+  L+ +  K   F   + +E WI  +E+   +    ++ + L +++++FD  +  +++ + +V +   +++ LI+ + P    + ++Q  L   W  L  L  Q++++L  A + ++F  +  E    IQDK   L  + +L  DL   + L R+    + D+ A+EA+++ L +++ +L+   P++ + I  +   V   W +LK     R  RL +S++LQ F  D+     W   ++  +  ++   D   A      H  +  EI   E ++  L       +Q G   +   ++    + +ER          L   W  K + L +  D   F+RD+ QID + + Q++ LS S+     E  +   R+ + F+  + + + K+  +   G  L+      S  I+   + + +R   ++D    R   L+D LL  +F  D    + W++EK   + A   SY +  ++  +  + +    F+ E+ AN+  + E+ + G  L+ ++     EI+  +  +   W  LL    ++ + LEEA   + F+     + +W+ +    +  ++   +   L   N  M+  +D D  +    + +  I Q A+KL  + Q P      +  +++      +++  L   R +L     +  F RDV+D  + I EK   ++      + L      IRR +    ++     +I D +    E +   +P     +I   L+EL+K W +L       Q    E     +++S+  E E W++                  E + +L +E K + EG         +E  + +   G  +SK   +       D    +L+      +++++  L E   E+   + +  Q       ++ +E W+A +     ++++G        L ++  EF   +  + V +L+           KDAD + +KL          I R K +       LLEL E R Q L  ++   +F+    E+   + +K+++  +   ++  ++ +  +KH AF  E+    P + + +   ++L+      K+ EI  +   L+  W  L+   + + + L  A D   F   V E  NWM E+E+Q++++D  +D+  V  ++  H  L+A++    E               +H   +++ ++A  V I+ +N L E    R+E LE  L + QF R+A     WL  ++L   + D G +L     L +KH  LE  L  Q    + L
Sbjct: 1418 RIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQAL-VQAGNRVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVD---ELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAEL---VSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFE----LDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQ---------HPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKM---LKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAAL--SQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDER--------QKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRD---LEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRD-LAAVEALIRREEALERDMSAVKQKI-DQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEG--------RQEAFAGLKQQGEQLSKRPQQQQ----PDNVRKYLLV-----LEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHADHVDTLQKFANSILEGEPKDADLIREKLAY--------ILRRKQK-------LLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKD-EIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERAT-VSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQAL 3048          

HSP 5 Score: 181.415 bits (459), Expect = 6.953e-45
Identity = 369/1764 (20.92%), Postives = 747/1764 (42.35%), Query Frame = 2
Query:  998 GDFSNYR-LTEKPPKFQDRGLLEMNFFEIQSKLR-----------ADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNH--FNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHK-TSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLI--TELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAV-------NELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQ-FGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKD---VSLHESKDA---QTFIRDSLQIDGILTQQESFL-----SKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEK--MIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEK--PHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQH---AEKLKEQYPERGDE-FELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMI-RNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEI--GSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHE-KIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLL----PMYGGEK--EQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWR--ERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFG 6118
            GD  NYR L+  P K Q     E      + +LR           A NR   VP     ++ +N+ W +L        L L E+  R  KLEQ  +    NR  +  K  + E D  +     G+DL +    I K + LE +I   ++++  L    DD+    ++    +E     + + +K L D  Q RR KL+   +    + E D    W+ E     +S + G++L   ++L +KHK L ++I+  +  I+      Q+    +   +++ V+   +QL   +Q+L     +R  +L+      +Y+ D    + W+ E   + +S + G D  S  +L+ K + I  ++     ++ +   S      +N P  +   ++  +   I ++L +L +    R+ +L +S   H+   + ++ +  I E+ +   + D G      +    + ++   +VE     +   EL  +K  ++ +S   N+ ++  E+++  +E+L+ L N R+   L+   + H F        + I  +   ++     +L+    +  + + FE+D+     ++    + S  L  +       I+++Q+ +   WN L + +  +   L  + D   F+ + ++  SW  +    L+  + +  D  G   L+ +  ++  +++A E K +YLN+ +D +        A ++ +  A+       +  W + KIML+ +        +L  F +D    D      Q  +++ D  + +++ +     H E  E ++  + E V LLQ  GR++   +         +  N+       L +  K KD   V  ++ +DA     F+RD  +    + +++  L     S +E+ N  E  K  ++  +AF+  VA+N+ +I  + + G  LL+  +  S +I+   E +      +  ++++R   L++    LEF+  +  +E W+ +K  M+ ASDT  RD +  +    +  D + ++  + + V  + +  +KLI++   P     ++ +  +    W +L          L  AN   +F+         + E S  + +T+         +L         ++        +   I+QH   AE L ++YPERG +  E   +E+      ++A    R++IL +     +F+ DV++ + W+ + ++ +   + +P T+  C  ++   +    EI+        L  +GE++  R      D     L  L +L   L  A  +  +   E  ++Q + ++  + E W++ +E  L  +D           ++KH+E   ++  +   V  L    + IL  +   + L+ +K   + +    LLE+  E+K ++    Q     RS+  ++ W+ ++ QVA        S L+  I     F    +      S RV+      ++LI   H    EIA+    +   W  L    +T+   L+ AYD   F     E  + + E +++L  E  GKD  +V+   +KH       ERLE  +++   +AD+L       +  E     EI +R     + + +L +    R  +L D+  L +F     + + W+ E ++   + D    +  V+ +   H SL+AE+ S++      +  G+ +I   H  +  ++ K+ E+L K    L +     R   L+ + E   F  EA  A+AW+  +   L++ D+G
Sbjct: 1421 GD-ENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNR---VPEVESRVADLNKRWKDL--------LTLSEDKGR--KLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSL-ISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSK---VLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKL-IDSESPYANEVEKRQEQLRTSWENLLQLLNQREQ-KLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHV-SDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQK-------IDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEF-ERLIQTQEEKVSLLQEHGRKLIEQR-------HYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQK-HQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTG-RDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGR------DLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQ-SPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLL--HADHVDTLQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSN----SPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKH-------ERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKS-ELLQKQLVQLRDLAAIRRLRLLDAV-ESQLFYVEANEADAWMREKRPVLSSSDYG 3124          

HSP 6 Score: 174.481 bits (441), Expect = 8.135e-43
Identity = 261/1225 (21.31%), Postives = 517/1225 (42.20%), Query Frame = 2
Query: 1253 FNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDL--KSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRID--DTSRKLQTADF-DRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEE--QMLQ---VEELEKLITELF-GRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPS-EELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSE--------------ITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQV----SHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNAL-SDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSY-RDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDL 4825
            FN +    + W+ + +++V     G DL    A ++K + ++ D+   ++R+  +  +AD L  +++       V+         W++L   L   R  L    +I +  ++ D   D + E ++ + S D G+ L  VE L+ + + L  D+  ++ +ID  +T+ +     + +R A    +++ K ++L  ++  L  LS +R+  LN   +  +++ D+   + W+ ++I+   +  S   +   E  +   ++   ++  R++     L     + S  P  Q+ + + + +  + EL   L++A   R   L ++H      A +E  +  +  +     N D+GD  +  E  LK+H+E  ++L    V+ L+K    +  G   D +L         E    +    + L++L+  RK  L  +        +   I+ W++  +KL V L  +  E   L     +   F+ ++  +S +V         LI   H   + I+++  +L  DW +L   ++ KK +LQ A D   F     E  +W+ D+++L   ++D   DL  +  L ++        + +EA V +  + AD+LK     DE    +E              I   N L E L I    R   L  S  LQ+F +D +    WL + Q+   +QD+   L   +     H  ++ E+   EP    LLQ G+Q+      + +  QY     +  +L+ +   L  +   + + L ++ ++Q F  ++ + D  + ++   LS S+   +  + +  +++ E  +  + + KP I+ V      L+  N   S  I  K  Q+    + +      R S L +   L E+  +   L EW+ ++M + +   Y  D + +      F+ F   L AN   V+  +E+G++LI E   + S I+ K  E +  W EL +    +   L  A +  ++D      +  +            I E+YG  L  +    +  +  + +L   +  +  +   A KL E YP+  +  E+ + E     T+++     R+N L Q +++Q +  +  D   WI E L  IT  ++A       L  +   K ++TEI             G+++I+     + +    +  L    + L       ++ +E N + Q +L +A   E W+S RE  L
Sbjct: 2357 FNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGA---QHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAG-LKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHADHVDTLQKFANSILEGEPKDADL-------IREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLV--QKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWM-DEVELQLSSEDYGKDLAAVSNLLKKH-------ERLEADVAHHGELADQLK---QKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGI----RRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQY-----KSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLI-----NEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAEL-LLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQL 3542          

HSP 7 Score: 140.969 bits (354), Expect = 1.164e-32
Identity = 351/1756 (19.99%), Postives = 729/1756 (41.51%), Query Frame = 2
Query: 1145 AINRAWDNLEKSEHRMELRLYEEL--IRQQKLEQLGNH-----FNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDK-----EWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQH---EEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDF---EDLVDLANTRKHLLLNNKDKFHLF-SNFETIETWIIAKEKLLVTLVPSEE----LDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQH--PELEIISEKQNILNLDWNQLADLAEQKKKELQLAV---DYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEAT-------KATEREFEAFKNSVASNKPKIDAVV--NFGES--LLASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSY-RDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEW---IREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRND-FPSSD---KFNIALDELNKL---WDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVS-------KLADKYHH-ILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQV----ACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEV-VGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKE-QEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPK--ANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKK 6214
            +IN   D++EK + R+  + Y+EL  + Q++   L +      F R+    + W+ E + +    I  D+   +  A +K E    D+ A  +R+  +    D  + + + ++ ++      I ++W++L +    R   L+    +++  +  D    WM E  ++L +      L  V+ L  +H+ L  ++  +E +++  +  L  +  +    ++D V+ +++++ + +Q++    +QR  +L   ++  E  + + N+       WI  +     + +S  D+ +   L++K   +  D+       V+ +   + K  +D  P   E +   I+ +    D + +    ++  L Q  D      + +  DA         E +++G  L   E  LK+H   E+ ++  +++ K  ++     N  +L S    D+    +R        + + D A  RK LL  +KD FH F +  + ++ W+  K     T +  +E    L  L     +   FE +++ + G++    +  + L+   +  PE+E    +   LN  W  L  L+E K ++L+ A    ++N+ + ++++    +   ++    + D+ +DL     L  +   L+ ++   + KV  L    D +      +   I++    + + +++L+   Q R A+L  S    KF  +LDS   W+ +      + ++ ++L +A+     H +++ EI   +P   + L  G+ +  S+  P+          LE  W  LE+   ++   L  S  AQ ++ D+ +I+  L ++ + L  +E   + ++        K  E E + +   V        A+V  N  +S  L A   L +K+     ++ S+      +  R   +L  H   LE SD+V   E+W+ E+   AS   Y +D + +    N+F D +  +E   + VD+      KLID +  + +E+E +  +L   W  LL    ++ ++L  A     F       +  + + ++ +           L  L +    + D      Q + ++ D    + +L+ +YP         Q +V     +++   T R + L     +Q FL DV D   W   +R  L+       A     + +Q          EI+    +   LN   + M++   + ++D   K    LDE  KL   W+      E     F   R+ ++  + +   +  +S  +F    ED         N +RKH+E   +I      VS       KL ++ H+   N       ++A++Q+  D        +C  ++ K+ED + +    R     + WI E+ +     A S    + L+  I   ++   F  +       R+++  +    L++  H+ SPEI R  + + EAW  LL  +E R + L+ A D  +F S   ++   I +K  ++     G+D +      RK +   +++   +  + +   +ADKL+       + Q +  R+ +    W  LQ         L  A++++ F   V +  + + E  + +++ D  RD+  VE +I    +L+ ++ +  +      T    LI +K+P+  A  + +K +E+     N+     +RQ  L      ++F  +    E W+     ++N      T+N+    L+ H + +  +  + + F  LK+
Sbjct:  941 SINENADSVEKRQQRIN-QTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERM----IKSDEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTY-LGNSVKNAYPAEKDNVNARQQEVQDMWQQV----QQRGSDLRN-RIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQ--LGKQLSDGKPNMAETVAV-IERLKAEQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSD-----NADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKD-FHKFAAEADDLKVWLQDK-----TRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRVPEVE---SRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALR----SGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLI-SQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQ------RQGRLMESLYKHEYFLE-SDEV---EQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVED----SVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQH----DAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVED-------VQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKD--------LCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEV-AANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLI-KKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQ 2628          

HSP 8 Score: 122.865 bits (307), Expect = 4.214e-27
Identity = 357/1794 (19.90%), Postives = 725/1794 (40.41%), Query Frame = 2
Query: 1247 NHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRI------DDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDE----LNCYKV----MWEYIEDI---------------------NNDKEWIKEIIQLFQSPDSGHDLRSVER-----LIRKFEQILSDVTVRKDLIVDKLDSI--VHKTSNDPSPQRQEIIHREID--EINELLDNLDQAMRNRRNQLNQSHD--------FHQLLAD----------IEDADAMILEERRLFENSDVGDKLSLT----EYYLKQHEEQMLQVEELEKLITELFGRKNDLELDS--QQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFS-NFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMK-LLEWTDDLKD---------DLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATI------DSEITAVNELW-EELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQ-----FGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDS------LQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSE-----------KMIIASDTSYR------DTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESE-IEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDL----------PGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSL--RVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHE-KIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPM--YGG----EKEQEITDRKIELQKLWFSLQKDYENRHNSLMDAS-DLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFG----DTLNETLNLLQKHLDLERNLAVQADRFETLK 6211
            +HF       + WL++   +    I   DL  +++  +KH+ALE +I + + +   +      L  E + + +E++     + E W+ L   ++ RR +L+   +      + +    W+ E    + SRD+G      + LL++H+ L  ++    G I       D   K      + +A + +  ++++++ VN  +  ++  E  EDE    L   KV    M  +++ +                      ND  W        +     + +R VE      ++ K E++ S   V+K ++V ++  +  +   S  P P    ++ R      INE  D++++    R+ ++NQ++D         H LL D           +D +  + E+ R+ + SD G+ +       E ++        +VEE++  + + F R+   +LD    +Q    +  +R+ N        A  ++   L       LF+   +  + W+  K   L T V + +L  +  ++ R    E ++     KV+    +   + N    E + ++ +Q  +   W Q+    +Q+  +L+  +       ES+  Q    +  K LL W D +KD         D+E    L ++   L  D++A + +   + +   +L   KP    T+       +E  A++  W E+ K +LQ  D        LQ F ++ D  D   K  +  +   ++   L E E     HL+ ++ ++  +    ++L+       + +S+   D +Y+   +R N +  +  A++    ++   L  SKD   F  ++      LQ    +   E++   S LP   +  +A ERE  A       N+ ++  V   G++L+ +        N+  ++ SR   +       N   +D L L E  D    LE+  S+           K +   D++ R      D +      N+ +  E E+    + V E++  G+ +     HF ++ IE    EL+ ++ +L +    +  +LEE+     F     S   W+ E      + E     +    L++K K  E + K             Q    + +Q+PER ++ E + Q+++    ++E    +R   L    + QQ+L D  + + W+ E+   +   +   +      + + + KT   E+D ++G +T++ +    M+  + P S         + K+   L       Q    E+    EY  E+ E E W+ E+E     ED  +D           E L  + N +  +  ++      +  C+L          P ++ V ++QE++   + +LL++  +++ K+    + +  +R +      I +++  A S E+G +L   + L  +   F    N++ +L  +++   E   +L A     +  IA+ +D++  AW DL E    R   L A+ D   F++D  +++      +  L  E    DA      + +H+A   EIE  E        ++D ++    Y      EK   + D + +L   W        N+   +++   DL+ F    +++ N     +  +++ D  + V  V+  I  H   +  I +++E  S+    GR LI ++H  + +++   + VL +   + +    R+  LE  L   +F R+ A A+ W+  ++ +L  D         L+E +  LQKH   +  +A    R + ++
Sbjct:  608 HHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAGICTLELSAAEPELPEVEQEEWVNETR--LVPKEVWEDEWVEKLEHKKVTETKMLPHVKSLFPFEGQGMKMDKGEVMLLKSKTNDDWWCVRKDNGVEGFVPANYVREVEPRPVACIVPKAEKVKSLQKVKKTILVRQVVPVKRIKPVSVAPKP----LVQRRTSTQSINENADSVEK----RQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIK-SDEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAV-DTFRRQGHSQLDKIIARQRQIHQIWQRLNN--------AKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQV----QQRGSDLRNRI-------ESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVAVIERLKAEQDAIHRGWAEKQKWLLQCVD--------LQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQD----KILKGFSDNADKLISNDHYDSKYI--GDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRA-------NEGQLRNVTKDGQALVQAG-------NRVPEVESRVADL-------NKRWKDLLTLSE--DKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMA-HGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSL--ISQQHPER-EQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDR-DSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQD----------FEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKN-AALSQELGRDLNSALALLRKHEGF---ENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAW--------NKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQ 2306          

HSP 9 Score: 107.071 bits (266), Expect = 2.118e-22
Identity = 123/505 (24.36%), Postives = 232/505 (45.94%), Query Frame = 2
Query: 1583 TDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRK-----LQTADFDRAAIDQDYVDMKEKQLVNN----YQELILLSEQREDELNCYKVMWEYIEDINNDKE--------WIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKN---DFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKL 3037
            T  L+ W+R+ T+ L+ RD    L G++  L    +   + R +E       R        T +    A++Q   + ++ QLVN+    +Q L      RE  L    +  E +E +N   E        ++KE+IQ+   P     LR V+  ++K E I +D+  R +   D L ++  +   +    ++ +  RE  E+      L + + N+R  L+Q  +   LL +I      + E ++ F + DVG  L   E  L+ H  Q LQV    + +   F R+  L   S +  DA    +R+ +    + +L+  +  R+  L   ++  H   +++  E+W++ K+++  T + +++L  +  ++ +    ED++K    K  + +   + LI EQHP    I  + + L   W  L  L E ++++L+ A +  QF  ++ E +SW+ +K+ L+  + D  +D      L +R   LQ ++ A    +  LN++ADKL
Sbjct:  285 TTNLLSWIRQKTLELEQRDLPNSLEGIQREL----LAFKEYRTIEKPPKYKERSEIEALYFTINTLLKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPRY---LRQVDATLKKHEAISADILARVERFND-LTAMAEELDRENYHGKERVRRRE-QEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKR-FNRQA-LPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVN-SRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKL 777          

HSP 10 Score: 75.485 bits (184), Expect = 7.694e-13
Identity = 82/340 (24.12%), Postives = 151/340 (44.41%), Query Frame = 2
Query: 4871 MRKHEELISVI-------NNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPE-VVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDS 5866
            ++KHE + + I       N+  ++  +L  + +H       G   V ++++ V   +  LLE+   ++L +  +    +L R I    E + E  Q   S ++G  L     L +  S   +Q N  G   +K  +       +  H+++  +A+    + EA+++LL     R   L+ A +F  FM D       + +K R+    +  KD ++V + Q+KH A   EI+  +P  S  +  A K L      +  EI  R   L + W +L+   E R   L DA++ Y+FY    E  +W+ E    +N+ D   D    + ++  HR L+ E+++
Sbjct:  432 LKKHEAISADILARVERFNDLTAMAEELDRENYH-------GKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGET-LKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKP-KSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNA 762          

HSP 11 Score: 62.3882 bits (150), Expect = 7.007e-9
Identity = 44/148 (29.73%), Postives = 76/148 (51.35%), Query Frame = 2
Query: 6530 GTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKIN---------EIGGVDTSLA-KYSTLPNIK--SDFEMPVTEASS 6937
            G+L RKH  ++  KKA  R W + + V+    +  +K+   +      Q      P++++GA    A +Y K+  VFR+++ +G+E+LFEA     +N WV KI+         ++   D S+  + S+ P+IK  S  E PV+  +S
Sbjct: 3752 GSLERKHGLQSGGKKAPVRSWKQFHTVLCGQLVCFFKDENDFL-----QQKTATAPVNILGAKCERADDYTKKKYVFRLKLPDGSEFLFEAPSLDILNDWVRKISFHASLPPNMQLLSYDESMKQQSSSSPDIKVTSSVESPVSSRNS 3894          
BLAST of Spectrin beta chain vs. Ensembl Fly
Match: kst (gene:FBgn0004167 transcript:FBtr0073071)

HSP 1 Score: 432.95 bits (1112), Expect = 1.650e-121
Identity = 289/758 (38.13%), Postives = 447/758 (58.97%), Query Frame = 2
Query:   92 YERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAID-----EKDGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTL--TKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEG----RIDDTSRKLQTADF-DRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQH 2329
            +E  RIK L E+R  +QKKTFTKW+NS L+K+K    V+DLF DL DG  LLKLLEI+S EK+     G++R+H IENV KS+ FL+ + V  E++GA DIVDGNP LILGLIWTIILRFQIQ+  ID     E   KR++K++LLLWCQ KT GY  VNI +FT+SW+ GL FNAL+H HRP++ +Y T+  +K + ++NLN AF+TA  E G+P LLDA DI   +P+EKSI+TYV S      R+K+ +K  KR+ N++ + + A++    YE L+  LL WI+ K   +E   L  SL G++ +L  F  YR  EKPPK+++R  +E  +F I + L+A N+  Y P +G+L++ I +AW  LE +EH  E+ L +EL+RQ+KLEQL   F +K+ +R+ +L E   ++    +   L  + A +KKHEA+  DI A  ER N L  +A++L  ENY+    V      ++  W++LL+ L+ +R  L +  ++  +L+E     + +RE+  +  S D G HLLGVE LL+ H +    + N  G    R +  +   ++++  D A + Q   D++E      Y EL+  S  R   L   +    ++ED +N++ W+ +  ++ ++  +  DLR+V  L +K + +  ++  RK     ++ +   +   +  P+  EI  R ID + E    L+  +  RR QL  + + +Q   D  +A++ + E+  L  + D G+     +  L++H
Sbjct:   10 FENERIKTLQEERLHIQKKTFTKWMNSFLIKAK--MEVEDLFTDLADGIKLLKLLEIISSEKLGKPNSGRMRVHKIENVNKSLAFLHTK-VRLESIGAEDIVDGNPRLILGLIWTIILRFQIQEIEIDVDEENESSEKRSAKDALLLWCQRKTHGYPGVNITDFTNSWRSGLGFNALIHSHRPDLFEYSTIVNSKNSNLDNLNHAFDTAANELGIPSLLDAEDIDSARPDEKSILTYVASYYHTFARMKNEQKSGKRIANIVGQLMDADRKKMQYEGLTTNLLSWIRQKTLELEQRDLPNSLEGIQRELLAFKEYRTIEKPPKYKERSEIEALYFTINTLLKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPRY---LRQVDATLKKHEAISADILARVERFNDLTAMAEELDRENYHGKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQV-NTYGETLKRFNRQALPYKSSEHKDAALLAQRLADLEEA-----YSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKP-KSGQMSTAGKRLIGEQHPRSSEIQSR-IDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRH 753          

HSP 2 Score: 344.354 bits (882), Expect = 2.604e-94
Identity = 393/1676 (23.45%), Postives = 739/1676 (44.09%), Query Frame = 2
Query: 1322 FGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRI----DDTSRKLQTADFDRAAIDQDYVDM--KEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRK---FEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFEN--SDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLE-----LDSQQQNDADE---ACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINE-QHP-ELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEAT-IDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNAL-SDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEF----ELIQQEVKVKLT-------EIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRL-KTNNT---EIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEK-IRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEE 6232
             G DL + +A ++KHE  E D+ A E ++  L   +  L+++     + +      +V  W  L +    R D+L    D+Q  L +   ++ W   +   LQ+ +      G   L  +H  +  +I   E +     + +   +QT  +  A +++    M  + ++L   + +  ++ EQ+ D L C+      + D                S D G  +  V+  IRK   FE+++     +  L+ +    ++ +   D S   Q I+   +    ++ D        RR +L  +  + + + D  +A   I E+++  E   +   +  +L E   K  + Q  Q E     +    GR  +++     L S+Q   + E   A E +   ++ L+     R   L   +D     S  + IE WI  KE ++       +L+  N +  + D  + DM++   +V   NQ++  LIN+ Q P + + + +++   N +W QL       +  L  A + + F  +  +T   I +K   +  TD  +D L  +  L RR  +L+RD+ A++ K+      A+ L    P   A  I+ ++  +++ W  L+ +   R + LN +    KF  D+   ++W+  +  ++     P  + + E     H E K EI   +  +  L Q G Q+S      Q     + L VLE     L + W ++   L E+   Q F     Q++  L  +E+FL+  +L ++Y A +   ++ + F+  + ++   +D +  F  S+L      +D IR K   I  R   + +  + R   L     L EF   +  ++ W+ +K+ +A D +YR+  ++ ++  +   F+ EL +N   V  VI +G +LI      + EI  +V  LE  W +L   +  K  +L++A   + F+ +     +W+ E+  Q+ + +   +   +  L             L +  ++ +D+  H E L +Q  ++ ++F      ++ E+  + T        +  PL  RR  L     +QQFLRD EDE +W+ EK     +     + L   L  ++ L K +N+   E+ +    I  L   G++MIR++  +S++     + L K    L       +    +  E Q +  EA E + WM E+   L   D  +DE       +K E L   +  +   + K+A     ++  +   S  +A+K  +V + Y DLL +  E++ ++ +  + +   R  + L EW+ ++  V  S + G ++EH   L   F  F    N     RV+   E  D+LI   +     I   +D   + W +L +L+  R   L  A     +   + E + LI+EK   LI E  G+D +S+    RKH  F +E+  ++  + + L  A KL  +Y   KE  I  ++ E  + W  L++    R N L  A  L  ++   R+L+ W+ E+  +I A + A  V G EL++++ +    EI +RDE  +     G+ LI  KH  A++V  K K +  +H  +     +R+E  E+ L+   F ++A + E W+ ++E QL     GD++ +  +LL++H D E+ +A Q ++F+ +K++T  E+
Sbjct: 1952 LGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKID-LFCF------LRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYD-SANIQTILQGVLARRQKVKD----LCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAE-----VAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRD-LAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHADH--VDTLQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNL-------------LKKHERLEADVAHHGE-LADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEK-----QLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLN-ANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLINEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEH-IEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAELLLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQLKDTKLGDSIPQVEDLLRRHEDFEKTVAAQEEKFQAIKRITMLEQ 3586          

HSP 3 Score: 332.798 bits (852), Expect = 7.906e-91
Identity = 295/1270 (23.23%), Postives = 590/1270 (46.46%), Query Frame = 2
Query: 2444 ERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNF---ETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDD-PQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALSDK-IRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEA------NREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESP---EIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLK 6211
            +R+   +++L ++A  R  LL   +D  HLF  +   +  E W+  KE++    + S+E + ++  K +F+ F  D+   S +V E +        + H +L+ I  +Q  ++  W +L +   Q++K L+ A     F     E + W+ +KM  L+ T  +  DL  +  LQRR  +L+R++  +E KV  +    + +K A PA++  +++    V ++W++++    D   R+ S    Q F         W+  V+ Q+   +  +D++ A      H ++ ++I   + E+V ++Q G+Q+S  K +  + +   ERL     E +A+ + W +K   L +  D Q F R++ +ID      E+FL  + L  + +  +A  +    F+ S+ +    +    +  + L++++    K I ++  Q+  +  A++D+   R   LQ      +F+ +   L+ W+ +K  IA D +YRD  ++  +  + + FEREL AN   +  V + G  L+        E+E +V +L  +W +LL  + +K ++LE+A      NR +   E  K  +  +           ++     L+   + ++ +     Q   +     D   H      Q  E G       +E++ +  ++  P   RR  L +     +F+ +++ E +WI E L      ++  + L       ++ K    EI  H   I      G+ +I    P  ++      +L + W DL   C +  +  + + + Q+YL +A E E W+ ER   L   +  +D   A   + KH+ +   ++ Y  IV+++      ++  + P S ++A KQ+ ++KM   L ++  +++ ++ + +  +  +     +E+WI E+ Q A S + G + EH  LL+ +F +   +  EVG+ RV   + +  KLI     ESP   E+ + ++++  +W +LL+L+  R Q L AA +  +F  D +E L  I +K   + + +G+D  S     RKH  F  ++  LE  +   +  + +L   Y       I  ++ ++   W  L++    R + L  +SDL  F   VR++V+W   +   + A++   D  G   +   H ++  EI++R++       L  +++   H  A DV +K   +L +   +   W +++  LE  ++++ F R+A   +    +Q+  L++ DFG T+ +  N ++KH + ER +  Q ++   L+
Sbjct:  954 QRINQTYDELQEMAQKRHALL---EDSIHLFGFYRECDDFEKWMKEKERM----IKSDEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLD-TAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQVQQRGSDLRNRIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVAVIERLKA---EQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSDNADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRV-PEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSL---EDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGT------KELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELG-QNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRV-EVGADRVDQCELLAKKLI---DSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNAS-AIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQ 2196          

HSP 4 Score: 218.009 bits (554), Expect = 4.995e-56
Identity = 358/1703 (21.02%), Postives = 733/1703 (43.04%), Query Frame = 2
Query: 1316 KIFGD----DLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRC---RDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTAD--FDRAAIDQDYVDMKEKQLVNNYQELILLSEQR----EDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRN-------RRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDL----ELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRL-------LQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNAL-SDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKM--IIASDTSYRDTKDISTRYNRFKD---FERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKL--KEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNI--ALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMS------------------EREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFA--IQTNEVGSLR----------VKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNIL-ENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETL 6208
            +I GD    DL  +   ++KH+A E ++ A+E ++  +      L  +   ++ EVE     + + WK LL   + +  KL++    R+    L++    +D   E+   L+S D G  L   ++L+ K +IL S+I   + ++ +    + T D        +   ++   K+L   +++L   +++R    E+ LN +K ++E    ++++ +WI E +   +S + G +L   + L +K +++ +++   + +I   L +     S           H E +++  L   L+QA ++       R  +L+ S    Q L D  + ++ + E   +  +++ G         L +H+   L+++    ++TE+      +      DS+      +  E+M    + L  LA+ R+  L+ +  K   F   + +E WI  +E+   +    ++ + L +++++FD  +  +++ + +V +   +++ LI+ + P    + ++Q  L   W  L  L  Q++++L  A + ++F  +  E    IQDK   L  + +L  DL   + L R+    + D+ A+EA+++ L +++ +L+   P++ + I  +   V   W +LK     R  RL +S++LQ F  D+     W   ++  +  ++   D   A      H  +  EI   E ++  L       +Q G   +   ++    + +ER          L   W  K + L +  D   F+RD+ QID + + Q++ LS S+     E  +   R+ + F+  + + + K+  +   G  L+      S  I+   + + +R   ++D    R   L+D LL  +F  D    + W++EK   + A   SY +  ++  +  + +    F+ E+ AN+  + E+ + G  L+ ++     EI+  +  +   W  LL    ++ + LEEA   + F+     + +W+ +    +  ++   +   L   N  M+  +D D  +    + +  I Q A+KL  + Q P      +  +++      +++  L   R +L     +  F RDV+D  + I EK   ++      + L      IRR +    ++     +I D +    E +   +P     +I   L+EL+K W +L       Q    E     +++S+  E E W++                  E + +L +E K + EG         +E  + +   G  +SK   +       D    +L+      +++++  L E   E+   + +  Q       ++ +E W+A +     ++++G        L ++  EF   +  + V +L+           KDAD + +KL          I R K +       LLEL E R Q L  ++   +F+    E+   + +K+++  +   ++  ++ +  +KH AF  E+    P + + +   ++L+      K+ EI  +   L+  W  L+   + + + L  A D   F   V E  NWM E+E+Q++++D  +D+  V  ++  H  L+A++    E               +H   +++ ++A  V I+ +N L E    R+E LE  L + QF R+A     WL  ++L   + D G +L     L +KH  LE  L  Q    + L
Sbjct: 1418 RIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQAL-VQAGNRVPEVESRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVD---ELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAEL---VSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFE----LDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLISQQ---------HPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKM---LKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAAL--SQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDER--------QKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRD---LEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRD-LAAVEALIRREEALERDMSAVKQKI-DQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEG--------RQEAFAGLKQQGEQLSKRPQQQQ----PDNVRKYLLV-----LEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHADHVDTLQKFANSILEGEPKDADLIREKLAY--------ILRRKQK-------LLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKD-EIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKHERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERAT-VSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQAL 3048          

HSP 5 Score: 181.415 bits (459), Expect = 7.830e-45
Identity = 369/1764 (20.92%), Postives = 747/1764 (42.35%), Query Frame = 2
Query:  998 GDFSNYR-LTEKPPKFQDRGLLEMNFFEIQSKLR-----------ADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNH--FNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHK-TSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLI--TELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAV-------NELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQ-FGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKD---VSLHESKDA---QTFIRDSLQIDGILTQQESFL-----SKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEK--MIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEK--PHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQH---AEKLKEQYPERGDE-FELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMI-RNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEI--GSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHE-KIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLL----PMYGGEK--EQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWR--ERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFG 6118
            GD  NYR L+  P K Q     E      + +LR           A NR   VP     ++ +N+ W +L        L L E+  R  KLEQ  +    NR  +  K  + E D  +     G+DL +    I K + LE +I   ++++  L    DD+    ++    +E     + + +K L D  Q RR KL+   +    + E D    W+ E     +S + G++L   ++L +KHK L ++I+  +  I+      Q+    +   +++ V+   +QL   +Q+L     +R  +L+      +Y+ D    + W+ E   + +S + G D  S  +L+ K + I  ++     ++ +   S      +N P  +   ++  +   I ++L +L +    R+ +L +S   H+   + ++ +  I E+ +   + D G      +    + ++   +VE     +   EL  +K  ++ +S   N+ ++  E+++  +E+L+ L N R+   L+   + H F        + I  +   ++     +L+    +  + + FE+D+     ++    + S  L  +       I+++Q+ +   WN L + +  +   L  + D   F+ + ++  SW  +    L+  + +  D  G   L+ +  ++  +++A E K +YLN+ +D +        A ++ +  A+       +  W + KIML+ +        +L  F +D    D      Q  +++ D  + +++ +     H E  E ++  + E V LLQ  GR++   +         +  N+       L +  K KD   V  ++ +DA     F+RD  +    + +++  L     S +E+ N  E  K  ++  +AF+  VA+N+ +I  + + G  LL+  +  S +I+   E +      +  ++++R   L++    LEF+  +  +E W+ +K  M+ ASDT  RD +  +    +  D + ++  + + V  + +  +KLI++   P     ++ +  +    W +L          L  AN   +F+         + E S  + +T+         +L         ++        +   I+QH   AE L ++YPERG +  E   +E+      ++A    R++IL +     +F+ DV++ + W+ + ++ +   + +P T+  C  ++   +    EI+        L  +GE++  R      D     L  L +L   L  A  +  +   E  ++Q + ++  + E W++ +E  L  +D           ++KH+E   ++  +   V  L    + IL  +   + L+ +K   + +    LLE+  E+K ++    Q     RS+  ++ W+ ++ QVA        S L+  I     F    +      S RV+      ++LI   H    EIA+    +   W  L    +T+   L+ AYD   F     E  + + E +++L  E  GKD  +V+   +KH       ERLE  +++   +AD+L       +  E     EI +R     + + +L +    R  +L D+  L +F     + + W+ E ++   + D    +  V+ +   H SL+AE+ S++      +  G+ +I   H  +  ++ K+ E+L K    L +     R   L+ + E   F  EA  A+AW+  +   L++ D+G
Sbjct: 1421 GD-ENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNR---VPEVESRVADLNKRWKDL--------LTLSEDKGR--KLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSL-ISQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSK---VLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKL-IDSESPYANEVEKRQEQLRTSWENLLQLLNQREQ-KLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHV-SDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQK-------IDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEF-ERLIQTQEEKVSLLQEHGRKLIEQR-------HYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQK-HQAFQAEVAANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTG-RDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGR------DLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQ-SPSTINDCETQLELHQERKVEIEGRQEAFAGLKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLL--HADHVDTLQKFANSILEGEPKDADLIREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLVQKLQVALDENYREPSNLQSKIQKHAAFDAELLSN----SPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWMDEVELQLSSEDYGKDLAAVSNLLKKH-------ERLEADVAHHGELADQLKQKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGIRRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQYKS-ELLQKQLVQLRDLAAIRRLRLLDAV-ESQLFYVEANEADAWMREKRPVLSSSDYG 3124          

HSP 6 Score: 174.481 bits (441), Expect = 9.635e-43
Identity = 261/1225 (21.31%), Postives = 517/1225 (42.20%), Query Frame = 2
Query: 1253 FNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDL--KSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRID--DTSRKLQTADF-DRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEE--QMLQ---VEELEKLITELF-GRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPS-EELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSE--------------ITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQV----SHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNAL-SDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSY-RDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDL 4825
            FN +    + W+ + +++V     G DL    A ++K + ++ D+   ++R+  +  +AD L  +++       V+         W++L   L   R  L    +I +  ++ D   D + E ++ + S D G+ L  VE L+ + + L  D+  ++ +ID  +T+ +     + +R A    +++ K ++L  ++  L  LS +R+  LN   +  +++ D+   + W+ ++I+   +  S   +   E  +   ++   ++  R++     L     + S  P  Q+ + + + +  + EL   L++A   R   L ++H      A +E  +  +  +     N D+GD  +  E  LK+H+E  ++L    V+ L+K    +  G   D +L         E    +    + L++L+  RK  L  +        +   I+ W++  +KL V L  +  E   L     +   F+ ++  +S +V         LI   H   + I+++  +L  DW +L   ++ KK +LQ A D   F     E  +W+ D+++L   ++D   DL  +  L ++        + +EA V +  + AD+LK     DE    +E              I   N L E L I    R   L  S  LQ+F +D +    WL + Q+   +QD+   L   +     H  ++ E+   EP    LLQ G+Q+      + +  QY     +  +L+ +   L  +   + + L ++ ++Q F  ++ + D  + ++   LS S+   +  + +  +++ E  +  + + KP I+ V      L+  N   S  I  K  Q+    + +      R S L +   L E+  +   L EW+ ++M + +   Y  D + +      F+ F   L AN   V+  +E+G++LI E   + S I+ K  E +  W EL +    +   L  A +  ++D      +  +            I E+YG  L  +    +  +  + +L   +  +  +   A KL E YP+  +  E+ + E     T+++     R+N L Q +++Q +  +  D   WI E L  IT  ++A       L  +   K ++TEI             G+++I+     + +    +  L    + L       ++ +E N + Q +L +A   E W+S RE  L
Sbjct: 2357 FNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLIKKYPERGA---QHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAG-LKQQGEQLSKRPQQQQPDNVRKYLLVLEELHQTLNEAWSERARDLTEAHQLQLFKAQVEQVEIWLANKEAFLNNDDLGDSYTAVERLLKKHDEFEKLLHADHVDTLQKFANSILEGEPKDADL-------IREKLAYILRRKQKLLELSEERKQRLTQSHQLQEFLRSLYEIDRWLV--QKLQVALDENYREPSNLQSKIQKHAAFDAELLSNSPRVQSVIHEGERLIRGDHFAKDEIAQQVQLLEGDWLKLKGASQTKKDKLQQAYDALAFNRSVDEFNNWM-DEVELQLSSEDYGKDLAAVSNLLKKH-------ERLEADVAHHGELADQLK---QKDEQFFQAEHFLRHEIHERATVSIRRYNTLHEPLGI----RRENLEDSLSLQQFLRDAEDELQWLAEKQLVAGSQDLGTSLLSVQGLQKKHNSLEAELTSQEPLIQALLQRGQQMIRDNHFASEQLQY-----KSELLQKQLVQLRDLAAIRRLRLLDAVESQLFYVEANEADAWMREKRPVLSSSDYGRDEVSVQGHQKKLEVLQRELTAFKPSIEKVAKLATGLIERNHFDSSNIAEKNAQVGQEYEDLLRLAKERESRLGECKKLFEYLRETEELHEWVGDQMAVTASEDYGEDVEHVEQLILAFESFVSNLNANEARVEACLERGDRLIQENNPYRSSIKSKRDETKQLWEELKDLVHARQDALAGAKQVHVYDRVADETIQLI-----NEKDASLISEDYGQDLESIQALGRKHQVFESELVGIQGQVDSVLAEAAKLGEIYPDAKEHIEVKRDETVEAWTDLKEKTAARKNKLSQAEQLQSYFDEYRDLIAWINEMLAKITAPELANSVAGAEL-LLASTKDHDTEIRTRDETFAKFAANGQQLIKEKHFLAHEVEDKIKVLQARHELLKHTLNKRREIYELNLDTQLFLKDAEILEQWISSREPQL 3542          

HSP 7 Score: 140.584 bits (353), Expect = 1.657e-32
Identity = 351/1756 (19.99%), Postives = 729/1756 (41.51%), Query Frame = 2
Query: 1145 AINRAWDNLEKSEHRMELRLYEEL--IRQQKLEQLGNH-----FNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDK-----EWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQH---EEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDF---EDLVDLANTRKHLLLNNKDKFHLF-SNFETIETWIIAKEKLLVTLVPSEE----LDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQH--PELEIISEKQNILNLDWNQLADLAEQKKKELQLAV---DYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEAT-------KATEREFEAFKNSVASNKPKIDAVV--NFGES--LLASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSY-RDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEW---IREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRND-FPSSD---KFNIALDELNKL---WDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVS-------KLADKYHH-ILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQV----ACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEV-VGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKE-QEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPK--ANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKK 6214
            +IN   D++EK + R+  + Y+EL  + Q++   L +      F R+    + W+ E + +    I  D+   +  A +K E    D+ A  +R+  +    D  + + + ++ ++      I ++W++L +    R   L+    +++  +  D    WM E  ++L +      L  V+ L  +H+ L  ++  +E +++  +  L  +  +    ++D V+ +++++ + +Q++    +QR  +L   ++  E  + + N+       WI  +     + +S  D+ +   L++K   +  D+       V+ +   + K  +D  P   E +   I+ +    D + +    ++  L Q  D      + +  DA         E +++G  L   E  LK+H   E+ ++  +++ K  ++     N  +L S    D+    +R        + + D A  RK LL  +KD FH F +  + ++ W+  K     T +  +E    L  L     +   FE +++ + G++    +  + L+   +  PE+E    +   LN  W  L  L+E K ++L+ A    ++N+ + ++++    +   ++    + D+ +DL     L  +   L+ ++   + KV  L    D +      +   I++    + + +++L+   Q R A+L  S    KF  +LDS   W+ +      + ++ ++L +A+     H +++ EI   +P   + L  G+ +  S+  P+          LE  W  LE+   ++   L  S  AQ ++ D+ +I+  L ++ + L  +E   + ++        K  E E + +   V        A+V  N  +S  L A   L +K+     ++ S+      +  R   +L  H   LE SD+V   E+W+ E+   AS   Y +D + +    N+F D +  +E   + VD+      KLID +  + +E+E +  +L   W  LL    ++ ++L  A     F       +  + + ++ +           L  L +    + D      Q + ++ D    + +L+ +YP         Q +V     +++   T R + L     +Q FL DV D   W   +R  L+       A     + +Q          EI+    +   LN   + M++   + ++D   K    LDE  KL   W+      E     F   R+ ++  + +   +  +S  +F    ED         N +RKH+E   +I      VS       KL ++ H+   N       ++A++Q+  D        +C  ++ K+ED + +    R     + WI E+ +     A S    + L+  I   ++   F  +       R+++  +    L++  H+ SPEI R  + + EAW  LL  +E R + L+ A D  +F S   ++   I +K  ++     G+D +      RK +   +++   +  + +   +ADKL+       + Q +  R+ +    W  LQ         L  A++++ F   V +  + + E  + +++ D  RD+  VE +I    +L+ ++ +  +      T    LI +K+P+  A  + +K +E+     N+     +RQ  L      ++F  +    E W+     ++N      T+N+    L+ H + +  +  + + F  LK+
Sbjct:  941 SINENADSVEKRQQRIN-QTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERM----IKSDEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAVDTFRRQGHSQLDKIIARQRQIHQIWQRLNNAKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTY-LGNSVKNAYPAEKDNVNARQQEVQDMWQQV----QQRGSDLRN-RIESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQ--LGKQLSDGKPNMAETVAV-IERLKAEQDAIHRGWAEKQKWLLQCVDLQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQDKILKGFSD-----NADKLISNDHYDSKYIGDRRNQVLGKRKAVKDRAFERKRLLQASKD-FHKFAAEADDLKVWLQDK-----TRIAGDENYRDLSNLPRKLQKHQAFERELRANEGQLRNVTKDGQALVQAGNRVPEVE---SRVADLNKRWKDLLTLSEDKGRKLEQAASQREHNRSLEDAKKKVDELDSALR----SGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMAHGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSLI-SQQHPEREQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDRDSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQ------RQGRLMESLYKHEYFLE-SDEV---EQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKNAALSQELGRDLNSALALLRKHEGFENDLVALEAQLQVLVED----SVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQH----DAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAWNKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVED-------VQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKD--------LCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEV-AANQGRIQEIQDTGVILLSKQHESSPEIKRAIEIVLEAWQGLLAELEQRGRGLEEAQDSLEFNSQLDKIEAWIRDKEMMVQASDTGRDLEHCNALMRKLDDVDSDMRVDDQRVKHINQLADKLINQAQVPADTQSVDKRRKDFNYNWRQLQGALNAYRALLGGANEIHVFNRDVDDTADRIAEKSLAMSSTDTGRDLAAVEALIRREEALERDMSAVKQKIDQHETAAEFLI-KKYPERGAQHIERKLEELHKSWGNLQALSVKRQSILNEAYLAHKFVSDVKELELWVNDMIKKMNNTQSPSTINDCETQLELHQERKVEIEGRQEAFAGLKQ 2628          

HSP 8 Score: 122.479 bits (306), Expect = 5.073e-27
Identity = 355/1784 (19.90%), Postives = 724/1784 (40.58%), Query Frame = 2
Query: 1247 NHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRI------DDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDE----LNCYKV----MWEYIEDI---------------------NNDKEWIKEIIQLFQSPDSGHDLRSVER-----LIRKFEQILSDVTVRKDLIVDKLDSI--VHKTSNDPSPQRQEIIHREID--EINELLDNLDQAMRNRRNQLNQSHD--------FHQLLAD----------IEDADAMILEERRLFENSDVGDKLSLT----EYYLKQHEEQMLQVEELEKLITELFGRKNDLELDS--QQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFS-NFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMK-LLEWTDDLKD---------DLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATI------DSEITAVNELW-EELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQ-----FGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDS------LQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSE-----------KMIIASDTSYR------DTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESE-IEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSL--RVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHE-KIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPM--YGG----EKEQEITDRKIELQKLWFSLQKDYENRHNSLMDAS-DLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFG----DTLNETLNLLQKHLDLERNLAVQADRFETLK 6211
            +HF       + WL++   +    I   DL  +++  +KH+ALE +I + + +   +      L  E + + +E++     + E W+ L   ++ RR +L+   +      + +    W+ E    + SRD+G      + LL++H+ L  ++    G I       D   K      + +A + +  ++++++ VN  +  ++  E  EDE    L   KV    M  +++ +                      ND  W        +     + +R VE      ++ K E++ S   V+K ++V ++  +  +   S  P P    ++ R      INE  D++++    R+ ++NQ++D         H LL D           +D +  + E+ R+ + SD G+ +       E ++        +VEE++  + + F R+   +LD    +Q    +  +R+ N        A  ++   L       LF+   +  + W+  K   L T V + +L  +  ++ R    E ++     KV+    +   + N    E + ++ +Q  +   W Q+    +Q+  +L+  +       ES+  Q    +  K LL W D +KD         D+E    L ++   L  D++A + +   + +   +L   KP    T+       +E  A++  W E+ K +LQ  D        LQ F ++ D  D   K  +  +   ++   L E E     HL+ ++ ++  +    ++L+       + +S+   D +Y+   +R N +  +  A++    ++   L  SKD   F  ++      LQ    +   E++   S LP   +  +A ERE  A       N+ ++  V   G++L+ +        N+  ++ SR   +       N   +D L L E  D    LE+  S+           K +   D++ R      D +      N+ +  E E+    + V E++  G+ +     HF ++ IE    EL+ ++ +L +    +  +LEE+     F     S   W+ E      + E     +    L++K K  E + K             Q    + +Q+PER ++ E + Q+++    ++E    +R   L    + QQ+L D  + + W+ E+   +   +   +      + + + KT   E+D ++G +T++ +    M+  + P S         + K+   L       Q    E+    EY  E+ E E W+ E+E     ED  +D         K ++L   +      V +       +++ + P ++ V ++QE++   + +LL++  +++ K+    + +  +R +      I +++  A S E+G +L   + L  +   F    N++ +L  +++   E   +L A     +  IA+ +D++  AW DL E    R   L A+ D   F++D  +++      +  L  E    DA      + +H+A   EIE  E        ++D ++    Y      EK   + D + +L   W        N+   +++   DL+ F    +++ N     +  +++ D  + V  V+  I  H   +  I +++E  S+    GR LI ++H  + +++   + VL +   + +    R+  LE  L   +F R+ A A+ W+  ++ +L  D         L+E +  LQKH   +  +A    R + ++
Sbjct:  608 HHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKLIKAGICTLELSAAEPELPEVEQEEWVNETR--LVPKEVWEDEWVEKLEHKKVTETKMLPHVKSLFPFEGQGMKMDKGEVMLLKSKTNDDWWCVRKDNGVEGFVPANYVREVEPRPVACIVPKAEKVKSLQKVKKTILVRQVVPVKRIKPVSVAPKP----LVQRRTSTQSINENADSVEK----RQQRINQTYDELQEMAQKRHALLEDSIHLFGFYRECDDFEKWMKEKERMIK-SDEGEGVDNAKRKFEKFITDLSAASKRVEEIDGAV-DTFRRQGHSQLDKIIARQRQIHQIWQRLNN--------AKAQREKSLEGASSVELFNRTCDEAKVWMSEKMLQLDTAVITPDLRTVQALQRRHQNLERELAPVEDKVNRVTYLGNSVKNAYPAEKDNVNARQQEVQDMWQQV----QQRGSDLRNRI-------ESEVGQQVFNNSAKVLLAWIDSVKDQLNADESARDVETANNLLKKHNDLGDDIRAHDTEFVEVIQLGKQLSDGKPNMAETVAVIERLKAEQDAIHRGWAEKQKWLLQCVD--------LQMFNREADKIDATTKSHEAFLEYNNLGASLDEVEAILKRHLDFEKSLMAQD----KILKGFSDNADKLISNDHYDSKYI--GDRRNQVLGKRKAVKDRAFERKRLLQASKDFHKFAAEADDLKVWLQDKTRIAGDENYRDLSNLPRKLQKHQAFERELRA-------NEGQLRNVTKDGQALVQAG-------NRVPEVESRVADL-------NKRWKDLLTLSE--DKGRKLEQAASQREHNRSLEDAKKKVDELDSALRSGDVGNDLRSCKDLINKQQILESEITIWDQKVAELVSTGDDMA-HGGHFNAQNIEAGTKELQQRFKDLRDPTQRRRAKLEESLNYHKFVFELDSEFQWINEHLPAAKSNELGQNLHQAQSLHKKHKKLEAEIKGHQPMINKALVAGQSL--ISQQHPER-EQVESLCQQLEQAWQDLERHCGERSRKLDMSLKAQQYLFDAGEIESWLGERNNVLRSTEYGRDR-DSAAKLLTKHKTIELELDTYSGIVTEMGHSCAAMVAANHPDSKVLAAKQQLIEKMLKSLHKLASQRQGRLMESLYKHEYFLESDEVEQWIREQEQAASSEDYGQDFEHLQLLQNKFDDLKHRVEVGADRVDQCELLAKKLIDSESPYANEVEKRQEQLRTSWENLLQLLNQREQKLHAAGEIHRFHRDVAEALFRIQDKN-AALSQELGRDLNSALALLRKHEGF---ENDLVALEAQLQVLVEDSVRLQAKYPSNASAIAQQQDKVVAAWNDLKERSTARGDRLAASSDLQTFLTDVRDIVSWSSNLRAALQAEEHVSDAAGATALKIQHDAIYGEIEAREDKFRYLNELSDSMVQTGHYAAADVEEKCAAMLDERQKLHAAW--------NKKKIMLEQKIDLFCFLRDAKQIDNLSSSQQAALSSSDFGQTVEDVQNKIRKHDEFERLIQTQEEKVSLLQEHGRKLIEQRHYDSANIQTILQGVLARRQKVKDLCAVRRYKLEDALLYAKFVRDCAEAKYWINEKQKKLEADAASYAEVTNLDEKIKKLQKHQAFQAEVAANQGRIQEIQ 2306          

HSP 9 Score: 107.071 bits (266), Expect = 2.173e-22
Identity = 123/505 (24.36%), Postives = 232/505 (45.94%), Query Frame = 2
Query: 1583 TDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRK-----LQTADFDRAAIDQDYVDMKEKQLVNN----YQELILLSEQREDELNCYKVMWEYIEDINNDKE--------WIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKN---DFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKL 3037
            T  L+ W+R+ T+ L+ RD    L G++  L    +   + R +E       R        T +    A++Q   + ++ QLVN+    +Q L      RE  L    +  E +E +N   E        ++KE+IQ+   P     LR V+  ++K E I +D+  R +   D L ++  +   +    ++ +  RE  E+      L + + N+R  L+Q  +   LL +I      + E ++ F + DVG  L   E  L+ H  Q LQV    + +   F R+  L   S +  DA    +R+ +    + +L+  +  R+  L   ++  H   +++  E+W++ K+++  T + +++L  +  ++ +    ED++K    K  + +   + LI EQHP    I  + + L   W  L  L E ++++L+ A +  QF  ++ E +SW+ +K+ L+  + D  +D      L +R   LQ ++ A    +  LN++ADKL
Sbjct:  285 TTNLLSWIRQKTLELEQRDLPNSLEGIQREL----LAFKEYRTIEKPPKYKERSEIEALYFTINTLLKALNQPPYNPQDGQLVNDIEKAWQILEYAEHHREVALRDELLRQEKLEQLNYKFEKKSVLREGYLKEMIQVLSDPRY---LRQVDATLKKHEAISADILARVERFND-LTAMAEELDRENYHGKERVRRRE-QEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGETLKR-FNRQA-LPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKPKSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVN-SRDYGNDEPSAQALLQRHRDLQGELNAYSGDILNLNQQADKL 777          

HSP 10 Score: 75.485 bits (184), Expect = 7.893e-13
Identity = 75/299 (25.08%), Postives = 134/299 (44.82%), Query Frame = 2
Query: 4973 GSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPE-VVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDS 5866
            G   V ++++ V   +  LLE+   ++L +  +    +L R I    E + E  Q   S ++G  L     L +  S   +Q N  G   +K  +       +  H+++  +A+    + EA+++LL     R   L+ A +F  FM D       + +K R+    +  KD ++V + Q+KH A   EI+  +P  S  +  A K L      +  EI  R   L + W +L+   E R   L DA++ Y+FY    E  +W+ E    +N+ D   D    + ++  HR L+ E+++
Sbjct:  466 GKERVRRREQEVMAKWRQLLELLENQRLNLSQMSNLMNLLREIASTTEAVRELQQQFASEDVGPHLLGVEELLQAHSLQELQVNTYGET-LKRFNRQALPYKSSEHKDAALLAQRLADLEEAYSELLRRSAARRARLEEARNFHHFMEDYDNEESWLVDKQRICKTGITAKDLRAVLSLQQKHKALEDEIKSRKP-KSGQMSTAGKRLIGEQHPRSSEIQSRIDSLAEHWQALEALVELRRRQLEDAAEAYQFYTDANEAESWLNEKIALVNSRDYGNDEPSAQALLQRHRDLQGELNA 762          

HSP 11 Score: 62.3882 bits (150), Expect = 7.751e-9
Identity = 44/148 (29.73%), Postives = 76/148 (51.35%), Query Frame = 2
Query: 6530 GTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKIN---------EIGGVDTSLA-KYSTLPNIK--SDFEMPVTEASS 6937
            G+L RKH  ++  KKA  R W + + V+    +  +K+   +      Q      P++++GA    A +Y K+  VFR+++ +G+E+LFEA     +N WV KI+         ++   D S+  + S+ P+IK  S  E PV+  +S
Sbjct: 3752 GSLERKHGLQSGGKKAPVRSWKQFHTVLCGQLVCFFKDENDFL-----QQKTATAPVNILGAKCERADDYTKKKYVFRLKLPDGSEFLFEAPSLDILNDWVRKISFHASLPPNMQLLSYDESMKQQSSSSPDIKVTSSVESPVSSRNS 3894          
BLAST of Spectrin beta chain vs. Ensembl Zebrafish
Match: sptbn1 (spectrin, beta, non-erythrocytic 1 [Source:ZFIN;Acc:ZDB-GENE-031006-3])

HSP 1 Score: 1374.76 bits (3557), Expect = 0.000e+0
Identity = 823/2279 (36.11%), Postives = 1316/2279 (57.74%), Query Frame = 2
Query:  218 VDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNN--------YQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPV---------RKVETIKQ--LSEDIIVPLQSRSVQSAVAIDDSAEAP-----PKQEVKEKSKENPKLIETKSTTEPKT---GTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPT 6958
            +DL+DG+ L+KLLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  R++K++LLLWCQMKTAGY NVNI NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI VD P+EKS++TYV +     +++K+ + + KR+G V++ AI  EK+I  YE L+ +LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+ A+  +A +L++ENY+ I  +      ++ +W+ LL+ L+ RR +L+    +Q + QE  Y+MDWM E+ + L S+D+GKHLLGVE+LL+KH ++ +DI     R+   +   Q     R A+D++     + Q++ +        YQEL  L+ +R   L   + +W++  ++  ++ WI+E  Q+  S D G DL    RL+ +   +  +++ R   +   +     +   D     +  I   I ++      L+Q    R+ +L ++   HQ  AD +D D   L+  R+   +DVG     T+  +K+H++   +V     +I  L  +   L  +     +  E    ++  ++++ +L   RK  L +    + +FS  +  E WI  KE+ L ++   E+L++L VI+HRF+  E +M   + +V+  NQI+R LI+  HP  + I  +Q+ LN  W+Q  DL +QKK+ L  A+    + L+  ET+SWI++K K++E T +L +DL G+M LQR+L  ++RD+ AIEAK+  L  EAD+L    P     I   +  +  +WEE+K  L+ R+  L  +++LQ+F ++LD F  WL + Q  +A++D+P  L EAE+    H  +K EI  +E +Y ++   G  V+  + D QY+   +RL  L+  WN L KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +E+P   E  +A  ++ E F  ++ +N+ KI+ VV  G  L +  N  +D+I+ +   I  R    ++        L+D+  L +F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL++N+E +D++ ++G +L+ EKP  E+ ++ K+  L+  W+EL  T   K++ L +AN+  +F ++   +  W+  +  QI + +     YG  L  +N  +K Q+  + Q++ +++ + +++  A  L+++  +  DE +  ++ V+ K  E+  PL  R+N L+  + + QF RDVEDE  W+ E++   T        LQ     I++ +T   EI  H  R  D+    + +++ D P+ +     L +L  LW  ++   E      EE  + Q+Y  +A E E WMSE+E  +M E+KAKDE  ++  ++KH+ L   + +Y   V +L+     ++  + P S  +  +Q +VDK+YA L ++  E++ K+E+  + + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   + M D+LI  GH ++  +A WKD +NEAWADLLELI+TR Q+L A+Y+  KF  D+ E+L  I +K + +PE +G+D  +V T QR H  F  +I+ L   +      A +L   Y G+K  +I  R+ E+ + W SL +  E R   L+D  D ++F++MVR+L+ WM ++   I   +K RDV  VEL+++NH+ +KAEID+R+++ + CI LG++L+ RKH  + ++++K  ++  K  ++++ W +R E+L +ILEV+QF+R+A VAEAWL+ QE  L++ + G +++E   L+++H   E++ A   +RF                +A ++   L+  E R      E    PP+P+PV         R+ E I Q  L  D   P      +     + S++ P     P  + + K  ++  L  TK    P     G L RKHEWE   KKA +R W+ +Y VI N +M  YK+ K          Y +E PI L  A+   A +YKK+ +VF++R+ +G EYLF+A D  EMN W++ I   G   +S  K  T P+ +S      T ASS     P 
Sbjct:    1 MDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKRSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSVITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRTELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAVVAVARELETENYHDIKRITARKDNVLRLWEYLLELLKARRQRLEMNLSLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIGIQADRVKAVNNNAQ-----RFAVDEEGYKPCDPQVIRDRVAHMEFCYQELTQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDCGKDLTGAVRLLSQHRALEDEMSGRSGHLQHTVRE--GQAMADAGHFGEAKIRERIADVQAQWAALEQLASVRKTRLEEACSLHQFQADADDVDTWTLDALRIVSTADVGHDEFSTQALVKKHKDASTEVASYRPVIDALHEQAQTLPPEQANSANVSERLAGIEERYKEVSELTRLRKQALQDALALYKMFSEADACELWIDEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKDIKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWIREKTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLRGEADRLAGEHPDQAKAITGRLAEITAVWEEMKETLRTREESLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEINNYEEDYQKMRDMGEMVTQDQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQIFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEDKINGVVEAGRRLASDGNINADRIQERAASIDDRHKKNREAAVELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIEKEGKQLVSEKPETEAVVKEKLAALQKMWTELETTTQTKAQCLFDANKAELFTQSCADLDKWLVGLEGQIQSDD-----YGKDLTSVNILLKKQQMLENQVEVRQREVEELQSQAHVLRQEGKD-TDEVDGRRKVVEQKFQELLDPLLKRKNFLMASREIHQFNRDVEDEILWVEERMPLATSTDHG-NNLQTVQLLIKKNQTLQKEIQGHQPRCDDIFERSQSILKADSPNVEGIRTRLSDLQGLWSLIMQETEKRHSRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSSVAMLKKHQILEQAVEDYAETVHQLSKTSRGLVAANHPESERIGMRQSQVDKLYAGLKDLSEERRGKLEERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDGVNRMADELINAGHADAATVAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEILGRILDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQDDAVRLQSAYAGDKADDIQRREGEVLEAWRSLLEACEGRRARLLDTGDKFRFFSMVRDLMLWMEDVIRLIETQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTDKRKDMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYLSSRELGQSVDEVEKLIKRHEAFEKSAATWEERF----------------SALERLTTLELLEVRRLQEEEERRRKPPSPDPVQAQDGETQQREGEQIAQNGLPSDQDSPRDGVDGEMNGVAERSSKEPSPIPSPGADRRGKGSQSATL-PTKGQETPSAQLEGFLHRKHEWEGHNKKASSRSWHNVYCVINNHEMGFYKDNKNAGQGI---PYHNEIPISLKEAVCEVAVDYKKKKHVFKLRVTDGNEYLFQAKDDEEMNTWIQAIQNAGSGSSSSEKSETAPSNQS------TPASSRAHTLPA 2239          
BLAST of Spectrin beta chain vs. Ensembl Zebrafish
Match: sptbn2 (spectrin, beta, non-erythrocytic 2 [Source:ZFIN;Acc:ZDB-GENE-030131-787])

HSP 1 Score: 1343.95 bits (3477), Expect = 0.000e+0
Identity = 817/2331 (35.05%), Postives = 1331/2331 (57.10%), Query Frame = 2
Query:   65 ENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGR---IDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKL---DSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERG-DEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDK-----FNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEV-VGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKEN--------------PKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIG-------GVDTSLAKYSTLPNIKSDFEMPVTEASSE 6940
            +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL   +    + DL+ DL+DG+ L++LLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVN+ NFT+SW+DGLAFNA++HKHR +++D+  L ++N   NL  AF  AE+E G+ +LLD  D+ VDQP+EKSI+TYV +     +++K+   + KR+G V++ AI A++LI  YE L+ ELL+WI+  I  + + +L  SL  V+ QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLE L   F+RKA MR+ WL EN  LV Q  FG +L  + AA +KHEA+E DI A+ ER+ A+  +A +L++E Y+++  V      ++ +W+ L + L  RR++L   RD+Q +LQE  Y+M+WM ++  RLQS+D GKHL  VE+LL+KH ++ +DI     R   +  T+++  + +      D   V+ K   L   Y EL  L+  R   L+  + +W+++ ++  +  WI+E  Q+    D G DL S   L+ K E    ++  R   + + +   +++V K  +  +P   E+  R I ++     +L++A + R   LN+S  FHQ   D  D +A ILE  R   + +VG     T+   ++  E   +++    LI  L  + + L          +     ++  +E+L  L+++ +  L      + +FS     + W+  KE+ L  +    +L++L VI+ RFD  E +M    G++S+ NQ+++ L+   +   + I + QN LN  W+    LA Q+K+ L+ A++   + LE  E +SW+++K K++E T  L +DL G+M LQR+L  ++RD++AI+ K+  L  EA KL    P  E  I  ++  + E+WEEL+  ++ R+  L  +++LQ F +DLD F  WL + Q  VA++D P  L EAER    H  +K E+  ++ +Y ++   G +V+  + D Q++   +RL  L+  W+ L +MW+ +   L ++ D QT +RD+ Q +G L  QE  LS +E+P++ +  +   ++ E F  ++ +++ KI+ VV  G  L++  N  +DKI+ K + I  R    +   +   + L+D+  L  F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N++ +D++ ++G  L+ EKP  E  +   +  L+ QW EL NT   K++ L +ANR  +F ++  ++ SW+     Q I+++   +++G  L  +N  +K  +  + Q+D + K +  ++  A  L ++  + G  E +  Q+ V  + ++++ PL +RR  LL  K   QF RD+EDE  W++E++   T      +   V L  +++ +T   EI  H  RI D+   G  M        D+      +  L EL +LW  LI+  E       E    Q++ ++A E E WM E+E  +M E+KAKDE  AL  ++KH+ L   + +Y   + +LA+    ++N + P S  +  +Q +VDK+YA L ++  E++ K+++ ++   L R +  LE+WIAER  VA S+E+G + EH  +LR++F EFA  T+ +G  RV   +   D+LI  GH E+  +A WKD +NEAWADLLELI+TR Q+L A+Y+  +F  D+ E L LI EK   +    +G+D  +V    R+H A+  +++ L   ++     A +L   Y GEK  +I   +  + + W  LQ   + R   L+D  + ++F  MVR+L+ WM  I +QI + D  RDV    L+I+NH+ +K+EI++R ++ + C  +GRTLIN  H  ++++++K  ++  K   I + W+E+ + L+++LEV QF R+A++AE+WL  QE  +   + G  ++E  +L+++H   E+  A   DRF  L+KLT+ EE +     E++    +         + +              ++  + S D     QS SV    +  D+++    + V    +++              P     + TTE   G L RK E E+  KK+ NR W  +Y V+    +  YK+ K   +      Y  E PI L  A+   A +YKKR +VF++R+ +G EYLF+A D+AEM+ W+  I           G    L++  T+P        P++ +S E
Sbjct:   34 DNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--GRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRSDLIDFDNLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIEKYETLASELLQWIEQTIVTLNDRQLANSLSAVQNQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGVELGAVEAATRKHEAIETDIQAYGERVAAVEAVARELEAEGYHEVRRVLARRDNVLRLWEYLKELLAARRERLMAHRDLQRLLQELSYIMEWMEDMKSRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVKAVQATAKRFASNEQSYKPCDPALVEEKVDLLGRAYGELGQLAADRRVRLDDSRRLWQFLWELGEEAAWIREQEQIISGGDYGKDLSSALHLLSKHEAFRDEMAARYGPLGNSIAGGEALV-KEGHVGAP---EVTER-IKDVRAQWSHLEEASQLREQSLNESVAFHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEIQSHRSLIDSLHEQGSLLPEAYAHSPQVEGRLPAIEQRYEELEGLSSSWRQALDGALALYRMFSEASACQLWVGEKEQWLHNMEIPTKLEDLEVIQQRFDTLEPEMNTLGGRISDVNQVAQQLLGSDNRNKDQIDQTQNQLNNRWSDFQSLANQRKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLRSEAKKLVSEHPEQEEEIKGQLAEIQEVWEELRATMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTTVASEDTPTSLAEAERLLAQHEAIKNEVDNYKEDYEKMRATGAEVTQGQTDAQHMFLAQRLQALDTGWHELRRMWESRHCVLAQAFDFQTLLRDAKQAEGFLNSQEYVLSHTEMPSSLQGAEEAIKKHEDFLTTMEASEEKINGVVESGRRLVSDGNTYADKIQEKTDSIQERHQKNKQAANELLAKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQVLVKEKPELEQTVSETLSGLQKQWVELENTTQAKAQCLFDANRAELFTQSCSALDSWL-----QNISSQLQSDDFGKDLTSVNILLKKHQMLEHQMDVREKEVQSLQSQALALAQE--DSGIVEVDGEQRRVTDRFSQLQDPLKERRQHLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQL-LMKKNQTLQKEIQGHQPRIDDIQAHGTNMSPGKESEMDRERRAALDGRLAELRELWALLISETEQRNVRLAEANRAQQFYTDAAEAEAWMGEQELHMMSEEKAKDEQSALVMVKKHQILEQALEDYAQTIHQLANSSRLMVNSEHPESERITLRQAQVDKLYAGLKDLAEERRGKLQERLRLTQLKREVDDLEQWIAEREVVAGSHELGQDYEHVTMLRDKFREFARDTSTIGQERVDAVNAQADELIESGHPENASVAEWKDGLNEAWADLLELIDTRTQMLAASYELHRFHQDAREALGLIREKKETLAGAELGRDLNTVQHFLRQHTAYEHDVQALSGQVTQVQDDAARLQKAYAGEKADDIHRHERAVTEAWEGLQSATQTRRLLLLDTVEKFRFLNMVRDLMLWMEGINLQIQSHDSPRDVSSAGLVIANHQDIKSEIETRADSFTACSEMGRTLINNNHYASDEIQEKLDQLQAKRTEINQKWQEKMDHLQIVLEVLQFGRDASMAESWLAGQEPLVRAAELGSNVDEVESLIKRHEAFEKLAAGWEDRFSQLEKLTTLEEQEIQRRREEEERARRPPTPPPVEEVVQSEIN----------DSAARTSLDQTTLNQSVSVNGVYSDQDTSQGSESESVNGPGRDSGLDSASRQDPSATLPGRGGAEGTTEAMEGILCRKQEMESHNKKSANRSWQNVYCVLRKGSLGFYKDNKSASNGI---PYHGEVPISLGEAVCEVAHDYKKRKHVFKLRLGDGKEYLFQAKDEAEMSSWIRAIQSSMSSSERSPGASRGLSRAMTMP--------PMSPSSGE 2328          
BLAST of Spectrin beta chain vs. Ensembl Zebrafish
Match: sptbn2 (spectrin, beta, non-erythrocytic 2 [Source:ZFIN;Acc:ZDB-GENE-030131-787])

HSP 1 Score: 1326.23 bits (3431), Expect = 0.000e+0
Identity = 817/2367 (34.52%), Postives = 1331/2367 (56.23%), Query Frame = 2
Query:   65 ENDNNSALLYERSRIKALSE------------------------------------QREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGR---IDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKL---DSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERG-DEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDK-----FNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEV-VGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKEN--------------PKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIG-------GVDTSLAKYSTLPNIKSDFEMPVTEASSE 6940
            +N+N+SA L+ERSRIKAL++                                    +REAVQKKTFTKWVNSHL   +    + DL+ DL+DG+ L++LLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVN+ NFT+SW+DGLAFNA++HKHR +++D+  L ++N   NL  AF  AE+E G+ +LLD  D+ VDQP+EKSI+TYV +     +++K+   + KR+G V++ AI A++LI  YE L+ ELL+WI+  I  + + +L  SL  V+ QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLE L   F+RKA MR+ WL EN  LV Q  FG +L  + AA +KHEA+E DI A+ ER+ A+  +A +L++E Y+++  V      ++ +W+ L + L  RR++L   RD+Q +LQE  Y+M+WM ++  RLQS+D GKHL  VE+LL+KH ++ +DI     R   +  T+++  + +      D   V+ K   L   Y EL  L+  R   L+  + +W+++ ++  +  WI+E  Q+    D G DL S   L+ K E    ++  R   + + +   +++V K  +  +P   E+  R I ++     +L++A + R   LN+S  FHQ   D  D +A ILE  R   + +VG     T+   ++  E   +++    LI  L  + + L          +     ++  +E+L  L+++ +  L      + +FS     + W+  KE+ L  +    +L++L VI+ RFD  E +M    G++S+ NQ+++ L+   +   + I + QN LN  W+    LA Q+K+ L+ A++   + LE  E +SW+++K K++E T  L +DL G+M LQR+L  ++RD++AI+ K+  L  EA KL    P  E  I  ++  + E+WEEL+  ++ R+  L  +++LQ F +DLD F  WL + Q  VA++D P  L EAER    H  +K E+  ++ +Y ++   G +V+  + D Q++   +RL  L+  W+ L +MW+ +   L ++ D QT +RD+ Q +G L  QE  LS +E+P++ +  +   ++ E F  ++ +++ KI+ VV  G  L++  N  +DKI+ K + I  R    +   +   + L+D+  L  F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N++ +D++ ++G  L+ EKP  E  +   +  L+ QW EL NT   K++ L +ANR  +F ++  ++ SW+     Q I+++   +++G  L  +N  +K  +  + Q+D + K +  ++  A  L ++  + G  E +  Q+ V  + ++++ PL +RR  LL  K   QF RD+EDE  W++E++   T      +   V L  +++ +T   EI  H  RI D+   G  M        D+      +  L EL +LW  LI+  E       E    Q++ ++A E E WM E+E  +M E+KAKDE  AL  ++KH+ L   + +Y   + +LA+    ++N + P S  +  +Q +VDK+YA L ++  E++ K+++ ++   L R +  LE+WIAER  VA S+E+G + EH  +LR++F EFA  T+ +G  RV   +   D+LI  GH E+  +A WKD +NEAWADLLELI+TR Q+L A+Y+  +F  D+ E L LI EK   +    +G+D  +V    R+H A+  +++ L   ++     A +L   Y GEK  +I   +  + + W  LQ   + R   L+D  + ++F  MVR+L+ WM  I +QI + D  RDV    L+I+NH+ +K+EI++R ++ + C  +GRTLIN  H  ++++++K  ++  K   I + W+E+ + L+++LEV QF R+A++AE+WL  QE  +   + G  ++E  +L+++H   E+  A   DRF  L+KLT+ EE +     E++    +         + +              ++  + S D     QS SV    +  D+++    + V    +++              P     + TTE   G L RK E E+  KK+ NR W  +Y V+    +  YK+ K   +      Y  E PI L  A+   A +YKKR +VF++R+ +G EYLF+A D+AEM+ W+  I           G    L++  T+P        P++ +S E
Sbjct:   34 DNENSSARLFERSRIKALADMDFDPREPEPCLSPAAFVNQVQYSNILEGRFKQLQDEREAVQKKTFTKWVNSHL--GRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRSDLIDFDNLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIEKYETLASELLQWIEQTIVTLNDRQLANSLSAVQNQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGVELGAVEAATRKHEAIETDIQAYGERVAAVEAVARELEAEGYHEVRRVLARRDNVLRLWEYLKELLAARRERLMAHRDLQRLLQELSYIMEWMEDMKSRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVKAVQATAKRFASNEQSYKPCDPALVEEKVDLLGRAYGELGQLAADRRVRLDDSRRLWQFLWELGEEAAWIREQEQIISGGDYGKDLSSALHLLSKHEAFRDEMAARYGPLGNSIAGGEALV-KEGHVGAP---EVTER-IKDVRAQWSHLEEASQLREQSLNESVAFHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEIQSHRSLIDSLHEQGSLLPEAYAHSPQVEGRLPAIEQRYEELEGLSSSWRQALDGALALYRMFSEASACQLWVGEKEQWLHNMEIPTKLEDLEVIQQRFDTLEPEMNTLGGRISDVNQVAQQLLGSDNRNKDQIDQTQNQLNNRWSDFQSLANQRKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLRSEAKKLVSEHPEQEEEIKGQLAEIQEVWEELRATMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTTVASEDTPTSLAEAERLLAQHEAIKNEVDNYKEDYEKMRATGAEVTQGQTDAQHMFLAQRLQALDTGWHELRRMWESRHCVLAQAFDFQTLLRDAKQAEGFLNSQEYVLSHTEMPSSLQGAEEAIKKHEDFLTTMEASEEKINGVVESGRRLVSDGNTYADKIQEKTDSIQERHQKNKQAANELLAKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQVLVKEKPELEQTVSETLSGLQKQWVELENTTQAKAQCLFDANRAELFTQSCSALDSWL-----QNISSQLQSDDFGKDLTSVNILLKKHQMLEHQMDVREKEVQSLQSQALALAQE--DSGIVEVDGEQRRVTDRFSQLQDPLKERRQHLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQL-LMKKNQTLQKEIQGHQPRIDDIQAHGTNMSPGKESEMDRERRAALDGRLAELRELWALLISETEQRNVRLAEANRAQQFYTDAAEAEAWMGEQELHMMSEEKAKDEQSALVMVKKHQILEQALEDYAQTIHQLANSSRLMVNSEHPESERITLRQAQVDKLYAGLKDLAEERRGKLQERLRLTQLKREVDDLEQWIAEREVVAGSHELGQDYEHVTMLRDKFREFARDTSTIGQERVDAVNAQADELIESGHPENASVAEWKDGLNEAWADLLELIDTRTQMLAASYELHRFHQDAREALGLIREKKETLAGAELGRDLNTVQHFLRQHTAYEHDVQALSGQVTQVQDDAARLQKAYAGEKADDIHRHERAVTEAWEGLQSATQTRRLLLLDTVEKFRFLNMVRDLMLWMEGINLQIQSHDSPRDVSSAGLVIANHQDIKSEIETRADSFTACSEMGRTLINNNHYASDEIQEKLDQLQAKRTEINQKWQEKMDHLQIVLEVLQFGRDASMAESWLAGQEPLVRAAELGSNVDEVESLIKRHEAFEKLAAGWEDRFSQLEKLTTLEEQEIQRRREEEERARRPPTPPPVEEVVQSEIN----------DSAARTSLDQTTLNQSVSVNGVYSDQDTSQGSESESVNGPGRDSGLDSASRQDPSATLPGRGGAEGTTEAMEGILCRKQEMESHNKKSANRSWQNVYCVLRKGSLGFYKDNKSASNGI---PYHGEVPISLGEAVCEVAHDYKKRKHVFKLRLGDGKEYLFQAKDEAEMSSWIRAIQSSMSSSERSPGASRGLSRAMTMP--------PMSPSSGE 2364          
BLAST of Spectrin beta chain vs. Ensembl Zebrafish
Match: sptbn1 (spectrin, beta, non-erythrocytic 1 [Source:ZFIN;Acc:ZDB-GENE-031006-3])

HSP 1 Score: 1295.41 bits (3351), Expect = 0.000e+0
Identity = 741/2007 (36.92%), Postives = 1199/2007 (59.74%), Query Frame = 2
Query:  218 VDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNN--------YQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRF 6199
            +DL+DG+ L+KLLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  R++K++LLLWCQMKTAGY NVNI NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI VD P+EKS++TYV +     +++K+ + + KR+G V++ AI  EK+I  YE L+ +LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+ A+  +A +L++ENY+ I  +      ++ +W+ LL+ L+ RR +L+    +Q + QE  Y+MDWM E+ + L S+D+GKHLLGVE+LL+KH ++ +DI     R+   +   Q     R A+D++     + Q++ +        YQEL  L+ +R   L   + +W++  ++  ++ WI+E  Q+  S D G DL    RL+ +   +  +++ R   +   +     +   D     +  I   I ++      L+Q    R+ +L ++   HQ  AD +D D   L+  R+   +DVG     T+  +K+H++   +V     +I  L  +   L  +     +  E    ++  ++++ +L   RK  L +    + +FS  +  E WI  KE+ L ++   E+L++L VI+HRF+  E +M   + +V+  NQI+R LI+  HP  + I  +Q+ LN  W+Q  DL +QKK+ L  A+    + L+  ET+SWI++K K++E T +L +DL G+M LQR+L  ++RD+ AIEAK+  L  EAD+L    P     I   +  +  +WEE+K  L+ R+  L  +++LQ+F ++LD F  WL + Q  +A++D+P  L EAE+    H  +K EI  +E +Y ++   G  V+  + D QY+   +RL  L+  WN L KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +E+P   E  +A  ++ E F  ++ +N+ KI+ VV  G  L +  N  +D+I+ +   I  R    ++        L+D+  L +F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL++N+E +D++ ++G +L+ EKP  E+ ++ K+  L+  W+EL  T   K++ L +AN+  +F ++   +  W+  +  QI + +     YG  L  +N  +K Q+  + Q++ +++ + +++  A  L+++  +  DE +  ++ V+ K  E+  PL  R+N L+  + + QF RDVEDE  W+ E++   T        LQ     I++ +T   EI  H  R  D+    + +++ D P+ +     L +L  LW  ++   E      EE  + Q+Y  +A E E WMSE+E  +M E+KAKDE  ++  ++KH+ L   + +Y   V +L+     ++  + P S  +  +Q +VDK+YA L ++  E++ K+E+  + + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   + M D+LI  GH ++  +A WKD +NEAWADLLELI+TR Q+L A+Y+  KF  D+ E+L  I +K + +PE +G+D  +V T QR H  F  +I+ L   +      A +L   Y G+K  +I  R+ E+ + W SL +  E R   L+D  D ++F++MVR+L+ WM ++   I   +K RDV  VEL+++NH+ +KAEID+R+++ + CI LG++L+ RKH  + ++++K  ++  K  ++++ W +R E+L +ILEV+QF+R+A VAEAWL+ QE  L++ + G +++E   L+++H   E++ A   +RF
Sbjct:    1 MDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKRSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSVITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRTELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAVVAVARELETENYHDIKRITARKDNVLRLWEYLLELLKARRQRLEMNLSLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIGIQADRVKAVNNNAQ-----RFAVDEEGYKPCDPQVIRDRVAHMEFCYQELTQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDCGKDLTGAVRLLSQHRALEDEMSGRSGHLQHTVRE--GQAMADAGHFGEAKIRERIADVQAQWAALEQLASVRKTRLEEACSLHQFQADADDVDTWTLDALRIVSTADVGHDEFSTQALVKKHKDASTEVASYRPVIDALHEQAQTLPPEQANSANVSERLAGIEERYKEVSELTRLRKQALQDALALYKMFSEADACELWIDEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKDIKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWIREKTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLRGEADRLAGEHPDQAKAITGRLAEITAVWEEMKETLRTREESLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEINNYEEDYQKMRDMGEMVTQDQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQIFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEDKINGVVEAGRRLASDGNINADRIQERAASIDDRHKKNREAAVELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIEKEGKQLVSEKPETEAVVKEKLAALQKMWTELETTTQTKAQCLFDANKAELFTQSCADLDKWLVGLEGQIQSDD-----YGKDLTSVNILLKKQQMLENQVEVRQREVEELQSQAHVLRQEGKD-TDEVDGRRKVVEQKFQELLDPLLKRKNFLMASREIHQFNRDVEDEILWVEERMPLATSTDHG-NNLQTVQLLIKKNQTLQKEIQGHQPRCDDIFERSQSILKADSPNVEGIRTRLSDLQGLWSLIMQETEKRHSRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSSVAMLKKHQILEQAVEDYAETVHQLSKTSRGLVAANHPESERIGMRQSQVDKLYAGLKDLSEERRGKLEERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDGVNRMADELINAGHADAATVAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEILGRILDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQDDAVRLQSAYAGDKADDIQRREGEVLEAWRSLLEACEGRRARLLDTGDKFRFFSMVRDLMLWMEDVIRLIETQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTDKRKDMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYLSSRELGQSVDEVEKLIKRHEAFEKSAATWEERF 1993          
BLAST of Spectrin beta chain vs. Ensembl Zebrafish
Match: sptb (spectrin, beta, erythrocytic [Source:ZFIN;Acc:ZDB-GENE-000906-1])

HSP 1 Score: 1288.48 bits (3333), Expect = 0.000e+0
Identity = 817/2370 (34.47%), Postives = 1317/2370 (55.57%), Query Frame = 2
Query:   62 LENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAID----EKDGK---RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDT-SRKLQTADFDR-AAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKD---LIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSK-DDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLAS-NALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXX---XYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAP--ETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEM--IRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRF------------------------------ETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPV------RKVETIKQLSEDIIVPLQ-SRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVD--------TSLAKYSTLPNIKSDFEMPVTEASSEKKKFPTLGRKQ 6973
            L+NDN+SA L+ERSRIKAL+++REAVQKKTFTKWVNS L  ++    + DL++DL+DG+ L+KLLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  LILGLIWTIILRFQIQD  ++    ++ G+   R++K++LLLWCQMKTAGY N+NI NFT+SWKDG+AFNAL+HKHRP++VDY  L ++NP  NL  AF  AE++ GV +LLD  D+  + P+EKSI+TYV +     +++K+   + KR+G V+++AI  EK+I  YE LS +LL WI+  I  + N KL  SL GV++QL  F++YR  EKPPKFQ++G LE+  F IQS++RA+N+K+Y P EG L+S IN+AW+ LEK+E+  E  L +ELIRQ+KLEQ+   F+RKA MR+ WL+EN  LV Q  FG DL  + AA KKH+A+E DI A+EER+ AL  ++ +L+SE Y+    ++     I+ +W  L + L+ RR +LD+   +Q I QE  +++ WM E+  RL S DFGKHLL VE+LL+KH ++ +DI     R+    +  L+ A+ D     D   +  + + L   YQEL  L+ QR+  L   + +W ++ +I   + WI+E  Q+F S D G DL SV  L  K      ++  R+D    ++D+ +S++ +  +  SP+    + + ++++      L++    R+  L  +  F Q   D +D  A +++  R   + DVG     T+  LK+H +   +  +    I  L  + N L  + +   D       +++ + +L+ L++ R+  L +    + +FS  +  E W+  KE  LV L   E L++L ++++R      +M     +V   N+ ++ L + +HP+ + + + Q  LN  W     + E KK  +  A+  + + L+  ET+SWI++K +++E T DL +DL  ++ +QR+L  ++RD+ AI+ K+  L  EA KL    P + + I +    ++  W+ LK  L+DR+  L   ++LQ F +D+D F  WL K Q  VA++D+P  L EAE+    H  ++ ++   E +Y R+   G  V   + DDPQY    +RL  L+  W  L KMW  +   L +    Q F+RD+ Q D IL  QE  L+  + P+  +  +   ++ E F  ++ +NK KI + +  G+ L+ S N  S K+++K   I  R    QDK    +  L+D+  L  F  +   L  W++EKM+ A DTSY + +++ +++ + + F  EL +N++ +  + ++G +L++ KP FE  ++ ++ +L   W +L +T  EK++ L +ANR  +FD++   +  W+ E+  Q+    E          + L +    +     +  +  ++   +EQH   L+E  P    E E+ QQ ++    ++  PL+ R+  L   K V QF RD+ DE  W+ E+L            +T+Q+ L++ + L+    EID H  RI ++   G  M       P  ++ +  + +L  +W  L       ++    + E Q+Y ++A + E W+ E+E  ++ ++ AKDE  A+  +++H  L   +++Y   + +LAD+   +L  + P    + ++Q +VDK YA L E+  ++K K++     + L R ++ LE+WIAER  VA S E+G +L+H  +LR++F EFA +T  VG  RV   + + D+LI  GH ES  +A WKD +NE+WADLLELI+TR QLL ++YD  K+  D  EL+  I EK   +PE +G+D     +  R H AF  +I  L   +      A +L   Y G++   I   + E+ + W  L      R   L + +D ++F+ MVR+L+ WM  I  QI   +K RDV  VEL++  H+ ++AEI++R    + C+ LG+ L+ RKH  + ++++K  +++ K   ++  W +R ++L ++LEV QFAR+A+VAEAWLIAQE  + + D G T++E   LL++H   E++ A   +RF                              E+ ++ T F E    L                E ++       P+   V        V  I ++ E + + L  S S+Q     + +A  P      E ++  P L+E         GTL RKHE E   KKA NR W  LY V++   +S+YK+ K +       T+  E+P+ L  +     TNYKK+  VF++R+ +G+EYLF+  D+ E+  W + I +   V         + +   S  P   +  E+P T+   E K+F    +K+
Sbjct:   33 LDNDNSSARLFERSRIKALADEREAVQKKTFTKWVNSIL--ARVSCRISDLYLDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDIIVETGQADQTGRQETRSAKDALLLWCQMKTAGYPNINITNFTTSWKDGMAFNALIHKHRPDLVDYGNLKRSNPTHNLQQAFNVAEKKLGVTKLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKALAVEGKRIGKVLDQAIETEKMIEKYETLSSDLLTWIEQTIVVLNNRKLANSLTGVQQQLQAFNSYRTVEKPPKFQEKGNLEVLLFTIQSRMRANNQKVYTPKEGALVSDINKAWERLEKAEYDRERVLRDELIRQEKLEQMARRFDRKAAMRETWLMENQRLVSQDNFGYDLPAVEAAKKKHDAIETDIAAYEERVQALVALSKELESERYHDAKRIDARKDNILRLWDYLQELLKARRGRLDKNLTLQRIFQEMLHIISWMDEMKGRLLSPDFGKHLLEVEDLLQKHSLVEADIAVQAERVKSANAAALKFANGDSYKPCDPQVIRDRVQHLDLCYQELCALAAQRKARLEQSRRLWNFLWEIAELESWIREREQIFSSLDYGKDLTSVLILQSKHSVFEDELAARRDNLKQVMDEGESMI-QIKHLGSPK----VQQRMNDVQRQWQQLEELAAFRKQNLQDTQRFFQFQGDADDLKAWLVDAMRQMSSDDVGHDEYTTQRLLKKHRDLRDEAAKNGATIDALSKQANALPEELRNTPDIQGRLNDIRDMYIELLTLSDLRQKKLDDTMALYTIFSETDACELWMGQKETWLVGLETPENLEDLEIVQNRLSILAQEMGNMQTRVDNVNKAAKQLEDSRHPQTKQVKDCQIRLNKRWEAFKAMVEDKKHRVDSALSLHNYDLDCDETESWIKEKTRVIESTQDLGNDLAAVITIQRKLFGMERDLAAIQDKLDSLRDEAQKLVKEHPENASDILARQEELDAAWDTLKRTLKDREDSLGEVSKLQTFLQDMDDFQAWLFKSQKAVASEDMPDGLPEAEQLLNLHDALRHDMDGHEEDYHRVKDTGAAVIQGQEDDPQYQQLEQRLEGLDKGWGELHKMWDSRKNFLDQGLGFQQFMRDAKQADAILNNQEYTLAHVDKPDTLDGAEKALKKHEDFVTTMDANKEKILSTLETGQRLVDSENLYSGKVKDKMSSIEERNKKNQDKAKEVSGKLKDNRELQHFLQNTQDLTLWINEKMLTAQDTSYDEARNLHSKWQKHQAFMAELASNKDWLHNIDKEGQELMESKPEFEPIVKDRLAKLHELWDKLESTTQEKARLLFDANRSELFDQSLADLKKWLAELQQQLQGDVEEEVKDLTSANILLKKHQITENQVRDRARELEELQEAVEQHG-SLREDQP----ELEIEQQNLQRDFQKLLTPLSQRKGKLEAAKAVHQFFRDLADEILWVNERLPMAMSDDHGNNLQTVQLLLKKNQSLQ---KEIDGHQPRIDEVLERGRRMAAAAEGSPEEERMSEEMKKLQVVWAQLQEEMAKRRERLYGSNEAQQYYNDADDSEAWIGEQELYMIADEMAKDEQSAMIMLKRHLVLKQTVDDYAYSIQQLADRAQKMLAEEHPDGEAIIRRQGQVDKQYAGLKELAEDRKKKLDHTYHHFLLSREVEDLEQWIAERDVVASSQEMGQDLDHVTILRDKFREFARETGTVGQERVDTVNRIIDELIEGGHSESATLAEWKDGVNESWADLLELIDTRAQLLTSSYDLLKYFYDGKELVGHIEEKKNELPEDLGEDFSKAESFHRMHAAFERDISSLGKQVKQFQETAARLHAQYAGDQATAIQATEKEVVEAWKGLLDACAGRRKQLEETADKFRFFTMVRDLMAWMESILQQIETQEKPRDVSSVELLMKYHQGIRAEIETRGPKFNQCVQLGQALLERKHKDSAEIKEKLMQLVEKRKEMMLKWDDRWDWLRLLLEVCQFARDASVAEAWLIAQEPYVASKDVGQTVDEVEKLLKRHEAFEKSTATWEERFSALERLTTLELLEIRKQQQEIQQYRQEAEKESRREDTGFAEESSQLYP------------TEEQSLSGLGVIEPSSGGVDGTAGESTVPLISEMQESVSLELDPSTSIQVTKETEKAASLPT-----ESTQVQPVLME---------GTLARKHELEGPNKKAPNRSWNNLYCVLKPGHLSIYKDAKSFSHSV---TFHGEEPLTLTNSSCEILTNYKKKKQVFKLRLGDGSEYLFQCKDEEELQNWTQAIEQAAQVQIEEPVAGPSGVKALSLPPPSSTTLEVPSTKKDKE-KRFSLFAKKK 2357          
BLAST of Spectrin beta chain vs. Ensembl Xenopus
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1425.22 bits (3688), Expect = 0.000e+0
Identity = 872/2346 (37.17%), Postives = 1365/2346 (58.18%), Query Frame = 2
Query:   56 DVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGR---IDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPE---------------PVRKVETIKQ--LSEDIIVPLQSRSVQSAVAIDDSAE--------AP---PKQEVKEKSKENPKLIETKSTTEPKT---------GTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPT 6958
            D  +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL  ++    + DL+ DL+DG+ L+KLLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVNI NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI VD P+EKSI+TYV +     +++K+   + KR+G V++ AI  EK+I  YE L+ +LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+ A+  +A +L++ENY+ I  +      ++ +W+ LL+ L+ RR +L+    +Q + QE  Y+MDWM E+ + L S+D+GKHLLGVE+LL+KH ++ +DI     R   ++ ++++  T        D   +  +   +   YQEL  L+ +R   L   + +W++  ++  ++ WI+E  Q+  S D G DL SV RL  K +    +++ R   ++  +       + D      E I   I +I E   NL+     R+ +L  +   +Q  AD +D DA +L+  R+  +SDVG     T+  +K+H++   ++      I  L  +   L  +     D       ++  +++L +LA  RK  L +    + +FS  +  E WI+ KE+ L  +   E+L++L VI+HRF+  E +M   + +V+  NQI+R LI+  HP  + I  +Q+ LN  W+Q  +L ++ K  L  A+    + LE  ET+SWI++K K++E T +L +DL G+M LQR+L  ++RD+ AIEAK+  L KEA+KL+   P     I   +  +N +WEE+K  L++R+  L  +++LQ+F +DLD F  WL + Q  +A++D+P  L EAE+  T H  +K EI  +E +Y ++   G  V+  + D QY+   +RL  L+  WN L KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +ELPNN EA +A  +  E F  ++ +++ KI+AVV+ G  L+   N  SDKI  K + I SR    +   +     L+D+  + +F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N+E +D++ ++GN+LI EKP  E+ ++ K+  L   W EL +T   K+++L +AN+  +F ++   +  W+       + ++   ++YG  L  +N  +K Q+  + Q+D ++K + ++   A+ L  Q  +  DE +  +Q V+V+  E+ APL +R+  LL  K + QF RDVEDE  W+ E++   T        LQ     +++ +T   EI  H  R  D+    + ++ +   +++     L +L  LW  LI   E   +  EE+   Q+Y  +  E E WMSE+E  +M E+KAKDE  A++ ++KH+ L   + +Y   V +L+     ++    P S  ++ +Q +VDK+YA L ++  E++ K+++  + + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   + M D LI  GH ++  IA WKD +NEAWADLLELI+TR Q+L A+++  KF  D+ E+   I +K + +PE +G+D  +V T QR H  F  +I+ L   +      A +L   Y G+K  +I  R+ E+ + W +L    + R   L+D  D ++F++MVR+L+ WM ++  QI A +K RDV  VEL+++NH+ +KAEID+R+++ + CI LG++L+ RKH  + ++++K  ++  K   +++ W +R E+L +ILEV+QF+R+A+VAEAWL  QE  L++ + G +++E   L+++H   E++ A   +RF                +A ++   L+  E R      E    PPTPE                 ++ E I Q  L  D   P  + +  +   ++ S E        +P   P  + K KS   P   +T +T   KT         G L RKHEWE   KKA +R W+ +Y VI N +M  YK+ K          Y +E P +L  A+   AT+YKK+ +VF++++ +G EYLF+A D  EMN W++ I      D +    ST            T ASS  +  P 
Sbjct:   26 DEWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--ARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFG--SEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWL-----HGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQALS-QEGKSTDEVDGQRQVVEVRFIELLAPLNERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTDHG-HNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDDSSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERF----------------SALERLTTLELLEVRRLQEEEERKRKPPTPELSPKLSEDGSPQQWDGTKEGEQISQNGLPSDQESPRMAENADTNELVNGSTEQRSSSKESSPIPSPTADRKSKSGMQP---QTAATLPAKTQEMPSAQFEGFLHRKHEWEGHNKKASSRSWHNVYCVINNQEMGFYKDSKNAASGI---AYHNEIPANLKEAVCEVATDYKKKKHVFKLKLNDGNEYLFQAKDDEEMNTWIQAITNAITSDKTEVSLST----------QSTPASSRAQTLPA 2328          
BLAST of Spectrin beta chain vs. Ensembl Xenopus
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1419.83 bits (3674), Expect = 0.000e+0
Identity = 858/2275 (37.71%), Postives = 1346/2275 (59.16%), Query Frame = 2
Query:   56 DVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRI---DDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLAS-NALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIV-PLQSRSVQSAVAIDDSAEAP-PKQEVKEKSKENPKLIETKSTTEPKT---------GTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMN 6823
            D  +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL  ++    + DL+ DL+DG+ L+KLLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVNI NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI VD P+EKSI+TYV +     +++K+   + KR+G V++ AI  EK+I  YE L+ +LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+ A+  +A +L++ENY+ I  +      ++ +W+ LL+ L+ RR +L+    +Q + QE  Y+MDWM E+ + L S+D+GKHLLGVE+LL+KH ++ +DI     R+   + ++++  T        D   +  +   +   YQEL  L+ +R   L   + +W++  ++  ++ WI+E  Q+  S D G DL SV RL  K +    +++ R   ++  +       + D      E I   I +I E   NL+     R+ +L  +   +Q  AD +D DA +L+  R+  +SDVG     T+  +K+H++   ++      I  L  +   L  +     D       ++  +++L +LA  RK  L +    + +FS  +  E WI+ KE+ L  +   E+L++L VI+HRF+  E +M   + +V+  NQI+R LI+  HP  + I  +Q+ LN  W+Q  +L ++ K  L  A+    + LE  ET+SWI++K K++E T +L +DL G+M LQR+L  ++RD+ AIEAK+  L KEA+KL+   P     I   +  +N +WEE+K  L++R+  L  +++LQ+F +DLD F  WL + Q  +A++D+P  L EAE+  T H  +K EI  +E +Y ++   G  V+  + D QY+   +RL  L+  WN L KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +ELPNN EA +A  +  E F  ++ +++ KI+AVV+ G  L+   N  SDKI  K + I SR    +   +     L+D+  + +F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N+E +D++ ++GN+LI EKP  E+ ++ K+  L   W EL +T   K+++L +AN+  +F ++   +  W+  + SQI + +     YG  L  +N  +K Q+  + Q+D ++K + ++   A+ L  Q  +  DE +  +Q V+V+  E+ APL +R+  LL  K + QF RDVEDE  W+ E++   T        LQ     +++ +T   EI  H  R  D+    + ++ +   +++     L +L  LW  LI   E   +  EE+   Q+Y  +  E E WMSE+E  +M E+KAKDE  A++ ++KH+ L   + +Y   V +L+     ++    P S  ++ +Q +VDK+YA L ++  E++ K+++  + + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   + M D LI  GH ++  IA WKD +NEAWADLLELI+TR Q+L A+++  KF  D+ E+   I +K + +PE +G+D  +V T QR H  F  +I+ L   +      A +L   Y G+K  +I  R+ E+ + W +L    + R   L+D  D ++F++MVR+L+ WM ++  QI A +K RDV  VEL+++NH+ +KAEID+R+++ + CI LG++L+ RKH  + ++++K  ++  K   +++ W +R E+L +ILEV+QF+R+A+VAEAWL  QE  L++ + G +++E   L+++H   E++ A   +RF  L++LT+      S  +                T   F    P        ET   ++E+     L + S +   +  +S+  P P  + K KS   P   +T +T   KT         G L RKHEWE   KKA +R W+ +Y VI N +M  YK+ K          Y +E P +L  A+   AT+YKK+ +VF++++ +G EYLF+A D   +N
Sbjct:   26 DEWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--ARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGS--EKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDD-----YGKDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQALS-QEGKSTDEVDGQRQVVEVRFIELLAPLNERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTDHG-HNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDDSSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTVLTLCFSFLSTNS-------------TRCSFTADDP--------ETAVMMAENADTNELVNGSTEQRSSSKESSPIPSPTADRKSKSGMQP---QTAATLPAKTQEMPSAQFEGFLHRKHEWEGHNKKASSRSWHNVYCVINNQEMGFYKDSKNAASGI---AYHNEIPANLKEAVCEVATDYKKKKHVFKLKLNDGNEYLFQAKDDVSIN 2262          
BLAST of Spectrin beta chain vs. Ensembl Xenopus
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1416.36 bits (3665), Expect = 0.000e+0
Identity = 869/2360 (36.82%), Postives = 1352/2360 (57.29%), Query Frame = 2
Query:   56 DVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGR---IDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERG--------------DEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPE---------------PVRKVETIKQ--LSEDIIVPLQSRSVQSAVAIDDSAE--------AP---PKQEVKEKSKENPKLIETKSTTEPKT---------GTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPT 6958
            D  +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL  ++    + DL+ DL+DG+ L+KLLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVNI NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI VD P+EKSI+TYV +     +++K+   + KR+G V++ AI  EK+I  YE L+ +LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+ A+  +A +L++ENY+ I  +      ++ +W+ LL+ L+ RR +L+    +Q + QE  Y+MDWM E+ + L S+D+GKHLLGVE+LL+KH ++ +DI     R   ++ ++++  T        D   +  +   +   YQEL  L+ +R   L   + +W++  ++  ++ WI+E  Q+  S D G DL SV RL  K +    +++ R   ++  +       + D      E I   I +I E   NL+     R+ +L  +   +Q  AD +D DA +L+  R+  +SDVG     T+  +K+H++   ++      I  L  +   L  +     D       ++  +++L +LA  RK  L +    + +FS  +  E WI+ KE+ L  +   E+L++L VI+HRF+  E +M   + +V+  NQI+R LI+  HP  + I  +Q+ LN  W+Q  +L ++ K  L  A+    + LE  ET+SWI++K K++E T +L +DL G+M LQR+L  ++RD+ AIEAK+  L KEA+KL+   P     I   +  +N +WEE+K  L++R+  L  +++LQ+F +DLD F  WL + Q  +A++D+P  L EAE+  T H  +K EI  +E +Y ++   G  V+  + D QY+   +RL  L+  WN L KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +ELPNN EA +A  +  E F  ++ +++ KI+AVV+ G  L+   N  SDKI  K + I SR    +   +     L+D+  + +F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N+E +D++ ++GN+LI EKP  E+ ++ K+  L   W EL +T   K+++L +AN+  +F ++   +  W+       + ++   ++YG  L  +N                             LK+Q  E G              DE +  +Q V+V+  E+ APL +R+  LL  K + QF RDVEDE  W+ E++   T        LQ     +++ +T   EI  H  R  D+    + ++ +   +++     L +L  LW  LI   E   +  EE+   Q+Y  +  E E WMSE+E  +M E+KAKDE  A++ ++KH+ L   + +Y   V +L+     ++    P S  ++ +Q +VDK+YA L ++  E++ K+++  + + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   + M D LI  GH ++  IA WKD +NEAWADLLELI+TR Q+L A+++  KF  D+ E+   I +K + +PE +G+D  +V T QR H  F  +I+ L   +      A +L   Y G+K  +I  R+ E+ + W +L    + R   L+D  D ++F++MVR+L+ WM ++  QI A +K RDV  VEL+++NH+ +KAEID+R+++ + CI LG++L+ RKH  + ++++K  ++  K   +++ W +R E+L +ILEV+QF+R+A+VAEAWL  QE  L++ + G +++E   L+++H   E++ A   +RF                +A ++   L+  E R      E    PPTPE                 ++ E I Q  L  D   P  + +  +   ++ S E        +P   P  + K KS   P   +T +T   KT         G L RKHEWE   KKA +R W+ +Y VI N +M  YK+ K          Y +E P +L  A+   AT+YKK+ +VF++++ +G EYLF+A D  EMN W++ I      D +    ST            T ASS  +  P 
Sbjct:   26 DEWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--ARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFG--SEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWL-----HGLESQIQSDDYGKDLTSVNIL---------------------------LKKQQVENGLCWRTRWIQEGKSTDEVDGQRQVVEVRFIELLAPLNERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTDHG-HNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDDSSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERF----------------SALERLTTLELLEVRRLQEEEERKRKPPTPELSPKLSEDGSPQQWDGTKEGEQISQNGLPSDQESPRMAENADTNELVNGSTEQRSSSKESSPIPSPTADRKSKSGMQP---QTAATLPAKTQEMPSAQFEGFLHRKHEWEGHNKKASSRSWHNVYCVINNQEMGFYKDSKNAASGI---AYHNEIPANLKEAVCEVATDYKKKKHVFKLKLNDGNEYLFQAKDDEEMNTWIQAITNAITSDKTEVSLST----------QSTPASSRAQTLPA 2316          
BLAST of Spectrin beta chain vs. Ensembl Xenopus
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1413.28 bits (3657), Expect = 0.000e+0
Identity = 858/2281 (37.62%), Postives = 1346/2281 (59.01%), Query Frame = 2
Query:   56 DVLENDNNSALLYERSRIKALS------EQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRI---DDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLAS-NALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIV-PLQSRSVQSAVAIDDSAEAP-PKQEVKEKSKENPKLIETKSTTEPKT---------GTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMN 6823
            D  +N+N+SA L+ERSRIKAL+      ++REAVQKKTFTKWVNSHL  ++    + DL+ DL+DG+ L+KLLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVNI NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI VD P+EKSI+TYV +     +++K+   + KR+G V++ AI  EK+I  YE L+ +LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+ A+  +A +L++ENY+ I  +      ++ +W+ LL+ L+ RR +L+    +Q + QE  Y+MDWM E+ + L S+D+GKHLLGVE+LL+KH ++ +DI     R+   + ++++  T        D   +  +   +   YQEL  L+ +R   L   + +W++  ++  ++ WI+E  Q+  S D G DL SV RL  K +    +++ R   ++  +       + D      E I   I +I E   NL+     R+ +L  +   +Q  AD +D DA +L+  R+  +SDVG     T+  +K+H++   ++      I  L  +   L  +     D       ++  +++L +LA  RK  L +    + +FS  +  E WI+ KE+ L  +   E+L++L VI+HRF+  E +M   + +V+  NQI+R LI+  HP  + I  +Q+ LN  W+Q  +L ++ K  L  A+    + LE  ET+SWI++K K++E T +L +DL G+M LQR+L  ++RD+ AIEAK+  L KEA+KL+   P     I   +  +N +WEE+K  L++R+  L  +++LQ+F +DLD F  WL + Q  +A++D+P  L EAE+  T H  +K EI  +E +Y ++   G  V+  + D QY+   +RL  L+  WN L KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +ELPNN EA +A  +  E F  ++ +++ KI+AVV+ G  L+   N  SDKI  K + I SR    +   +     L+D+  + +F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N+E +D++ ++GN+LI EKP  E+ ++ K+  L   W EL +T   K+++L +AN+  +F ++   +  W+  + SQI + +     YG  L  +N  +K Q+  + Q+D ++K + ++   A+ L  Q  +  DE +  +Q V+V+  E+ APL +R+  LL  K + QF RDVEDE  W+ E++   T        LQ     +++ +T   EI  H  R  D+    + ++ +   +++     L +L  LW  LI   E   +  EE+   Q+Y  +  E E WMSE+E  +M E+KAKDE  A++ ++KH+ L   + +Y   V +L+     ++    P S  ++ +Q +VDK+YA L ++  E++ K+++  + + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   + M D LI  GH ++  IA WKD +NEAWADLLELI+TR Q+L A+++  KF  D+ E+   I +K + +PE +G+D  +V T QR H  F  +I+ L   +      A +L   Y G+K  +I  R+ E+ + W +L    + R   L+D  D ++F++MVR+L+ WM ++  QI A +K RDV  VEL+++NH+ +KAEID+R+++ + CI LG++L+ RKH  + ++++K  ++  K   +++ W +R E+L +ILEV+QF+R+A+VAEAWL  QE  L++ + G +++E   L+++H   E++ A   +RF  L++LT+      S  +                T   F    P        ET   ++E+     L + S +   +  +S+  P P  + K KS   P   +T +T   KT         G L RKHEWE   KKA +R W+ +Y VI N +M  YK+ K          Y +E P +L  A+   AT+YKK+ +VF++++ +G EYLF+A D   +N
Sbjct:   26 DEWDNENSSARLFERSRIKALAGSAMLIDEREAVQKKTFTKWVNSHL--ARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFGS--EKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDD-----YGKDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQALS-QEGKSTDEVDGQRQVVEVRFIELLAPLNERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTDHG-HNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDDSSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLTTVLTLCFSFLSTNS-------------TRCSFTADDP--------ETAVMMAENADTNELVNGSTEQRSSSKESSPIPSPTADRKSKSGMQP---QTAATLPAKTQEMPSAQFEGFLHRKHEWEGHNKKASSRSWHNVYCVINNQEMGFYKDSKNAASGI---AYHNEIPANLKEAVCEVATDYKKKKHVFKLKLNDGNEYLFQAKDDVSIN 2268          
BLAST of Spectrin beta chain vs. Ensembl Xenopus
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1407.89 bits (3643), Expect = 0.000e+0
Identity = 843/2264 (37.23%), Postives = 1333/2264 (58.88%), Query Frame = 2
Query:   56 DVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGR---IDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLAS-NALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMN 6823
            D  +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL  ++    + DL+ DL+DG+ L+KLLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVNI NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI VD P+EKSI+TYV +     +++K+   + KR+G V++ AI  EK+I  YE L+ +LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+ A+  +A +L++ENY+ I  +      ++ +W+ LL+ L+ RR +L+    +Q + QE  Y+MDWM E+ + L S+D+GKHLLGVE+LL+KH ++ +DI     R   ++ ++++  T        D   +  +   +   YQEL  L+ +R   L   + +W++  ++  ++ WI+E  Q+  S D G DL SV RL  K +    +++ R   ++  +       + D      E I   I +I E   NL+     R+ +L  +   +Q  AD +D DA +L+  R+  +SDVG     T+  +K+H++   ++      I  L  +   L  +     D       ++  +++L +LA  RK  L +    + +FS  +  E WI+ KE+ L  +   E+L++L VI+  F+  E +M   + +V+  NQI+R LI+  HP  + I  +Q+ LN  W+Q  +L ++ K  L  A+    + LE  ET+SWI++K K++E T +L +DL G+M LQR+L  ++RD+ AIEAK+  L KEA+KL+   P     I   +  +N +WEE+K  L++R+  L  +++LQ+F +DLD F  WL + Q  +A++D+P  L EAE+  T H  +K EI  +E +Y ++   G  V+  + D QY+   +RL  L+  WN L KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +ELPNN EA +A  +  E F  ++ +++ KI+AVV+ G  L+   N  SDKI  K + I SR    +   +     L+D+  + +F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N+E +D++ ++GN+LI EKP  E+ ++ K+  L   W EL +T   K+++L +AN+  +F ++   +  W+       + ++   ++YG  L  +N  +K Q+  + Q+D ++K + ++   A+ L  Q  +  DE +  +Q V+V+  E+ APL +R+  LL  K + QF RDVEDE  W+ E++   T        LQ     +++ +T   EI  H  R  D+    + ++ +   +++     L +L  LW  LI   E   +  EE+   Q+Y  +  E E WMSE+E  +M E+KAKDE  A++ ++KH+ L   + +Y   V +L+     ++    P S  ++ +Q +VDK+YA L ++  E++ K+++  + + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   + M D LI  GH ++  IA WKD +NEAWADLLELI+TR Q+L A+++  KF  D+ E+   I +K + +PE +G+D  +V T QR H  F  +I+ L   +      A +L   Y G+K  +I  R+ E+ + W +L    + R   L+D  D ++F++MVR+L+ WM ++  QI A +K RDV  VEL+++NH+ +KAEID+R+++ + CI LG++L+ RKH  + ++++K  ++  K   +++ W +R E+L +ILEV+QF+R+A+VAEAWL  QE  L++ + G +++E   L+++H   E++ A   +RF  L++LT         T               + +  + ++P P+P   RK ++  Q      +P +++ + SA                                    G L RKHEWE   KKA +R W+ +Y VI N +M  YK+ K          Y +E P +L  A+   AT+YKK+ +VF++++ +G EYLF+A D   +N
Sbjct:   30 DEWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--ARVSCRITDLYADLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLIGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVLAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLKARRLRLEMNLGLQKVFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVNASAQRFATGGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDYGKDLTSVVRLYCKHKAFEDEMSGRSGHLLQTIKEGEEMIAEDHFG--SEKIRERIKDIQEQWANLEHLSAIRKKRLEDTTSSYQFQADADDVDAWMLDILRIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRSTIDALHEQAAALPEERFNSTDVQNRLSGIEERYKELAELARLRKQALQDALTLYKMFSEADACELWIVEKEQWLNNMQIPEKLEDLEVIQ--FESLEPEMNNQASRVAVVNQIARQLIHSGHPSEKEIKAQQDKLNTRWSQFRELVDKTKDALSSALSIQNYHLECNETKSWIREKTKVIESTQELGNDLAGVMALQRKLTGMERDLAAIEAKLTDLQKEAEKLEAEHPDQAQAIMDRLAEINNVWEEMKTTLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLTQHENIKNEINNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQSLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTELPNNLEAAEAAIKTQEDFMTTMDASEEKINAVVDTGRRLVNDENINSDKIEEKVDSIDSRHKKNRAGANDLLMRLKDNREMQKFLQDCQELSLWINEKMLTARDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGNQLIAEKPETEAIVKEKMSALHAMWEELESTTQTKAQRLFDANKAELFTQSCADLDKWL-----HGLESQIQSDDYGKDLTSVNILLKKQQMLENQMDVRKKEVEELRSQAQALS-QEGKSTDEVDGQRQVVEVRFIELLAPLNERKKYLLASKEIHQFNRDVEDEILWVEERMPLATSTDHG-HNLQTVQLLMKKNQTLQKEIQGHQHRNDDIFERSKMILDDSSLNAEAITQRLADLQALWSLLIEETEKRHRRLEESHRAQQYYFDGAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVAEGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERQRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGHIGQERVDSVNHMADDLINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRESEVLEAWKALLDACDGRRLRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLFGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERFSALERLT---------TVLTLYTNELVNGSTEQRSSSKESSPIPSPTADRKSKSGMQPQTAATLPAKTQEMPSA---------------------------------QFEGFLHRKHEWEGHNKKASSRSWHNVYCVINNQEMGFYKDSKNAASGI---AYHNEIPANLKEAVCEVATDYKKKKHVFKLKLNDGNEYLFQAKDDVSIN 2235          
BLAST of Spectrin beta chain vs. Ensembl Mouse
Match: Sptbn1 (spectrin beta, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98388])

HSP 1 Score: 1439.09 bits (3724), Expect = 0.000e+0
Identity = 877/2347 (37.37%), Postives = 1384/2347 (58.97%), Query Frame = 2
Query:   56 DVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRI---DDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLI---RKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFP-SSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKV---------ETIK--QLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKEN-----PKL---------IETKSTTEPKT---------GTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPT 6958
            D  +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL  ++    + DL+ DL+DG+ L+KLLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVNI NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI VD P+EKSI+TYV +     +++K+   + KR+G V++ AI  EK+I  YE L+ +LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+ A+  +A +L++ENY+ I  +      ++ +W+ LL+ L+ RR +L+    +Q I QE  Y+MDWM E+ + L S+D+GKHLLGVE+LL+KH ++ +DI     R+   + +++K  T        D   +  +   +   YQEL  L+ +R   L   + +W++  ++  ++ WI+E  ++  S D G DL SV RL+   R FE  +S  +   +  + + + ++ +        R+ II+     I E   NL+Q    R+ +L ++   HQ  AD +D DA +L+  ++  ++DVG     T+  +K+H++   ++      I  L  + + L     +  D       ++   +++ +L   RK  L +    + +FS  +  E WI  KE+ L  +   E+L++L VI+HRF+  E +M   + +V+  NQI+R L++  HP  + I  +Q+ LN  W+Q  +L ++KK  L  A+    + LE  ET+SWI++K K++E T DL +DL G+M LQR+L  ++RD+ AIEAK+  L KEA+KL+   P     I S +  ++++WEE+K  L++R+A L  +++LQ+F +DLD F  WL + Q  +A++D+P  L EAE+  T H  +K EI  +E +Y ++   G  V+  + D QY+   +RL  L+  WN L KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +E+P   E  +A  ++ E F  ++ +N+ KI+AVV  G  L++  N  SD+I+ K + I  R    ++        L+D+  L +F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N+E +D++ ++G +LI EKP  E+ ++ K+  L   W  L +T   K+++L +AN+  +F ++   +  W+  + SQI + +     YG  L  +N  +K Q+  + Q++ ++K + +++  A+ L  Q  +  DE +  +  V+ K  E+  PL++R++ LL  K + QF RDVEDE  W+ E++   T        LQ     I++ +T   EI  H  RI D+    + +I +    +++     L +L +LW  LI   E   +  EE  + Q+Y  +A E E WMSE+E  +M E+KAKDE  A++ ++KH+ L   + +Y   V +L+     ++    P S  ++ +Q +VDK+YA L ++  E++ K+++  + + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   + M D+LI  GH ++  IA WKD +NEAWADLLELI+TR Q+L A+Y+  KF  D+ E+   I +K + +PE +G+D  +V T QR H  F  +I+ L   +      A +L   Y G+K  +I  R+ E+ + W SL    E R   L+D  D ++F++MVR+L+ WM ++  QI A +K RDV  VEL+++NH+ +KAEID+R+++ + CI LG++L+ RKH  + ++++K  ++  K   +++ W +R E+L +ILEV+QF+R+A+VAEAWL+ QE  L++ + G +++E   L+++H   E++ A   +RF                +A ++   L+  E R +    E    PP+P+P  KV         +T K  Q+S++ + P +  S + A  ++ S       E +  SKE+     P L          ++ +T   +T         G L RKHEWE   KKA +R W+ +Y VI N +M  YK+ K          Y  E P+ L  AI   A +YKK+ +VF++R+ +G EYLF+A D  EMN W++ I+     D    K+ T  + +S      T ASS  +  PT
Sbjct:   28 DDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--ARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIY-----IREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDD-----YGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALS-QEGKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHG-HNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERF----------------SALERLTTLELLEVRRQQEEEERKRRPPSPDPNTKVSEEAESQQWDTSKGDQVSQNGL-PAEQGSPRMAGTMETSEMVNGAAEQRTSSKESSPVPSPTLDRKAKSALPAQSAATLPARTLETPAAQMEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGI---PYHSEVPVSLKEAICEVALDYKKKKHVFKLRLSDGNEYLFQAKDDEEMNTWIQAISSAISSD----KHDTSASTQS------TPASSRAQTLPT 2330          
BLAST of Spectrin beta chain vs. Ensembl Mouse
Match: Sptbn1 (spectrin beta, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98388])

HSP 1 Score: 1439.09 bits (3724), Expect = 0.000e+0
Identity = 877/2347 (37.37%), Postives = 1384/2347 (58.97%), Query Frame = 2
Query:   56 DVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRI---DDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLI---RKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFP-SSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKV---------ETIK--QLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKEN-----PKL---------IETKSTTEPKT---------GTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPT 6958
            D  +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL  ++    + DL+ DL+DG+ L+KLLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVNI NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI VD P+EKSI+TYV +     +++K+   + KR+G V++ AI  EK+I  YE L+ +LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+ A+  +A +L++ENY+ I  +      ++ +W+ LL+ L+ RR +L+    +Q I QE  Y+MDWM E+ + L S+D+GKHLLGVE+LL+KH ++ +DI     R+   + +++K  T        D   +  +   +   YQEL  L+ +R   L   + +W++  ++  ++ WI+E  ++  S D G DL SV RL+   R FE  +S  +   +  + + + ++ +        R+ II+     I E   NL+Q    R+ +L ++   HQ  AD +D DA +L+  ++  ++DVG     T+  +K+H++   ++      I  L  + + L     +  D       ++   +++ +L   RK  L +    + +FS  +  E WI  KE+ L  +   E+L++L VI+HRF+  E +M   + +V+  NQI+R L++  HP  + I  +Q+ LN  W+Q  +L ++KK  L  A+    + LE  ET+SWI++K K++E T DL +DL G+M LQR+L  ++RD+ AIEAK+  L KEA+KL+   P     I S +  ++++WEE+K  L++R+A L  +++LQ+F +DLD F  WL + Q  +A++D+P  L EAE+  T H  +K EI  +E +Y ++   G  V+  + D QY+   +RL  L+  WN L KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +E+P   E  +A  ++ E F  ++ +N+ KI+AVV  G  L++  N  SD+I+ K + I  R    ++        L+D+  L +F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N+E +D++ ++G +LI EKP  E+ ++ K+  L   W  L +T   K+++L +AN+  +F ++   +  W+  + SQI + +     YG  L  +N  +K Q+  + Q++ ++K + +++  A+ L  Q  +  DE +  +  V+ K  E+  PL++R++ LL  K + QF RDVEDE  W+ E++   T        LQ     I++ +T   EI  H  RI D+    + +I +    +++     L +L +LW  LI   E   +  EE  + Q+Y  +A E E WMSE+E  +M E+KAKDE  A++ ++KH+ L   + +Y   V +L+     ++    P S  ++ +Q +VDK+YA L ++  E++ K+++  + + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   + M D+LI  GH ++  IA WKD +NEAWADLLELI+TR Q+L A+Y+  KF  D+ E+   I +K + +PE +G+D  +V T QR H  F  +I+ L   +      A +L   Y G+K  +I  R+ E+ + W SL    E R   L+D  D ++F++MVR+L+ WM ++  QI A +K RDV  VEL+++NH+ +KAEID+R+++ + CI LG++L+ RKH  + ++++K  ++  K   +++ W +R E+L +ILEV+QF+R+A+VAEAWL+ QE  L++ + G +++E   L+++H   E++ A   +RF                +A ++   L+  E R +    E    PP+P+P  KV         +T K  Q+S++ + P +  S + A  ++ S       E +  SKE+     P L          ++ +T   +T         G L RKHEWE   KKA +R W+ +Y VI N +M  YK+ K          Y  E P+ L  AI   A +YKK+ +VF++R+ +G EYLF+A D  EMN W++ I+     D    K+ T  + +S      T ASS  +  PT
Sbjct:   28 DDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--ARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIY-----IREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDD-----YGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALS-QEGKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHG-HNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERF----------------SALERLTTLELLEVRRQQEEEERKRRPPSPDPNTKVSEEAESQQWDTSKGDQVSQNGL-PAEQGSPRMAGTMETSEMVNGAAEQRTSSKESSPVPSPTLDRKAKSALPAQSAATLPARTLETPAAQMEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGI---PYHSEVPVSLKEAICEVALDYKKKKHVFKLRLSDGNEYLFQAKDDEEMNTWIQAISSAISSD----KHDTSASTQS------TPASSRAQTLPT 2330          
BLAST of Spectrin beta chain vs. Ensembl Mouse
Match: Sptbn1 (spectrin beta, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98388])

HSP 1 Score: 1362.05 bits (3524), Expect = 0.000e+0
Identity = 791/2060 (38.40%), Postives = 1257/2060 (61.02%), Query Frame = 2
Query:   56 DVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGR---IDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLI---RKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFP-SSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRF 6199
            D  +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL  ++    + DL+ DL+DG+ L+KLLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVNI NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI VD P+EKSI+TYV +     +++K+   + KR+G V++ AI  EK+I  YE L+ +LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+ A+  +A +L++ENY+ I  +      ++ +W+ LL+ L+ RR +L+    +Q I QE  Y+MDWM E+ + L S+D+GKHLLGVE+LL+KH ++ +DI     R   ++ +++K  T        D   +  +   +   YQEL  L+ +R   L   + +W++  ++  ++ WI+E  ++  S D G DL SV RL+   R FE  +S  +   +  + + + ++ +        R+ II+     I E   NL+Q    R+ +L ++   HQ  AD +D DA +L+  ++  ++DVG     T+  +K+H++   ++      I  L  + + L     +  D       ++   +++ +L   RK  L +    + +FS  +  E WI  KE+ L  +   E+L++L VI+HRF+  E +M   + +V+  NQI+R L++  HP  + I  +Q+ LN  W+Q  +L ++KK  L  A+    + LE  ET+SWI++K K++E T DL +DL G+M LQR+L  ++RD+ AIEAK+  L KEA+KL+   P     I S +  ++++WEE+K  L++R+A L  +++LQ+F +DLD F  WL + Q  +A++D+P  L EAE+  T H  +K EI  +E +Y ++   G  V+  + D QY+   +RL  L+  WN L KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +E+P   E  +A  ++ E F  ++ +N+ KI+AVV  G  L++  N  SD+I+ K + I  R    ++        L+D+  L +F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N+E +D++ ++G +LI EKP  E+ ++ K+  L   W  L +T   K+++L +AN+  +F ++   +  W+       + ++   ++YG  L  +N  +K Q+  + Q++ ++K + +++  A+ L  Q  +  DE +  +  V+ K  E+  PL++R++ LL  K + QF RDVEDE  W+ E++   T        LQ     I++ +T   EI  H  RI D+    + +I +    +++     L +L +LW  LI   E   +  EE  + Q+Y  +A E E WMSE+E  +M E+KAKDE  A++ ++KH+ L   + +Y   V +L+     ++    P S  ++ +Q +VDK+YA L ++  E++ K+++  + + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   + M D+LI  GH ++  IA WKD +NEAWADLLELI+TR Q+L A+Y+  KF  D+ E+   I +K + +PE +G+D  +V T QR H  F  +I+ L   +      A +L   Y G+K  +I  R+ E+ + W SL    E R   L+D  D ++F++MVR+L+ WM ++  QI A +K RDV  VEL+++NH+ +KAEID+R+++ + CI LG++L+ RKH  + ++++K  ++  K   +++ W +R E+L +ILEV+QF+R+A+VAEAWL+ QE  L++ + G +++E   L+++H   E++ A   +RF
Sbjct:   28 DDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--ARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIY-----IREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWL-----HGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALS-QEGKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHG-HNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERF 2073          
BLAST of Spectrin beta chain vs. Ensembl Mouse
Match: Sptbn1 (spectrin beta, non-erythrocytic 1 [Source:MGI Symbol;Acc:MGI:98388])

HSP 1 Score: 1343.95 bits (3477), Expect = 0.000e+0
Identity = 780/2045 (38.14%), Postives = 1241/2045 (60.68%), Query Frame = 2
Query:  101 SRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGR---IDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLI---RKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFP-SSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRF 6199
             R K L ++REAVQKKTFTKWVNSHL  ++    + DL+ DL+DG+ L+KLLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVNI NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI VD P+EKSI+TYV +     +++K+   + KR+G V++ AI  EK+I  YE L+ +LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+ A+  +A +L++ENY+ I  +      ++ +W+ LL+ L+ RR +L+    +Q I QE  Y+MDWM E+ + L S+D+GKHLLGVE+LL+KH ++ +DI     R   ++ +++K  T        D   +  +   +   YQEL  L+ +R   L   + +W++  ++  ++ WI+E  ++  S D G DL SV RL+   R FE  +S  +   +  + + + ++ +        R+ II+     I E   NL+Q    R+ +L ++   HQ  AD +D DA +L+  ++  ++DVG     T+  +K+H++   ++      I  L  + + L     +  D       ++   +++ +L   RK  L +    + +FS  +  E WI  KE+ L  +   E+L++L VI+HRF+  E +M   + +V+  NQI+R L++  HP  + I  +Q+ LN  W+Q  +L ++KK  L  A+    + LE  ET+SWI++K K++E T DL +DL G+M LQR+L  ++RD+ AIEAK+  L KEA+KL+   P     I S +  ++++WEE+K  L++R+A L  +++LQ+F +DLD F  WL + Q  +A++D+P  L EAE+  T H  +K EI  +E +Y ++   G  V+  + D QY+   +RL  L+  WN L KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +E+P   E  +A  ++ E F  ++ +N+ KI+AVV  G  L++  N  SD+I+ K + I  R    ++        L+D+  L +F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N+E +D++ ++G +LI EKP  E+ ++ K+  L   W  L +T   K+++L +AN+  +F ++   +  W+       + ++   ++YG  L  +N  +K Q+  + Q++ ++K + +++  A+ L  Q  +  DE +  +  V+ K  E+  PL++R++ LL  K + QF RDVEDE  W+ E++   T        LQ     I++ +T   EI  H  RI D+    + +I +    +++     L +L +LW  LI   E   +  EE  + Q+Y  +A E E WMSE+E  +M E+KAKDE  A++ ++KH+ L   + +Y   V +L+     ++    P S  ++ +Q +VDK+YA L ++  E++ K+++  + + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   + M D+LI  GH ++  IA WKD +NEAWADLLELI+TR Q+L A+Y+  KF  D+ E+   I +K + +PE +G+D  +V T QR H  F  +I+ L   +      A +L   Y G+K  +I  R+ E+ + W SL    E R   L+D  D ++F++MVR+L+ WM ++  QI A +K RDV  VEL+++NH+ +KAEID+R+++ + CI LG++L+ RKH  + ++++K  ++  K   +++ W +R E+L +ILEV+QF+R+A+VAEAWL+ QE  L++ + G +++E   L+++H   E++ A   +RF
Sbjct:   30 GRFKQLQDEREAVQKKTFTKWVNSHL--ARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIY-----IREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWL-----HGLESQIQSDDYGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALS-QEGKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHG-HNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERF 2060          
BLAST of Spectrin beta chain vs. Ensembl Mouse
Match: Sptbn2 (spectrin beta, non-erythrocytic 2 [Source:MGI Symbol;Acc:MGI:1313261])

HSP 1 Score: 1266.52 bits (3276), Expect = 0.000e+0
Identity = 799/2356 (33.91%), Postives = 1288/2356 (54.67%), Query Frame = 2
Query:   83 ALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTS-RKLQTADFDR--AAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKD---LIVDKLDSIV---HKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPV------------RKVETIKQLSEDIIVP-LQSRSVQSAVAIDDSAEAPPKQEVKEKS--KENP-------------------------KLIETKST------TEPKTGT-----------LTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYSTLPNIKSDFEMPVTEASS 6937
            A L+ERSRIKAL+++REAVQKKTFTKWVNSHL  ++    V DL+ DL+DG+ LL+LLE+LSGE +P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGL+WTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVN+ NFT+SW+DGLAFNA++HKHRP+++D+ +L K N   NL  AF  AE+E G+ +LLD  D+ VDQP+EKSI+TYV +     +++K+   + KR+G V++ A+ AE L+  YE L+ ELL+WI+  I  + + +L  SL GV+ QL  F++YR  EKPPKF ++G LE+  F IQSKLRA+N+K+Y P EG+LIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG +L  + AA++KHEA+E DI A+  R+ A+  +A +L +E+Y+ I  +      +  +W  L   +  RR++L    ++Q + Q+  YLMDWM E+  RLQS+D GKHL GVE+LL+ H+++ +DI     R+   S   L+  D  +     D   V  +   L  +Y+ L  L+  R   L   + +W ++ ++   + W++E   L  S D+G DL  V RL+ K   +  +++ R     L +++   +V   H  +N  S +          E+    + L+     R  QL Q+   +Q  AD  D +A +++  RL  + +VG     T+   +QH     ++      +  L  +   L        +       ++  +E+L   A  R   L      + + S       W+  KE+ L  L   E L++L V++ RF+  E +M   + +V+  N I+  L+    P  + I   Q  LN  W Q   LA+ KK  L  A+    + LE  ETQ+W+++K K++E T  L +DL G++ LQR+L   +RD++AI A+V  L +EA+ L    PA    I++ +  V   WE+L+  ++ R+  L  +  LQ F + LD F  WL + Q  VA+++ P  L EAE     H  ++ E+   + EY RL   G +V+  + DPQ L   +RL  L   W  L +MW+ +   L ++   Q F+RD+ Q +G+L+ QE  LS +E+P   +A  A  ++ E F +++ +N  +I  ++  G  L++  N  ++KI+ K + I  R    Q+ + +    L+D+     F  D   L  W+ EKM+ A D SY + +++ T++ + + F  EL AN++ +D+V ++G +L  EKP  +  +  K+ +L  +W EL  T   K++ L +ANR  +F ++  ++ SW+     + +  +   ++YG  L  +N  +K Q+  ++++  + K +  I+  A+ L ++    G E E   + V+ K   +  P+ +R   L   +   QF RDVEDE  W+ E+L   +  +   +   V L  +++ +T   EI  H  RI DL        R     +      L EL ++W  L    E   +  EE    Q++  +A E E WM E+E  +M ++KAKDE  A   ++KH+ L   + +Y   + +LA     +++ + P S  +  +Q +VDK+YA L E+  E++ ++++ ++   L R +  LE+WI ER  VA S+E+G + EH  +LR++F EF+  T+ +G  RV  A+ + + LIA GH     +A WKD +NEAWADLLEL++TR Q+L AAY+  +F+  + + L  +  K + +P+  G+D  +    QR+H A+  +I+ L   +        +L   Y G+K +EI      + + W  LQ     R   L+D +D ++F+  VREL+ WM  I +Q++A ++ RDV   +L+I N + +KAEI++R +  S CI +G+ L+ R H  A ++ +K  ++  +     + W+E+ ++L+++LEV  F R+A +AEAWL +QE  + + + G T++E  +L+++H   +++     +RF  L+KLT+ EE +     +++ E+ + +              PPT EP+            R  +T    ++  + P  Q+ SV       DS++   +Q+  E+S   E P                          + +++S+      T P  G            L RK E E   KKA NR W  +Y V+    +  YK+ +          Y  E P+ L  A  S A +Y+KR +VF++ +Q+G EYLF+A D+AEM+ W+  +N       ++A  S+ P    + E PV  ++S
Sbjct:   40 ARLFERSRIKALADEREAVQKKTFTKWVNSHL--ARVTCRVGDLYSDLRDGRNLLRLLEVLSGETLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNAFNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHAMEAEHLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFTEKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQEKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGRVQAVDAVAAELAAEHYHDIKRIAARQNNVARLWDFLRQMVAARRERLLLNLELQKVFQDLLYLMDWMAEMKGRLQSQDLGKHLAGVEDLLQLHELVEADIAVQAERVRAVSASALRFCDPGKEYRPCDPQLVSERVATLEQSYEALCELAATRRARLEESRRLWRFLWEVGEAEAWVREQQHLLASADTGRDLTGVLRLLNKHAALRGEMSGRLGPLKLTLEQGQQLVAEGHPGANQASTR--------AAELQAQWERLEALAEERAQQLAQAASLYQFQADANDMEAWLVDALRLVSSPEVGHDEFSTQALARQHRALEEEIRAHRPTLDALREQAAALPPALSHTPEVQGRVPTLEQHYEELQARAGERARALEAALAFYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQRFETLEPEMNALAARVTAVNDIAEQLLKASPPGKDRIIGTQEQLNQRWQQFRSLADGKKAALTSALSIQNYHLECTETQAWMREKTKVIESTQGLGNDLAGVLALQRKLAGTERDLEAISARVGELTQEANALAAGHPAQAPAINTRLGEVQAGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAWLGRTQTAVASEEGPATLPEAEALLAQHAALRGEVERAQSEYSRLRTLGEEVTRDQADPQCLFLRQRLEALGTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEYVLSHTEMPGTLQAADAAIKKLEDFMSTMDANGERIRGLLEAGRQLVSKGNIHAEKIQEKADSIEKRHRKNQEAVQQLLGRLRDNREQQHFLQDCQELRLWIDEKMLTAQDVSYDEARNLHTKWQKHQAFMAELAANKDWLDKVDKEGRELTLEKPELKVVVSEKLEDLHRRWDELETTTQAKARSLFDANRAELFAQSCSALESWL-----ESLQAQLHSDDYGKDLTSVNILLKKQQMLEREMAVREKEVEAIQAQAQALAQEDQSAG-EVERTSRAVEEKFRALCQPMKERCRRLHASREQHQFHRDVEDEILWVTERLPMASSLEHGKDLPSVQL-LMKKNQTLQKEIQGHEPRIADLKE------RQRTLGTAAAGPELAELQEMWKRLSHELELRGKRLEEALRAQQFYRDAAEAEAWMGEQELHMMGQEKAKDELSAQAEVKKHQVLEQALADYAQTIKQLAASSQDMIDHEHPESTRLTIRQAQVDKLYASLKELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSKDTSTIGQERVDSANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAAYELQRFLHGARQALARVQHKQQQLPDGTGRDLNAAEALQRRHCAYEHDIQALSTQVQQVQDDGQRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELMLWMDGINLQMDAQERPRDVSSADLVIKNQQGIKAEIEARADRFSSCIDMGQELLARSHYAAEEISEKLSQLQSRRQETADKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAELGCTVDEVESLIKRHEAFQKSAVAWEERFSALEKLTALEERENERKRKREEEERRKQ--------------PPTSEPMASQPEGSLVDGQRVPDTAWDGTQSKLPPSTQAPSVNGVCTDTDSSQPLLEQQRLEQSNVPEGPGSGTGDESSGPRGERQTLPRGPAPSPMPQSRSSEAAHGATLPTRGPELSAQEQMEGMLCRKQEMEAFNKKAANRSWQNVYCVLRRGSLGFYKDARAASAGV---PYHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVN------AAIATASSAPG---ESEEPVVPSAS 2346          
BLAST of Spectrin beta chain vs. UniProt/SwissProt
Match: sp|Q01082|SPTB2_HUMAN (Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2)

HSP 1 Score: 1444.1 bits (3737), Expect = 0.000e+0
Identity = 874/2348 (37.22%), Postives = 1378/2348 (58.69%), Query Frame = 2
Query:   56 DVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRI---DDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLI---RKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFP-SSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKV----------ETIK--QLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKT-----------------------GTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPT 6958
            D  +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL  ++    + DL+ DL+DG+ L+KLLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVNI NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI VD P+EKSI+TYV +     +++K+   + KR+G V++ AI  EK+I  YE L+ +LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+ A+  +A +L++ENY+ I  +      ++ +W+ LL+ L+ RR +L+    +Q I QE  Y+MDWM E+ + + S+D+GKHLLGVE+LL+KH ++ +DI     R+   + +++K  T        D   +  +   +   YQEL  L+ +R   L   + +W++  ++  ++ WI+E  ++  S D G DL SV RL+   R FE  +S  +   +  + + + ++ +        R+ II+     I E   NL+Q    R+ +L ++   HQ  AD +D DA +L+  ++  +SDVG     T+  +K+H++   ++      +  L  + + L  +  +  D       ++  ++++ +L   RK  L +    + +FS  +  E WI  KE+ L  +   E+L++L VI+HRF+  E +M   + +V+  NQI+R L++  HP  + I  +Q+ LN  W+Q  +L ++KK  L  A+    + LE  ET+SWI++K K++E T DL +DL G+M LQR+L  ++RD+ AIEAK+  L KEA+KL+   P     I S +  ++++WEE+K  L++R+A L  +++LQ+F +DLD F  WL + Q  +A++D+P  L EAE+  T H  +K EI  +E +Y ++   G  V+  + D QY+   +RL  L+  WN L KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +E+P   E  +A  ++ E F  ++ +N+ KI+AVV  G  L++  N  SD+I+ K + I  R    ++        L+D+  L +F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N+E +D++ ++G +LI EKP  E+ ++ K+  L   W  L +T   K+++L +AN+  +F ++   +  W+  + SQI + +     YG  L  +N  +K Q+  + Q++ ++K + +++  A+ L  Q  +  DE +  +  V+ K  E+  PL +R++ LL  K + QF RDVEDE  W+ E++   T        LQ     I++ +T   EI  H  RI D+    + ++ +    S++     L +L +LW  LI   E   +  EE    Q+Y  +A E E WMSE+E  +M E+KAKDE  A++ ++KH+ L   + +Y   V +L+     ++    P S  ++ +Q +VDK+YA L ++  E++ K+++  + + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   + + D+LI  GH ++  IA WKD +NEAWADLLELI+TR Q+L A+Y+  KF  D+ E+   I +K + +PE +G+D  +V T QR H  F  +I+ L   +      A +L   Y G+K  +I  R+ E+ + W SL    E+R   L+D  D ++F++MVR+L+ WM ++  QI A +K RDV  VEL+++NH+ +KAEID+R+++ + CI LG++L+ RKH  + ++++K  ++  K   +++ W +R E+L +ILEV+QF+R+A+VAEAWL+ QE  L++ + G +++E   L+++H   E++ A   +RF                +A ++   L+  E R +    E    PP+PEP  KV          +T K  Q+S++ + P +  S + A  +D S       E +  SKE+  +    S  + KT                       G L RKHEWE   KKA +R W+ +Y VI N +M  YK+ K          Y  E P+ L  A+   A +YKK+ +VF++R+ +G EYLF+A D  EMN W++ I+     D      ST            T ASS  +  PT
Sbjct:   28 DDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--ARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLVLSQDYGKHLLGVEDLLQKHTLVEADIGIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIY-----IREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSSDVGHDEYSTQSLVKKHKDVAEEIANYRPTLDTLHEQASALPQEHAESPDVRGRLSGIEERYKEVAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKEIKAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNRETASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDD-----YGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALS-QEGKSTDEVDSKRLTVQTKFMELLEPLNERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHG-HNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIVTDSSSLSAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNHLADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACESRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERF----------------SALERLTTLELLEVRRQQEEEERKRRPPSPEPSTKVSEEAESQQQWDTSKGEQVSQNGL-PAEQGSPRMAETVDTSEMVNGATEQRTSSKESSPIPSPTSDRKAKTALPAQSAATLPARTQETPSAQMEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKTAASGI---PYHSEVPVSLKEAVCEVALDYKKKKHVFKLRLNDGNEYLFQAKDDEEMNTWIQAISSAISSDKHEVSAST----------QSTPASSRAQTLPT 2331          
BLAST of Spectrin beta chain vs. UniProt/SwissProt
Match: sp|Q62261|SPTB2_MOUSE (Spectrin beta chain, non-erythrocytic 1 OS=Mus musculus OX=10090 GN=Sptbn1 PE=1 SV=2)

HSP 1 Score: 1439.09 bits (3724), Expect = 0.000e+0
Identity = 877/2347 (37.37%), Postives = 1384/2347 (58.97%), Query Frame = 2
Query:   56 DVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRI---DDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLI---RKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFP-SSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKV---------ETIK--QLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKEN-----PKL---------IETKSTTEPKT---------GTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPT 6958
            D  +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL  ++    + DL+ DL+DG+ L+KLLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVNI NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI VD P+EKSI+TYV +     +++K+   + KR+G V++ AI  EK+I  YE L+ +LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+ A+  +A +L++ENY+ I  +      ++ +W+ LL+ L+ RR +L+    +Q I QE  Y+MDWM E+ + L S+D+GKHLLGVE+LL+KH ++ +DI     R+   + +++K  T        D   +  +   +   YQEL  L+ +R   L   + +W++  ++  ++ WI+E  ++  S D G DL SV RL+   R FE  +S  +   +  + + + ++ +        R+ II+     I E   NL+Q    R+ +L ++   HQ  AD +D DA +L+  ++  ++DVG     T+  +K+H++   ++      I  L  + + L     +  D       ++   +++ +L   RK  L +    + +FS  +  E WI  KE+ L  +   E+L++L VI+HRF+  E +M   + +V+  NQI+R L++  HP  + I  +Q+ LN  W+Q  +L ++KK  L  A+    + LE  ET+SWI++K K++E T DL +DL G+M LQR+L  ++RD+ AIEAK+  L KEA+KL+   P     I S +  ++++WEE+K  L++R+A L  +++LQ+F +DLD F  WL + Q  +A++D+P  L EAE+  T H  +K EI  +E +Y ++   G  V+  + D QY+   +RL  L+  WN L KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +E+P   E  +A  ++ E F  ++ +N+ KI+AVV  G  L++  N  SD+I+ K + I  R    ++        L+D+  L +F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N+E +D++ ++G +LI EKP  E+ ++ K+  L   W  L +T   K+++L +AN+  +F ++   +  W+  + SQI + +     YG  L  +N  +K Q+  + Q++ ++K + +++  A+ L  Q  +  DE +  +  V+ K  E+  PL++R++ LL  K + QF RDVEDE  W+ E++   T        LQ     I++ +T   EI  H  RI D+    + +I +    +++     L +L +LW  LI   E   +  EE  + Q+Y  +A E E WMSE+E  +M E+KAKDE  A++ ++KH+ L   + +Y   V +L+     ++    P S  ++ +Q +VDK+YA L ++  E++ K+++  + + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   + M D+LI  GH ++  IA WKD +NEAWADLLELI+TR Q+L A+Y+  KF  D+ E+   I +K + +PE +G+D  +V T QR H  F  +I+ L   +      A +L   Y G+K  +I  R+ E+ + W SL    E R   L+D  D ++F++MVR+L+ WM ++  QI A +K RDV  VEL+++NH+ +KAEID+R+++ + CI LG++L+ RKH  + ++++K  ++  K   +++ W +R E+L +ILEV+QF+R+A+VAEAWL+ QE  L++ + G +++E   L+++H   E++ A   +RF                +A ++   L+  E R +    E    PP+P+P  KV         +T K  Q+S++ + P +  S + A  ++ S       E +  SKE+     P L          ++ +T   +T         G L RKHEWE   KKA +R W+ +Y VI N +M  YK+ K          Y  E P+ L  AI   A +YKK+ +VF++R+ +G EYLF+A D  EMN W++ I+     D    K+ T  + +S      T ASS  +  PT
Sbjct:   28 DDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--ARVSCRITDLYTDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLPAVEAATKKHEAIETDIAAYEERVQAVVAVARELEAENYHDIKRITARKDNVIRLWEYLLELLRARRQRLEMNLGLQKIFQEMLYIMDWMDEMKVLLLSQDYGKHLLGVEDLLQKHALVEADIAIQAERVRGVNASAQKFATDGEGYKPCDPQVIRDRVAHMEFCYQELCQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEKILSSDDYGKDLTSVMRLLSKHRAFEDEMSGRSGHFEQAIKEGEDMIAEEHFGSEKIRERIIY-----IREQWANLEQLSAIRKKRLEEASLLHQFQADADDIDAWMLDILKIVSSNDVGHDEYSTQSLVKKHKDVAEEITNYRPTIDTLHEQASALPQAHAESPDVKGRLAGIEERCKEMAELTRLRKQALQDTLALYKMFSEADACELWIDEKEQWLNNMQIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHNGHPSEKEIRAQQDKLNTRWSQFRELVDRKKDALLSALSIQNYHLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEAKLSDLQKEAEKLESEHPDQAQAILSRLAEISDVWEEMKTTLKNREASLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLTEAEKLLTQHENIKNEIDNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQQFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNINSDRIQEKVDSIDDRHRKNREAASELLMRLKDNRDLQKFLQDCQELSLWINEKMLTAQDMSYDEARNLHSKWLKHQAFMAELASNKEWLDKIEKEGMQLISEKPETEAVVKEKLTGLHKMWEVLESTTQTKAQRLFDANKAELFTQSCADLDKWLHGLESQIQSDD-----YGKDLTSVNILLKKQQMLENQMEVRKKEIEELQSQAQALS-QEGKSTDEVDSKRLTVQTKFMELLEPLSERKHNLLASKEIHQFNRDVEDEILWVGERMPLATSTDHG-HNLQTVQLLIKKNQTLQKEIQGHQPRIDDIFERSQNIITDSSSLNAEAIRQRLADLKQLWGLLIEETEKRHRRLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVSMLKKHQILEQAVEDYAETVHQLSKTSRALVADSHPESERISMRQSKVDKLYAGLKDLAEERRGKLDERHRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDTVNNMADELINSGHSDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEIFGRIQDKHKKLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAARLQAAYAGDKADDIQKRENEVLEAWKSLLDACEGRRVRLVDTGDKFRFFSMVRDLMLWMEDVIRQIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKEKLLQLTEKRKEMIDKWEDRWEWLRLILEVHQFSRDASVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWDERF----------------SALERLTTLELLEVRRQQEEEERKRRPPSPDPNTKVSEEAESQQWDTSKGDQVSQNGL-PAEQGSPRMAGTMETSEMVNGAAEQRTSSKESSPVPSPTLDRKAKSALPAQSAATLPARTLETPAAQMEGFLNRKHEWEAHNKKASSRSWHNVYCVINNQEMGFYKDAKSAASGI---PYHSEVPVSLKEAICEVALDYKKKKHVFKLRLSDGNEYLFQAKDDEEMNTWIQAISSAISSD----KHDTSASTQS------TPASSRAQTLPT 2330          
BLAST of Spectrin beta chain vs. UniProt/SwissProt
Match: sp|Q9QWN8|SPTN2_RAT (Spectrin beta chain, non-erythrocytic 2 OS=Rattus norvegicus OX=10116 GN=Sptbn2 PE=1 SV=2)

HSP 1 Score: 1286.55 bits (3328), Expect = 0.000e+0
Identity = 796/2313 (34.41%), Postives = 1276/2313 (55.17%), Query Frame = 2
Query:   83 ALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTS-RKLQTADFDR--AAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKD---LIVDKLDSIV---HKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTI-----------REFNT---------PPPTPEP-VRKVETIKQLSEDIIVPLQSRSVQSAV------AIDDSAEAP------------PKQEVKEKSKEN------PKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKIN 6844
            A L+ERSRIKAL+++REAVQKKTFTKWVNSHL  ++    V DL+ DL+DG+ LL+LLE+LSGE +P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGL+WTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVN+ NFT+SW+DGLAFNA++HKHRP+++D+ +L K N   NL  AF  AE+E G+ +LLD  D+ VDQP+EKSI+TYV +     +++K+   + KR+G V++ A+ AE L+  YE L+ ELL+WI+  I  + + +L  SL GV+ QL  F++YR  EKPPKF ++G LE+  F IQSKLRA+N+K+Y P EG+LIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG +L  + AA++KHEA+E DI A+  R+ A+  +A +L +E+Y+ I  +      +  +W  L + +  RR++L    ++Q + Q+  YLMDWM E+  RLQS+D GKHL GVE+LL+ H+++ +DI     R+   S   L+  D  +     D   V  +   L  +Y+ L  L+  R   L   + +W ++ ++   + W++E   L  S ++G DL  V RL+ K   +  +++ R     L +++   +V   H  +N  S +          E+    + L+     R  +L Q+   +Q  AD  D +A +++  RL  + +VG     T+   +QH     ++      +  L  +   L        +       ++  +E+L   A  R   L      + + S       W+  KE+ L  L   E L++L V++ RF+  E +M   + +V+  + I+  L+    P  + I   Q  LN  W Q   LA+ KK  L  A+    + LE  ETQ+W+++K K++E T DL +DL G++ LQR+L   +RD++AI A+V  L +EA+ L    PA    I++ +  V   WE+L+  ++ R+  L  +  LQ F + LD F  WL + Q  VA+++ P  L EAE     H  ++ E+   + EY RL   G +V+  + DPQ L   +RL  L   W  L +MW+ +   L ++   Q F+RD+ Q +G+L+ QE FLS +E+P   +A  A  ++ E F +++ +N  +I  ++  G  L++  N  ++KI+ K + I  R    Q+ + +    L+D+     F  D   L+ W+ EKM+ A D SY + +++ T++ + + F  EL AN++ +D+V ++G +L  EKP  +  +  K+ +L  +W EL  T   K++ L +ANR  +F ++  ++ SW+     + +  +   ++YG  L  +N  +K Q+  ++++  + K +  I+  A+ L ++    G E E   + V+ K   +  P+ DR   L   +   QF RDVEDE  W+ E+L   +  +   +   V L  +++ +T   EI  H  RI DL        R     +      L EL ++W  L    E   +  EE    Q++  +A E E WM E+E  +M ++KAKDE  A   ++KH+ L   + +Y   + +LA     +++ + P S  +  +Q +VDK+YA L E+  E++ ++++ ++   L R +  LE+WI ER  VA S+E+G + EH  +LR++F EF+  T+ +G  RV  A+ + + LIA GH     +A WKD +NEAWADLLEL++TR Q+L AAY+  +F+  + + L  +  K + +P+  G+D  +    QR+H A+  +I+ L   +        +L   Y G+K +EI      + + W  LQ     R   L+D +D ++F+  VREL+ WM  I +Q++A ++ RDV   +L+I N + +KAEI++R +  S CI +G+ L+ R H  A ++ +K  ++  +     E W+E+ ++L+++LEV  F R+A +AEAWL +QE  + + + G T++E  +L+++H   +++     +RF  L+KLT+ EE +     +++ E+ + +    E              R  +T         PP T  P +  V T  + S+ ++   Q R  QS V         D +  P            P    + +S E+      P      S  E   GTL RK E E   KKA NR W  +Y V+    +  YK+ +          Y  E P+ L  A  S A +Y+KR +VF++ +Q+G EYLF+A D+AEM+ W+  +N
Sbjct:   40 ARLFERSRIKALADEREAVQKKTFTKWVNSHL--ARVTCRVGDLYSDLRDGRNLLRLLEVLSGETLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNAFNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHAMEAEHLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFTEKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQEKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGRVQAVDAVAAELAAEHYHDIKRIAARQNNVARLWDFLREMVAARRERLLLNLELQKVFQDLLYLMDWMAEMKGRLQSQDLGKHLAGVEDLLQLHELVEADIAVQAERVRAVSASALRFCDPGKEYRPCDPQLVSERVATLEQSYEALCELAATRRARLEESRRLWRFLWEVGEAEAWVREQQHLLASAETGRDLTGVLRLLNKHTALRGEMSGRLGPLKLTLEQGQQLVAEGHPGANQASTR--------AAELQAQWERLEALAEERAQRLAQAASLYQFQADANDMEAWLVDALRLVSSPEVGHDEFSTQALARQHRALEEEIRAHRPTLDALREQAAALPPALSHTPEVQGRVPTLEQHYEELQARAGERARALEAALAFYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQRFETLEPEMNALAARVTAVSDIAEQLLKASPPGKDRIIGTQEQLNQRWQQFRSLADGKKAALTSALSIQNYHLECTETQAWMREKTKVIESTQDLGNDLAGVLALQRKLAGTERDLEAISARVGELTQEANALAAGHPAQAPAINTRLGEVQTGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAWLGRTQTAVASEEGPATLPEAEALLAQHAALRGEVERAQSEYSRLRTLGEEVTRDQADPQCLFLRQRLEALGTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEYFLSHTEMPGTLQAADAAIKKLEDFMSTMDANGERIRGLLEAGRQLVSKGNIHAEKIQEKADSIEKRHRKNQEAVQQLLGRLRDNREQQHFLQDCQELKLWIDEKMLTAQDVSYDEARNLHTKWQKHQAFMAELAANKDWLDKVDKEGRELTLEKPELKVLVSEKLEDLHRRWDELETTTQAKARSLFDANRAELFAQSCSALESWL-----ESLQAQLHSDDYGKDLTSVNILLKKQQMLEREMAVREKEVEAIQAQAKALAQEDQSAG-EVERTSRAVEEKFRALCQPMKDRCRRLQASREQHQFHRDVEDEILWVTERLPMASSLEHGKDLPSVQL-LMKKNQTLQKEIQGHEPRIADLKE------RQRTLGTAAAGPELAELQEMWKRLSHELELRGKRLEEALRAQQFYRDAAEAEAWMGEQELHMMGQEKAKDELSAQAEVKKHQVLEQALADYAQTIKQLAASSQDMIDHEHPESTRLTIRQAQVDKLYAGLKELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSRDTSTIGQERVDSANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAAYELQRFLHGARQALARVQHKQQQLPDGTGRDLNAAEALQRRHCAYEHDIQALSTQVQQVQDDGLRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELMLWMDGINLQMDAQERPRDVSSADLVIKNQQGIKAEIEARADRFSACIDMGQELLARNHYAAEEISEKLSQLQSRRQETAEKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAELGCTVDEVESLIKRHEAFQKSAVAWEERFSALEKLTALEERENEQKRKREEEERRKQPPTSEPMASQPEGSLVDGQRVLDTAWDGTQSKLPPSTQAPSINGVCTDTESSQPLLE--QQRLEQSNVPEGPGSGTGDESSGPRGERQTLPRGPAPSPMPQSRSSESAHVATLPARGAELSAQEQMEGTLCRKQEMEAFNKKAANRSWQNVYCVLRRGSLGFYKDARAASAGV---PYHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVN 2324          
BLAST of Spectrin beta chain vs. UniProt/SwissProt
Match: sp|O15020|SPTN2_HUMAN (Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3)

HSP 1 Score: 1284.63 bits (3323), Expect = 0.000e+0
Identity = 792/2311 (34.27%), Postives = 1271/2311 (55.00%), Query Frame = 2
Query:   83 ALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSR---KLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKD---LIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPP------------------PTPEPVRKVETIKQLSED--IIVPL--QSRSVQSAV------AIDDSAEAP------------PKQEVKEKSKEN------PKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKIN 6844
            A L+ERSRIKAL+++REAVQKKTFTKWVNSHL  ++    V DL+ DL+DG+ LL+LLE+LSGE +P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGL+WTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVN+ NFT+SW+DGLAFNA++HKHRP+++D+ +L K N   NL  AF  AE+E G+ +LLD  D+ VDQP+EKSI+TYV +     +++K+   + KR+G V++ A+ AE+L+  YE L+ ELL+WI+  I  + + +L  SL GV+ QL  F++YR  EKPPKF ++G LE+  F IQSKLRA+N+K+Y P EG+LIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG +L  + AA++KHEA+E DI A+  R+ A+  +A +L +E Y+ I  +      +  +W  L   +  RR++L    ++Q + Q+  YLMDWM E+  RLQS+D G+HL GVE+LL+ H+++ +DI     R+   S    +      +    D   V  +  +L  +Y+ L  L+  R   L   + +W ++ ++   + W++E   L  S D+G DL    RL+ K   +  +++ R     L +++   +V      P   +      E+    E L+ L +    R  +L Q+   +Q  AD  D +A +++  RL  + ++G     T+   +QH     ++      +  L  +   L     +  +       ++  +E+L   A  R   L      + + S       W+  KE+ L  L   E L++L V++ RF+  E +M   + +++  N I+  L+    P  + I   Q  LN  W Q   LA+ KK  L  A+    + LE  ETQ+W+++K K++E T  L +DL G++ LQR+L   +RD++AI A+V  L +EA+ L    PA    I++ +  V   WE+L+  ++ R+  L  +  LQ F + LD F  WL + Q  VA+++ P  L EAE     H  ++ E+   + EY RL   G +V+  + DPQ L   +RL  L   W  L +MW+ +   L ++   Q F+RD+ Q +G+L+ QE  LS +E+P   +A  A  ++ E F +++ +N  +I  ++  G  L++  N  +DKIR K + I  R    QD   +    L+D+     F  D   L+ W+ EKM+ A D SY + +++ T++ + + F  EL AN++ +D+V ++G +L  EKP  ++ +  K+ +L  +W EL  T   K++ L +ANR  +F ++  ++ SW+     + +  +   ++YG  L  +N  +K Q+  + ++  + K +  I+  A+ L ++    G E E   + V+ K   +  P+ +R   L   +   QF RDVEDE  W+ E+L   +  +   +   V L  +++ +T   EI  H  RI DL        R     +      L EL ++W  L    E   +  E+    Q++  +A E E WM E+E  +M ++KAKDE  A   ++KH+ L   + +Y   + +LA     +++ + P S  ++ +Q +VDK+YA L E+  E++ ++++ ++   L R +  LE+WI ER  VA S+E+G + EH  +LR++F EF+  T+ +G  RV  A+ + + LIA GH     +A WKD +NEAWADLLEL++TR Q+L AAY+  +F+  + + L  +  K + +P+  G+D  +    QR+H A+  +I+ L P +        +L   Y G+K +EI      + + W  LQ     R   L+D +D ++F+  VREL+ WM E+ +Q++A ++ RDV   +L+I N + +KAEI++R +  S CI +G+ L+ R H  A ++ +K  ++  +     E W+E+ ++L+++LEV  F R+A +AEAWL +QE  + + + G T++E  +L+++H   +++     +RF  L+KLT+ EE +K    +++ E+ + +    E T    + PP                  P P P  +  ++  +  D     PL  Q R   S+          D A  P            P    + +S E+      P      S  E   G L RK E E   KKA NR W  +Y V+    +  YK+ K          Y  E P+ L  A  S A +Y+KR +VF++ +Q+G EYLF+A D+AEM+ W+  +N
Sbjct:   40 ARLFERSRIKALADEREAVQKKTFTKWVNSHL--ARVTCRVGDLYSDLRDGRNLLRLLEVLSGEILPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLVWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRPDLLDFESLKKCNAHYNLQNAFNLAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDHAMEAERLVEKYESLASELLQWIEQTIVTLNDRQLANSLSGVQNQLQSFNSYRTVEKPPKFTEKGNLEVLLFTIQSKLRANNQKVYTPREGRLISDINKAWERLEKAEHERELALRTELIRQEKLEQLAARFDRKAAMRETWLSENQRLVSQDNFGLELAAVEAAVRKHEAIETDIVAYSGRVQAVDAVAAELAAERYHDIKRIAARQHNVARLWDFLRQMVAARRERLLLNLELQKVFQDLLYLMDWMEEMKGRLQSQDLGRHLAGVEDLLQLHELVEADIAVQAERVRAVSASALRFCNPGKEYRPCDPQLVSERVAKLEQSYEALCELAAARRARLEESRRLWRFLWEVGEAEAWVREQQHLLASADTGRDLTGALRLLNKHTALRGEMSGRLGPLKLTLEQGQQLV--AEGHPGASQASARAAELQAQWERLEALAE---ERAQRLAQAASLYQFQADANDMEAWLVDALRLVSSPELGHDEFSTQALARQHRALEEEIRSHRPTLDALREQAAALPPTLSRTPEVQSRVPTLERHYEELQARAGERARALEAALALYTMLSEAGACGLWVEEKEQWLNGLALPERLEDLEVVQQRFETLEPEMNTLAAQITAVNDIAEQLLKANPPGKDRIVNTQEQLNHRWQQFRRLADGKKAALTSALSIQNYHLECTETQAWMREKTKVIESTQGLGNDLAGVLALQRKLAGTERDLEAIAARVGELTREANALAAGHPAQAVAINARLREVQTGWEDLRATMRRREESLGEARRLQDFLRSLDDFQAWLGRTQTAVASEEGPATLPEAEALLAQHAALRGEVERAQSEYSRLRALGEEVTRDQADPQCLFLRQRLEALGTGWEELGRMWESRQGRLAQAHGFQGFLRDARQAEGVLSSQEYVLSHTEMPGTLQAADAAIKKLEDFMSTMDANGERIHGLLEAGRQLVSEGNIHADKIREKADSIERRHKKNQDAAQQFLGRLRDNREQQHFLQDCHELKLWIDEKMLTAQDVSYDEARNLHTKWQKHQAFMAELAANKDWLDKVDKEGRELTLEKPELKALVSEKLRDLHRRWDELETTTQAKARSLFDANRAELFAQSCCALESWL-----ESLQAQLHSDDYGKDLTSVNILLKKQQMLEWEMAVREKEVEAIQAQAKALAQEDQGAG-EVERTSRAVEEKFRALCQPMRERCRRLQASREQHQFHRDVEDEILWVTERLPMASSMEHGKDLPSVQL-LMKKNQTLQKEIQGHEPRIADLRE------RQRALGAAAAGPELAELQEMWKRLGHELELRGKRLEDALRAQQFYRDAAEAEAWMGEQELHMMGQEKAKDELSAQAEVKKHQVLEQALADYAQTIHQLAASSQDMIDHEHPESTRISIRQAQVDKLYAGLKELAGERRERLQEHLRLCQLRRELDDLEQWIQEREVVAASHELGQDYEHVTMLRDKFREFSRDTSTIGQERVDSANALANGLIAGGHAARATVAEWKDSLNEAWADLLELLDTRGQVLAAAYELQRFLHGARQALARVQHKQQQLPDGTGRDLNAAEALQRRHCAYEHDIQALSPQVQQVQDDGHRLQKAYAGDKAEEIGRHMQAVAEAWAQLQGSSAARRQLLLDTTDKFRFFKAVRELMLWMDEVNLQMDAQERPRDVSSADLVIKNQQGIKAEIEARADRFSSCIDMGKELLARSHYAAEEISEKLSQLQARRQETAEKWQEKMDWLQLVLEVLVFGRDAGMAEAWLCSQEPLVRSAELGCTVDEVESLIKRHEAFQKSAVAWEERFCALEKLTALEEREKERKRKREEEERRKQPPAPEPTA---SVPPGDLVGGQTASDTTWDGTQPRPPPSTQAPSVNGVCTDGEPSQPLLGQQRLEHSSFPEGPGPGSGDEANGPRGERQTRTRGPAPSAMPQSRSTESAHAATLPPRGPEPSAQEQMEGMLCRKQEMEAFGKKAANRSWQNVYCVLRRGSLGFYKDAKAASAGV---PYHGEVPVSLARAQGSVAFDYRKRKHVFKLGLQDGKEYLFQAKDEAEMSSWLRVVN 2324          
BLAST of Spectrin beta chain vs. UniProt/SwissProt
Match: sp|P11277|SPTB1_HUMAN (Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5)

HSP 1 Score: 1248.8 bits (3230), Expect = 0.000e+0
Identity = 755/2069 (36.49%), Postives = 1188/2069 (57.42%), Query Frame = 2
Query:   56 DVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYY---KITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDD-TSRKLQ-TADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRK---FEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFE 6229
            D L+NDN+SA L+ERSRIKAL+++RE VQKKTFTKWVNSHL  ++    + DL+ DL+DG+ L+KLLE+LSGE +P  TKGK+RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L+LGLIWTIILRFQIQD  +  ++G+  R++K++LLLWCQMKTAGY +VN+ NFTSSWKDGLAFNAL+HKHRP+++D+  L  +N   NL  AF  AER+ G+  LLD  D+  + P+EKSI+TYV +     +++K    + KR+G VI+ AI  EK+I  Y  L+ +LL WI+  I  + + K   SL GV++QL  FS YR  EKPPKFQ++G LE+  F IQS++RA+N+K+Y P +GKL+S INRAW++LE++E+R EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E D  A+EER+ AL  +A +L+ ENY+   +IT  +D    I+ +W  L + LQ+RR +L+    +Q + Q+  + +DWM EI   L S +FGKHLL VE+LL+KHK++ +DI     ++   T+  L+ T        D   +  +   L   ++EL  ++  R+ +L   K +W++  +++  + WIKE  Q++ S D G DL SV  L RK   FE  L  +    + I  +   +V +      PQ    I   I E++   D L       +  L  + +F Q   D +D  A + +  RL    DVG     T    K+H++ + ++EE   ++  L  +      + +   D     + ++  ++ +V  A+ R+  L    D + +F   +  E W+  KEK L  +   + L++L V++HRFD  + +MK    ++   N  +  L+   HP    + + Q+ LN  W     L  ++++ +  A+  + + ++ +ET  WI DK K++E T DL  DL GI+ +QR+L  L+RDV AI+A+V  L +E+ +L  + P  +  I      + ELW+ L+  LQ ++  L   ++LQ F +DLD F  WL   Q  VA++D+P+ L EAE+    H  +K+EI   +  Y R+ + G +V   + DP+YLL  +RL  L+  WNAL +MW+ +  +L +    Q F +D+ Q + IL+ QE  L+  E P++ EA +A  R+FE F  S+ +N+ K+ + V+ G  L+A  N  SDKI+ K + I  R     +K    +  L+D+L L  F  +   L  W+++K++ + D SY + +++  ++ + + F  EL ++   ++ +  +G +L+DEKP F + +  K+  L   W EL  T  EK++ L  A    +  +T   +  W++ +  Q+ + +   +   L  +N  +   +  + Q++ +++ L +       L  Q P  G+E       ++ +  ++  PL  R+  L   +   Q  RD+EDE  W+ E+L            LQ     +++ +T   EI  H  R+ D+   G++++             L  L   WD L  A     Q   +  E Q+Y  +A E E W+ E+E  ++ ++  KDE GA+  +++H      + +YG  + +LA +   +L+   P    + + Q +VDK YA L ++  E+K K+E++   + L R    LE+WI+E+  VA S E+G + +H  LLR++F +FA +T  +G  RV + +   ++LI  GH E+  IA WKD +NE WADLLELI+TR+QLL A+YD  ++    +E+L LI EK R +PE VG DA +  +  R H AF  E+  L   +     +A +L   Y GEK + I +++ E+   W +L      R   L+D +D ++F++M R+L++WM  I  QI   ++ RDV  VEL++  H+ + AEI++R +N S C+ LG +L+ R+H  + ++R+K ++V+ +   + E W  R E L M+LEV QF+R+A+VAEAWLIAQE  L + DFG T++    L+++H   E++ A  A+RF  L+K T+ E
Sbjct:   28 DELDNDNSSARLFERSRIKALADEREVVQKKTFTKWVNSHL--ARVSCRITDLYKDLRDGRMLIKLLEVLSGEMLPKPTKGKMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAKDALLLWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEHAFNVAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDHAIETEKMIEKYSGLASDLLTWIEQTITVLNSRKFANSLTGVQQQLQAFSTYRTVEKPPKFQEKGNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYRRELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVAQDNFGYDLAAVEAAKKKHEAIETDTAAYEERVRALEDLAQELEKENYHDQKRITARKDN---ILRLWSYLQELLQSRRQRLETTLALQKLFQDMLHSIDWMDEIKAHLLSAEFGKHLLEVEDLLQKHKLMEADIAIQGDKVKAITAATLKFTEGKGYQPCDPQVIQDRISHLEQCFEELSNMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEKEQIYSSLDYGKDLTSVLILQRKHKAFEDELRGLDAHLEQIFQEAHGMVARKQFG-HPQ----IEARIKEVSAQWDQLKDLAAFCKKNLQDAENFFQFQGDADDLKAWLQDAHRLLSGEDVGQDEGATRALGKKHKDFLEELEESRGVMEHLEQQAQGFPEEFRDSPDVTHRLQALRELYQQVVAQADLRQQRLQEALDLYTVFGETDACELWMGEKEKWLAEMEMPDTLEDLEVVQHRFDILDQEMKTLMTQIDGVNLAANSLVESGHPRSREVKQYQDHLNTRWQAFQTLVSERREAVDSALRVHNYCVDCEETSKWITDKTKVVESTKDLGRDLAGIIAIQRKLSGLERDVAAIQARVDALERESQQLMDSHPEQKEDIGQRQKHLEELWQGLQQSLQGQEDLLGEVSQLQAFLQDLDDFQAWLSITQKAVASEDMPESLPEAEQLLQQHAGIKDEIDGHQDSYQRVKESGEKVIQGQTDPEYLLLGQRLEGLDTGWNALGRMWESRSHTLAQCLGFQEFQKDAKQAEAILSNQEYTLAHLEPPDSLEAAEAGIRKFEDFLGSMENNRDKVLSPVDSGNKLVAEGNLYSDKIKEKVQLIEDRHRKNNEKAQEASVLLRDNLELQNFLQNCQELTLWINDKLLTSQDVSYDEARNLHNKWLKHQAFVAELASHEGWLENIDAEGKQLMDEKPQFTALVSQKLEALHRLWDELQATTKEKTQHLSAARSSDLRLQTHADLNKWISAMEDQLRSDDPGKD---LTSVNRMLAKLKRVEDQVNVRKEELGE-------LFAQVPSMGEEGGDADLSIEKRFLDLLEPLGRRKKQLESSRAKLQISRDLEDETLWVEERLPLAQSADYGT-NLQTVQLFMKKNQTLQNEILGHTPRVEDVLQRGQQLVEAAEIDCQDLEERLGHLQSSWDRLREAAAGRLQRLRDANEAQQYYLDADEAEAWIGEQELYVISDEIPKDEEGAIVMLKRHLRQQRAVEDYGRNIKQLASRAQGLLSAGHPEGEQIIRLQGQVDKHYAGLKDVAEERKRKLENMYHLFQLKRETDDLEQWISEKELVASSPEMGQDFDHVTLLRDKFRDFARETGAIGQERVDNVNAFIERLIDAGHSEAATIAEWKDGLNEMWADLLELIDTRMQLLAASYDLHRYFYTGAEILGLIDEKHRELPEDVGLDASTAESFHRVHTAFERELHLLGVQVQQFQDVATRLQTAYAGEKAEAIQNKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMARDLLSWMESIIRQIETQERPRDVSSVELLMKYHQGINAEIETRSKNFSACLELGESLLQRQHQASEEIREKLQQVMSRRKEMNEKWEARWERLRMLLEVCQFSRDASVAEAWLIAQEPYLASGDFGHTVDSVEKLIKRHEAFEKSTASWAERFAALEKPTTLE 2075          
BLAST of Spectrin beta chain vs. TrEMBL
Match: A0A0X3PMM5 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR158569 PE=4 SV=1)

HSP 1 Score: 1914.81 bits (4959), Expect = 0.000e+0
Identity = 1068/2349 (45.47%), Postives = 1540/2349 (65.56%), Query Frame = 2
Query:   35 NQFMQTKDVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTA-------DFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKN---DFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNAL-SDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIA-SDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXX-XXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGTLT----RKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXX-XXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGG---------VDTSLAKYSTLPNIKSDFE-------MPVTEASSEKKKFPTLGRKQ 6973
            N +   +D  E+ N++A LYERSRIKAL+++RE VQKKTFTKWVNSHL    +  H++DL++DL+DGK LLKLLEILSGE++P  T+GK+RIHC+ENV KS+NFL DQHV  EN+GAHDIVDGN  L LGLIWTIILRFQIQD  ++E      R +K++LLLWCQMKTAGYNNVN+RNFT+SW+DGLAFNAL+HKHRP+++DY  L+KA+P++NL  AF  AE + G+  LLD  D+ V+QP+EKSI+TYV +     N++K++    KR+G V+N+AI + +L N YE L+ +LL WI+  I+ + +     SLP V+ QL  F+ YR  +KPPKF ++G LE+  F +QSK+RA+N+K+Y P EGK I+ INRAW+NLE++EH  EL L +ELIRQ+KL QL   F+RKA MR+ WL EN  L+ Q  FG DL  + AA KKHEA+E DI A+EER+NA+  +A++L+ ENYY    ++     ++ +W+ LLD L+ RR  L    ++Q + QE  YL DW+ EI  RL+S D+GKHL+GVE+LL+KH +L +DIR L+GR++    + Q         + D   I+ D V+ + + L   Y +L  L+  R+  L+  + MW++  D++++KEWIKE  QL  SPD GHDL SVERL+RK   +  +   R  +    LDS   K   +   + +E + R IDE+ +L D L      R+ +L +S +F QL+AD +DADA +L+++R+  N DVG K+S TE  LK ++E M  +E   + + +L       ++      D      R+     ++   ++LA  R+  LL+    + LF   +T+ TWI  KEKLL TL PS+E++EL VI+HRF+CFE +M  ++ KV   N++S  L+++ HP+ + I   Q+ LN  WN+LADL E++K +L LA  YNQ+++E  ET +WI++K  L+E TD+L +DLEGIMQLQRRL  LQRD+QAI+AK+ Y++++AD L+ AKP     I +E   +++LW+ELK M+++RD RLN S+ELQ+F +D D F +WL+++Q  VA++D+P  L EAE+   +H +V+ EI  +  ++ RL++ GR+V+ ++ DPQY+   +RL+V+   W+AL+KM  D++  L +  +AQTF RD++Q D I+ +QE+F+SK E+P + EA +   +  E+F  ++ ++  KID V+  G  L A     ++KI+ KC+Q+  R  A++ K   R++ L     L  F  DV  +EEW++EK I+A +    RD   I+  Y++FK FE EL+AN++ +++VI+ G +L+ E+P  +++IEP+V  L  QW +L   A ++S +L ++NRE +FDET KSM++W+TEISSQ + TTEE+ EE GLVELNE++KDQE K+++L  KRKML D+  HAEKLKEQYPER DEFE + +EV+++LTE+EAP+ DRR  L ++KR++QF RD+EDEK+W+REKL+ +        +L  C Q  RR +    E+DNH  RI  + NEGE MI    P +      +DEL+ LW DL  A    Q   + N   Q+YL +A E E WM E+E  LM  +KAKDE GA +AM+KHE L   I NY   +  L D+   ++  + P +  VA KQ RVD+MYA L ++CLE++L++E++++ Y L R I  LE WIAER+ +A S+E+G++ EHC LLRERF+EF+ +TNE+G  RV  A+E+CD LI  GH E+ EIA WKDR+NEAWADLLELIETRIQLLKAA+D  KF+ D  ++LD I EK   IPE VG+DAK+VA  QRKH AF +E+ RL   +   +  A  LLP Y G+KE+ I DR+ E+ + W  LQ   E R   L+DASD+++F+AMVREL  WM  ++ ++++ +K RDV GVEL+++NHRSL+AEID+R+EN SIC++LGRTL+NR HP+  ++R+K  +++ +   + E W +R E L++ILEVYQFAR+AAVAEAWLIAQE  + + D G++L+ETL LL+KHL  ER  A Q +RF  L+KLT  E      T E +  +L+ R++++    REF  PP  P P              + P      Q++VA      AP +  V+  +  + +  E+  +  P    L     RKHEWE++TKKA  R W+ELY V+  +  ++   + + +  +K    Y  E P+ L GA++ PATNY+KR  VFR++++NG E LF+A    EM+ W+E IN I              +  K +TLP+     E            + + KKKF TL RK+
Sbjct:   49 NNYTSDEDDFESGNSTAKLYERSRIKALADEREIVQKKTFTKWVNSHLAVVND--HIEDLYLDLRDGKVLLKLLEILSGERLPKPTRGKMRIHCLENVDKSLNFLCDQHVHLENVGAHDIVDGNQRLTLGLIWTIILRFQIQDIIVEEYQTSETRCAKDALLLWCQMKTAGYNNVNVRNFTTSWRDGLAFNALIHKHRPDLIDYAKLSKASPLQNLQNAFSVAEEKLGITPLLDPADVCVEQPDEKSIITYVVTYYHFFNKLKADSVHSKRIGKVVNQAIESSELTNQYERLTSDLLTWIQNTIELLNDRVFANSLPDVQHQLAGFNTYRTIDKPPKFAEKGALEVLLFTLQSKMRANNQKVYTPTEGKSIADINRAWENLERAEHARELALRDELIRQEKLAQLATRFDRKAGMREAWLSENQRLLAQYNFGSDLAAVEAATKKHEAIETDISAYEERVNAVVSVAEELQLENYYDNDRIQARRETVLRLWQNLLDLLRKRRSCLALSLELQHVFQEMSYLQDWIDEIGNRLKSEDYGKHLMGVEDLLQKHGLLEADIRVLDGRLNHVLEQAQVFIDCNFPDNIDYRPIEPDVVEKRGRDLRAAYDQLHDLAATRKHALDDSRKMWQFFWDMDDEKEWIKEKSQLMSSPDLGHDLSSVERLLRKHRALEEECQTRHGVFQASLDS--GKKLIEEDNRGKENVQRRIDEMRDLWDQLADQTAERKQRLQESQEFFQLMADCDDADAWLLDQQRIASNEDVGVKMSTTESLLKINQELMENLEAYRETVNQLHA--TAAKVSDYPDIDGGMIASRLDGVDKNYSKAIELAKLRQQRLLDALSMYKLFDVSDTVRTWITEKEKLLTTLCPSDEIEELEVIRHRFECFEKEMTSNAEKVGNVNKLSASLLDKDHPDAQQIVVHQDTLNATWNELADLVEKQKGQLDLAYQYNQYLIECTETANWIKEKEHLIESTDELGNDLEGIMQLQRRLSGLQRDLQAIQAKIDYVDEQADLLEAAKPEASEVIQTERKKLHDLWDELKDMIKERDDRLNDSSELQRFLQDFDHFQMWLRRMQTTVASEDVPNTLTEAEKLVQDHEQVRMEIDGYADDFNRLMEMGRKVTENQTDPQYVYLAQRLDVIAENWDALQKMCDDREKVLKQDLEAQTFFRDAIQSDVIINKQENFVSK-EVPTSPEALQEAIQSHESFMAALPASDEKIDHVIAVGRELAARGVFPTEKIQLKCDQLEQRRAAVKQKAQERSALLAQQGQLQGFCQDVDDVEEWIAEKNIVAQAAPPPRDQFGIAAIYSKFKTFESELDANKDKIEKVIQAGEQLMLEQPELQAQIEPRVEVLRRQWDDLNTQAVDQSAKLADSNREALFDETAKSMLTWITEISSQIVTTTEEVTEEVGLVELNEQIKDQEKKEQELVAKRKMLEDMATHAEKLKEQYPERKDEFEQVHREVRIRLTELEAPMADRRERLAKQKRIRQFFRDLEDEKDWVREKLQLLEDSNRLGNSLLSCQQLKRRHRMLANEVDNHHPRIEAICNEGETMINEGHPHAANVREGIDELHALWADLQKAVAARQDALDLNEVAQQYLFDASEAEAWMGEQELYLMSSEKAKDEQGANSAMKKHELLQKTIENYAGEIRSLGDRSRAMIEGNHPEAEAVASKQSRVDRMYAGLHDLCLERRLRLEEILKLYSLLREILDLEAWIAERTVIASSHEMGADYEHCCLLRERFAEFSRETNELGKHRVNAANELCDALITQGHGEAAEIASWKDRVNEAWADLLELIETRIQLLKAAWDLHKFLCDCQDVLDRIAEKAGAIPEDVGRDAKAVAVLQRKHIAFESELTRLGQQVEEVVEFATTLLPSYAGDKERIICDRRDEVVQAWRQLQYSAEQRKVHLLDASDVHRFFAMVRELRLWMEMMQTEMSSKEKPRDVSGVELLMNNHRSLEAEIDAREENFSICLSLGRTLLNRNHPRQEEIREKCIQLVTERILLSEQWNDRWEHLKLILEVYQFARDAAVAEAWLIAQESFIKSSDLGESLDETLALLKKHLAFERAAATQEERFLALQKLTHLELKASERTPESEAARLELRKQKISEATREFQ-PPKQPVP--------------LTP-----AQASVAAAGVGSAPGRPGVETPTSRSIR--ESIDSGRPPPSNLEALLHRKHEWESATKKASARSWHELYFVLSAATGTLSAYKDQKHAHEKPGDLYHKEAPVSLAGAVAVPATNYEKRMYVFRLKLENGGESLFQARSDDEMHNWIEAINAISNSLGGLSSASASLAAGKAATLPSTALQLEESQQTSSSSQAHSKAPKKKFLTLMRKK 2368          
BLAST of Spectrin beta chain vs. TrEMBL
Match: A0A0R3UHC1 (Spectrin beta chain OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS6715 PE=3 SV=1)

HSP 1 Score: 1912.89 bits (4954), Expect = 0.000e+0
Identity = 1071/2360 (45.38%), Postives = 1532/2360 (64.92%), Query Frame = 2
Query:   35 NQFMQTKDVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGKRT--SKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRID---DTSRKLQTADFDRAA-----IDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKN---DFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALS-DKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXX-XXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEK---SKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHE-KPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEI--------------------GGVDTSLAKYSTLPN--------IKSDFEMPVTEASSEKKKFPTLGRKQ 6973
            N ++   D  E+ N++A LYERSRIKAL+++RE VQKKTFTKWVNSHL      + V+DL++DL+DGK LL+LLEILSGE++P  T+GK+RIHC+ENV KS+NFL DQHV  EN+GAHDIVDGN  L LGLIWTIILRFQIQD  ++E     T  +K++LLLWCQMKTAGYNNVN+RNF++SW+DGLAFNAL+HKHRP++++Y  LTKA P++NL  AF  A+ + G+P LLDA D+ V+QP+EKSI+TYV +     N++K++    KR+G V+N+AI + +LI+ YE+L+ ELL WI+  I+ + +     SLP V+ QL  F+ YR  +KPPKF ++G LE+  F +QSK+RA+N K+Y PP+GKLIS INRAW+NLEK+EH  EL L +ELIRQ+KL QL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+ ER+NA+  +A++L+ ENYY    ++     ++ +W  LLD L+ RR  L+    +Q + QE  YL DW+ EI  RL+S D+GKHL+GV++LL+KH +L +DIR L+ R+    D ++     +F         I+ ++V  + + L   Y++L  L++ R   L   + MW++  D++++KEWIKE  QL  SPD GHDL SVERL+RK   +  +  +R+++  + +  +      +   + +E I + IDE++EL D L      R+ +L +S +F QL+AD +DADA +++++R+  N DVG K+S TE  +K ++E M  +E+  + I  L       ++     +D+     R+ N   ++   ++LA  R+  LL+    + LF   +T+ TWI  KE+LL TL PS+ + EL V +HRF+CFE +M  ++ KVS  N++S +LI   HP+ + I  +Q+ LN  WN LADL E++K  ++ A  YNQ++LE QET  WI+DK  L+E TD+L +DLEGIMQLQRRL  LQRD+QAI+AK+ +L+++AD L V KP +   I +E   +++LW+ELK ML++RD RLN S+ELQ+F +DLD F VWL+K Q+ VA++D+P  L EAE+   NH + K EI  +E ++ RL++ GR+V  ++ DPQYL   ERL+ +E  W AL KM++D+D  L +  +AQ+F RD+  +D ++ +QE+ +SK E+ +  E+     R    F+ ++ +N  KI  V+  G  L A      +KI  KC+Q+  R  A+++K   R + L  H  L  F  DV  +EEW+SEK I+A          I+  Y +FK FE EL+AN++ +++VI  G  LI E+P  ++EIEP++  L  QW +L N A E+S +L ++NRE +FDET KSM++W+TE+SSQ + TTEE+ EE GLVELNE++KDQE K+++L  KRKML D+ +HAEKLKEQYP+R DEFE + QEV+++LTE+EAP+ +RR+ L ++KRV+QF RD+EDEK+WIREKL  I        +L    Q  RR K    E+DNH  RI  +  +GEEMI +  P S+KF   +DE+  LW  L  A +D Q    +N   Q+YL +A E E WM E+E  LM ++KA+DE GA NAM+KHE L   I NY S +  L D+   ++    P S +VA KQ RVDKMYA L ++CLE++L++E++++ Y L R I  LE WIAER+ +A S+E+G++ EHC LLRERF++F+ +TNE+G LRV  A+E+CD LIA GH E+ EIA WKDR+NEAWADLLELIETRIQLLKAA+D  KF+ D  ++LD I EK  +IPE VG+DAK+VA  QRKH A+  E+ RL   +   +  A+ LLP Y G+KE  I DR+ E+ + W  LQ   E R   L+DASD++KF+AMVREL  WM  +  ++   +K RDV GVEL+++NH+SLKAEID+R EN SIC++LGRTL+NR+HP+  ++R+K  +++ +   +LE W +R E L+++LEVY FAR+AAVAEAWLIAQE  + + D G++L+ETL LL+KHL  E+ +A Q +RF  L+KLT+ E   K  T E +  + K  E+++    REF   P T +P               VP           +    E P  + ++E     +  P+ +E           L RK+EWE + K+A  R W ELY V++ +  ++   +       K     H+  P++L GA+++PAT+Y KRP VFR+++ NG E LF+   + EM+ WVE IN +                    GG+ +   + +TLP+          S  ++P    S  KKKF TL RK+
Sbjct:   27 NNYISDDDDFESGNSTAKLYERSRIKALADEREIVQKKTFTKWVNSHLAVVN--HRVEDLYLDLRDGKHLLRLLEILSGERLPKPTRGKMRIHCLENVDKSLNFLCDQHVHLENVGAHDIVDGNQRLTLGLIWTIILRFQIQDIIVEEYQTSETKCAKDALLLWCQMKTAGYNNVNVRNFSTSWRDGLAFNALIHKHRPDLIEYQKLTKATPLQNLQNAFTVADEKLGIPPLLDANDVCVEQPDEKSIITYVAAYYHYFNKMKADTVHSKRIGKVVNQAIESSQLIDQYEQLTSELLTWIQKTIELLNDRVFANSLPDVQHQLAGFNTYRTVDKPPKFVEKGALEVLLFTLQSKMRANNHKVYSPPDGKLISDINRAWENLEKAEHARELALRDELIRQEKLSQLATRFDRKAGMREAWLSENQRLVAQYNFGSDLAAVEAATKKHEAIETDISAYAERVNAVVSVAEELQLENYYDNDRIQMRRENVLRLWSNLLDLLRKRRACLNLSLQLQRVFQEMSYLQDWIDEIGNRLKSEDYGKHLMGVDDLLQKHNLLEADIRVLDDRLTQVLDQAKVFVDCNFPENVEGYRPIEPEFVQKRGEDLRAAYEKLHELADARRQALEDSRKMWQFFWDMDDEKEWIKEKSQLMSSPDLGHDLTSVERLLRKHRALEEECKIRQNVFNNSV--VTGNNLINEGNRGKEAIQQRIDEMHELWDQLADVTAERKQRLQESQEFFQLMADCDDADAWLIDQQRIASNEDVGLKMSTTESLIKINQELMENLEQYRETINLL--HVTAAKVSEYPDSDSTIIGSRLDNVDENYNRALELAKQRQQRLLDALSMYKLFDVSDTVRTWITEKERLLATLCPSDVIQELEVTRHRFECFEKEMTKNAEKVSSVNKLSENLIKTDHPDSQQIVIRQDKLNATWNGLADLVEKQKCRIETAHQYNQYLLECQETACWIKDKKNLIESTDELGNDLEGIMQLQRRLSGLQRDLQAIQAKIDHLDEQADVLVVTKPEEAEAIRAERMKIHDLWDELKEMLKERDDRLNDSSELQRFLQDLDHFQVWLRKAQVTVASEDVPNTLPEAEKLLQNHEQFKPEIDGYEDDFKRLMEMGRRVVENQSDPQYLFLAERLDGIEENWVALHKMYEDRDKVLKQDVEAQSFFRDATLMDKLINKQEALISK-EVVSTPESVDEALRNLNTFQAAMPANDEKISQVIAVGRDLAARGVFPVEKILAKCDQLEQRRQAVKEKAIDREAKLAQHSRLQGFVQDVDDVEEWISEKTILAQHAPPPRGAGIAAIYGKFKTFESELDANKDKIEKVIATGEHLIAEQPQLQAEIEPRIEVLRRQWVDLNNQAQEQSAKLADSNREALFDETAKSMLTWITEVSSQIVTTTEEVTEEVGLVELNEQIKDQERKEQELMAKRKMLEDMAKHAEKLKEQYPDRKDEFEQVHQEVRIRLTELEAPMANRRDRLTKQKRVRQFFRDLEDEKDWIREKLAIIEDHGRMGTSLLSNQQMQRRHKMLANEVDNHQPRIDAVCQQGEEMIADGHPHSEKFREGIDEVRALWASLRLALDDRQAALLQNEVAQQYLFDASEAEAWMGEQELYLMGDEKARDEQGATNAMKKHELLQKTIENYASEIRSLGDRCRAMVESGHPESEVVAAKQSRVDKMYAGLHDLCLERRLRLEEILKLYSLLREILDLEAWIAERTVIASSHEMGADYEHCCLLRERFADFSKETNELGKLRVASANELCDALIAQGHGEAAEIASWKDRVNEAWADLLELIETRIQLLKAAWDLHKFLCDCQDVLDRIAEKSGIIPEDVGRDAKAVAVLQRKHAAYEAELSRLGQQVEEVVDFANNLLPSYAGDKESIICDRRDEVVQAWRQLQYAAEQRKIHLLDASDVHKFFAMVRELQLWMEAMRTEMTIKEKPRDVSGVELLMNNHKSLKAEIDARKENFSICLSLGRTLLNRRHPREEEIREKCIQLVTERVIMLEQWNDRNENLQLMLEVYHFARDAAVAEAWLIAQESFVKSPDLGESLDETLALLKKHLAFEKAVATQEERFIALEKLTTLELKAKEKTPESEAARKKAIEQKIVDASREFQPLPSTSQPA--------------VP---SGPMHGTPLRRGFETPTGRSLRESVDSGRPTPRNLE---------ALLHRKNEWETTVKRAFGRSWVELYFVLDATLGTLSAYKDSRSAHDKPGHLYHKVPPVNLAGAVAAPATDYDKRPYVFRLKLPNGGESLFQCLSEDEMHTWVETINSVSASLPAPVKVMPTTEEEEAEGGLVSPAGRSATLPSTALHLSETTSSGAQVPA--PSKPKKKFLTLMRKK 2351          
BLAST of Spectrin beta chain vs. TrEMBL
Match: A0A5K3ET41 (Spectrin beta chain OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 1912.5 bits (4953), Expect = 0.000e+0
Identity = 1075/2363 (45.49%), Postives = 1535/2363 (64.96%), Query Frame = 2
Query:   35 NQFMQTKDVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGKRT--SKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRID---DTSRKLQTADFDR-----AAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSND---PSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKN---DFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALS-DKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXX-XXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEK---SKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHE-KPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEI--------------------GGVDTSLAKYSTLPN--------IKSDFEMPVTEASSEKKKFPTLGRKQ 6973
            N ++   D  E+ N++A LYERSRIKAL+++RE VQKKTFTKWVNSHL      + V+DL++DL+DGK LL+LLEILSGE++P  T+GK+RIHC+ENV KS+NFL DQHV  EN+GAHDIVDGN  L LGLIWTIILRFQIQD  ++E     T  +K++LLLWCQMKTAGYNNVN+RNF++SW+DGLAFNAL+HKHRP++++Y  LTKA P++NL  AF  A+ + G+P LLDA D+ V+QP+EKSI+TYV +     N++K++    KR+G V+N+AI + +LI+ YE+L+ ELL WI+  I+ + +     SLP V+ QL  F+ YR  +KPPKF ++G LE+  F +QSK+RA+N K+Y PP+GKLIS INRAW+NLEK+EH  EL L +ELIRQ+KL QL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+ ER+NA+  +A++L+ ENYY    ++     ++ +W  LLD L+ RR  L+    +Q + QE  YL DW+ EI  RL+S D+GKHL+GV++LL+KH +L +DIR L+ R+    D ++     +F         I+ ++V  + + L   Y++L  L++ R   L   + MW++  D++++KEWIKE  QL  SPD GHDL SVERL+RK   +  +  +R+++  +   S+V  T N+      + +E I + IDE++EL D L      R+ +L +S +F QL+AD +DADA +++++R+  N DVG K+S TE  +K ++E M  +E+  + I  L       ++     +D+     R+ N   ++   ++LA  R+  LL+    + LF   +T+ TWI  KE+LL TL PS+ + EL V +HRF+CFE +M  ++ KVS  N++S +LI   HP+ + I  +Q+ LN  WN LADL E++K  ++ A  YNQ++LE QET  WI+DK  L+E TD+L +DLEGIMQLQRRL  LQRD+QAI+AK+ +L+++AD L V KP +   I +E   +++LW+ELK ML++RD RLN S+ELQ+F +DLD F VWL+K Q+ VA++D+P  L EAE+   NH + K EI  +E ++ RL++ GR+V  ++ DPQYL   ERL+ +E  W AL KM++D+D  L +  +AQ+F RD+  +D ++ +QE+ +SK E+ +  E+     R    F+ ++ +N  KI  V+  G  L A      +KI  KC+Q+  R  A+++K   R + L  H  L  F  DV  +EEW+SEK I+A          I+  Y +FK FE EL+AN++ +++VI  G  LI E+P  ++EIEP++  L  QW +L N A E+S +L ++NRE +FDET KSM++W+TE+SSQ + TTEE+ EE GLVELNE++KDQE K+++L  KRKML D+ +HAEKLKEQYP+R DEFE + QEV+++LTE+EAP+ +RR+ L ++KRV+QF RD+EDEK+WIREKL  I        +L    Q  RR K    E+DNH  RI  +  +GEEMI +  P S+KF   +DE+  LW  L  A +D Q    +N   Q+YL +A E E WM E+E  LM ++KA+DE GA NAM+KHE L   I NY S +  L D+   ++    P S +VA KQ RVDKMYA L ++CLE++L++E++++ Y L R I  LE WIAER+ +A S+E+G++ EHC LLRERF++F+ +TNE+G LRV  A+E+CD LIA GH E+ EIA WKDR+NEAWADLLELIETRIQLLKAA+D  KF+ D  ++LD I EK  +IPE VG+DAK+VA  QRKH A+  E+ RL   +   +  A+ LLP Y G+KE  I DR+ E+ + W  LQ   E R   L+DASD++KF+AMVREL  WM  +  ++   +K RDV GVEL+++NH+SLKAEID+R EN SIC++LGRTL+NR+HP+  ++R+K  +++ +   +LE W +R E L+++LEVY FAR+AAVAEAWLIAQE  + + D G++L+ETL LL+KHL  E+ +A Q +RF  L+KLT+ E   K  T E +  + K  E+++    REF   P T +P               VP           +    E P  + ++E     +  P+ +E           L RK+EWE + K+A  R W ELY V++ +  ++   +       K     H+  P++L GA+++PAT+Y KRP VFR+++ NG E LF+   + EM+ WVE IN +                    GG+ +   + +TLP+          S  ++P    S  KKKF TL RK+
Sbjct:   21 NNYISDDDDFESGNSTAKLYERSRIKALADEREIVQKKTFTKWVNSHLAVVN--HRVEDLYLDLRDGKHLLRLLEILSGERLPKPTRGKMRIHCLENVDKSLNFLCDQHVHLENVGAHDIVDGNQRLTLGLIWTIILRFQIQDIIVEEYQTSETKCAKDALLLWCQMKTAGYNNVNVRNFSTSWRDGLAFNALIHKHRPDLIEYQKLTKATPLQNLQNAFTVADEKLGIPPLLDANDVCVEQPDEKSIITYVAAYYHYFNKMKADTVHSKRIGKVVNQAIESSQLIDQYEQLTSELLTWIQKTIELLNDRVFANSLPDVQHQLAGFNTYRTVDKPPKFVEKGALEVLLFTLQSKMRANNHKVYSPPDGKLISDINRAWENLEKAEHARELALRDELIRQEKLSQLATRFDRKAGMREAWLSENQRLVAQYNFGSDLAAVEAATKKHEAIETDISAYAERVNAVVSVAEELQLENYYDNDRIQMRRENVLRLWSNLLDLLRKRRACLNLSLQLQRVFQEMSYLQDWIDEIGNRLKSEDYGKHLMGVDDLLQKHNLLEADIRVLDDRLTQVLDQAKVFVDCNFPENVEGYRPIEPEFVQKRGEDLRAAYEKLHELADARRQALEDSRKMWQFFWDMDDEKEWIKEKSQLMSSPDLGHDLTSVERLLRKHRALEEECKIRQNVFNN---SVV--TGNNLINEGNRGKEAIQQRIDEMHELWDQLADVTAERKQRLQESQEFFQLMADCDDADAWLIDQQRIASNEDVGLKMSTTESLIKINQELMENLEQYRETINLL--HVTAAKVSEYPDSDSTIIGSRLDNVDENYNRALELAKQRQQRLLDALSMYKLFDVSDTVRTWITEKERLLATLCPSDVIQELEVTRHRFECFEKEMTKNAEKVSSVNKLSENLIKTDHPDSQQIVIRQDKLNATWNGLADLVEKQKCRIETAHQYNQYLLECQETACWIKDKKNLIESTDELGNDLEGIMQLQRRLSGLQRDLQAIQAKIDHLDEQADVLVVTKPEEAEAIRAERMKIHDLWDELKEMLKERDDRLNDSSELQRFLQDLDHFQVWLRKAQVTVASEDVPNTLPEAEKLLQNHEQFKPEIDGYEDDFKRLMEMGRRVVENQSDPQYLFLAERLDGIEENWVALHKMYEDRDKVLKQDVEAQSFFRDATLMDKLINKQEALISK-EVVSTPESVDEALRNLNTFQAAMPANDEKISQVIAVGRDLAARGVFPVEKILAKCDQLEQRRQAVKEKAIDREAKLAQHSRLQGFVQDVDDVEEWISEKTILAQHAPPPRGAGIAAIYGKFKTFESELDANKDKIEKVIATGEHLIAEQPQLQAEIEPRIEVLRRQWVDLNNQAQEQSAKLADSNREALFDETAKSMLTWITEVSSQIVTTTEEVTEEVGLVELNEQIKDQERKEQELMAKRKMLEDMAKHAEKLKEQYPDRKDEFEQVHQEVRIRLTELEAPMANRRDRLTKQKRVRQFFRDLEDEKDWIREKLAIIEDHGRMGTSLLSNQQMQRRHKMLANEVDNHQPRIDAVCQQGEEMIADGHPHSEKFREGIDEVRALWASLRLALDDRQAALLQNEVAQQYLFDASEAEAWMGEQELYLMGDEKARDEQGATNAMKKHELLQKTIENYASEIRSLGDRCRAMVESGHPESEVVAAKQSRVDKMYAGLHDLCLERRLRLEEILKLYSLLREILDLEAWIAERTVIASSHEMGADYEHCCLLRERFADFSKETNELGKLRVASANELCDALIAQGHGEAAEIASWKDRVNEAWADLLELIETRIQLLKAAWDLHKFLCDCQDVLDRIAEKSGIIPEDVGRDAKAVAVLQRKHAAYEAELSRLGQQVEEVVDFANNLLPSYAGDKESIICDRRDEVVQAWRQLQYAAEQRKIHLLDASDVHKFFAMVRELQLWMEAMRTEMTIKEKPRDVSGVELLMNNHKSLKAEIDARKENFSICLSLGRTLLNRRHPREEEIREKCIQLVTERVIMLEQWNDRNENLQLMLEVYHFARDAAVAEAWLIAQESFVKSPDLGESLDETLALLKKHLAFEKAVATQEERFIALEKLTTLELKAKEKTPESEAARKKAIEQKIVDASREFQPLPSTSQPA--------------VP---SGPMHGTPLRRGFETPTGRSLRESVDSGRPTPRNLE---------ALLHRKNEWETTVKRAFGRSWVELYFVLDATLGTLSAYKDSRSAHDKPGHLYHKVPPVNLAGAVAAPATDYDKRPYVFRLKLPNGGESLFQCLSEDEMHTWVETINSVSASLPAPVKVMPTTEEEEAEGGLVSPAGRSATLPSTALHLSETTSSGAQVPA--PSKPKKKFLTLMRKK 2345          
BLAST of Spectrin beta chain vs. TrEMBL
Match: A0A075A6I1 (Spectrin beta chain OS=Opisthorchis viverrini OX=6198 GN=T265_02435 PE=3 SV=1)

HSP 1 Score: 1910.19 bits (4947), Expect = 0.000e+0
Identity = 1061/2344 (45.26%), Postives = 1542/2344 (65.78%), Query Frame = 2
Query:   41 FMQTKDVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEK--DGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTAD-FDRAA----------IDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKL---DSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDL----ELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALS-DKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXX-XXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXX-XXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKIN---------EIGGVDTSLAKYSTLPNIKSDFEMP-VTEASSEKKKFPTLGRKQ 6973
            +   +D  E+ N++A LYERSRIKAL+++RE VQKKTFTKWVNSHL+       ++DL++DL+DGK LLKLLEILSGE++PP T+GK+RIHC+ENV KS+NFL DQHV  EN+GAHDIVDG+P L LGLIWTIILRFQIQD  ++E+     R +K++LLLWCQMKTAGY NVN+RNFT+SW+DGLAFNAL+HKHRP++++Y  L+KA P++NL  AF  AE    +  LLD  D+ V+QP+EKSI+TYV +     N++K++    KR+G ++N+AI  E +IN YE+L+ +LLEWI+  I+ + N   + SL GV+ QL  F+ YR  +KPPKF+++G LE+  F I+S++R++N+ +Y PPEGKLIS INRAW+ LE++EH  EL L +ELIRQ+KLEQL + F+RKA +R+ WL +N  LV Q  FG DL  + AA KKHEA+E DI+A++ER+NA+  +A++L+ ENY+ +  V+     ++ +W  L+  L  RR +LD    +Q + QE  YLMDW+ EI  RL+S D+GKHL+GVE+L++KH ++ +DIR L GR++     LQ AD F   A          I+ D V  + ++L   Y+EL  L + R   L   K MW++  D+ ++KEWIKE  QL  SPD GHDL SV RL+RK + I  D TV   ++ + L   D ++ + +       +E I + + E+ +L D L     +R+ +L +S +F QLLAD +DAD  + E++R   N DVG KL+ TE  LK ++E M  + E +K I +L  +   +    + D+       +A +R    + D+V L   R+  LL+    + LF   +T+ TWI  KE+LL TLVPS+EL EL VI+HRF+CFE ++  ++ KV   N++S  ++   HP+   I  +Q+ LN  WNQLADL + +K++L LA  YNQF++ES ET +WI++K KL+E TD+L +DL GIMQLQRRLG LQRD++AIEAKV++L+K+A++L  AKP     + +E   ++ELW+ELK ML+DRD RLN S+ELQ+F +DLD F +WL++ Q  VA++DIP +LQEAE    NH ++  EI  +E ++ RL+ FGR+ +  K D QY    +RL+++E +W+AL  M+  +   L ++ +A TF RD+LQ D +L + E  ++K E P + EA +   R+++  + S+  N  +ID V+  G+ L+       +K++ KCEQ+ SR ++++ +   R  AL++ L L +F  +V  +EEW++EK +  ++      K+I+  Y RFK FE EL+AN++ + +VI++G  L+   P  E++I+P++  L+ QW EL  TA +KS ++ +ANRE +FDET KSMM+W+TE+ +QI+TT E + EE GLVELNE +KDQ+ KD++L  KR+ML D+  HAEKLKEQYP+R +EFE + QEV+++LTE+EAPL  RR  LL++KRV+QFLRD+EDEK+WI++KL  I        +L    Q +RR +    E++NH  RI  +  EGE+MI+   P SD+F  A+DEL  LW  L        Q   EN   Q+YL +A E E WM E+E  LM E++AKDE GA NAM++HE+L  V+ NY + +  L ++   +L  + P +  VA KQ RVDKMYA L E+C+E++ ++E++++ Y L R I  LE WIAER  VA S+E+G++ EHC LLRERF+EFA +T+E+G  R+  A+E+CD LI  GH E+ EIA WKDR+NEAWADLLELI+TRIQLLK A+D  KF+SD  ++LD I EK   IPE VG+DAK+VA  QRKH  F  ++ RL   +   +  A+ LLP Y G+KE+ I DR+ E+   W  LQ   E R   L+DA+D+++F+AMVREL  WM  +  ++   +K RDV G++L+++NHRSLKAEID+R+EN SIC++LGRTL+NR+HP+  +VR+K  +++ +   +++ W ER E L+++LEVYQFAR+A VAEAWL+AQE  L + D G+TL+ETL LL+KHL  ER  A Q +RF  L+KLT+ E   +  T E +  +  ++E+R+   IREF        P          +E + +  ++R +   V        P +    + S   P+  E         G LTRKHEW++  KKA +R W++LY V+  S+ ++   ++     +K  + Y+HE P++L GA ++PA NY KR  VFR+++ NG E LF+A     M++WV+ IN         ++     +  + +TLP+       P  + A++ KKKF TLGRK+
Sbjct:   36 YTSDEDDFESGNSTAKLYERSRIKALADEREIVQKKTFTKWVNSHLVVVS--CSIEDLYLDLRDGKMLLKLLEILSGERLPPPTRGKMRIHCLENVDKSLNFLCDQHVHLENVGAHDIVDGSPRLTLGLIWTIILRFQIQDIVVEEQMTSETRCAKDALLLWCQMKTAGYPNVNVRNFTTSWRDGLAFNALIHKHRPDLINYAALSKAEPMKNLTNAFSVAEERLHLTPLLDPSDVCVEQPDEKSIITYVVTYYHYFNKMKADTVHSKRIGKIVNQAIETEDMINQYEQLTSDLLEWIEKTIELLNNRTFSNSLSGVQHQLAGFNTYRTADKPPKFEEKGGLEVLLFTIRSRMRSNNQAIYNPPEGKLISDINRAWEELERAEHARELALRDELIRQEKLEQLASRFDRKAGLREAWLTDNQRLVAQDNFGQDLAAVEAATKKHEAIETDIYAYQERVNAMVNVAEELERENYHDLERVQLRRDNVLALWGNLISSLTLRRHRLDLSLQLQHVFQEMSYLMDWIEEIKGRLRSTDYGKHLMGVEDLIQKHALIEADIRVLGGRMEQV---LQQADPFITCAFPQEVGSYRPIEPDVVQERGRELRAAYEELHDLKDARLQGLQDSKKMWQFFWDMEDEKEWIKEKSQLMSSPDLGHDLSSVGRLLRKHKAIEEDSTVHLGVLQNALKNGDKLIEEGNLG-----KEQIEQHMREMKQLWDQLVDQTADRKQRLMESQEFFQLLADCDDADVWLAEQQRTVSNEDVGLKLATTESLLKNNQEIMDNLNEYQKTIDQLHQQAATVSDYPDCDAATIGSRLDAVDR---HYADVVGLCKLRQQRLLDALAMYKLFDVSDTVRTWITEKERLLTTLVPSDEL-ELEVIRHRFECFERELTANAEKVESVNKLSEGMLVTDHPDGSKILAQQDTLNASWNQLADLVDNRKRQLDLAYQYNQFLIESAETANWIKEKAKLVESTDELGNDLSGIMQLQRRLGGLQRDLKAIEAKVEHLDKQAEELCQAKPEQANVVSAERAKIHELWDELKEMLKDRDDRLNYSSELQRFLQDLDHFQMWLRRTQTDVASEDIPNNLQEAEALVDNHKQLGAEIDGYEADFHRLMDFGRRETEGKTDAQYEYLAKRLDLIEEDWDALHNMYAKRGEILSQNVEAHTFFRDALQADIVLAKLEQAVAKEETPTSLEAAEENLRQWDVLEASILKNDERIDHVLAQGQDLIDRKIFPVEKMQAKCEQLASRRESLKKRAAERKEALEEQLHLQQFCQEVDDVEEWLTEKAVAVTEQPTPLAKNIALLYGRFKAFEGELDANKDKIADVIKEGQVLMQSHPMLEAQIQPRIEALQRQWVELETTAADKSAKMADANRETLFDETAKSMMTWITEVRTQIVTTTEDVTEEIGLVELNEHLKDQDRKDQELQSKRRMLEDMATHAEKLKEQYPDRQEEFEQVHQEVRIRLTELEAPLASRREKLLKQKRVRQFLRDIEDEKDWIKDKLALIEDSSKMGNSLLAAQQLLRRHRMLANEVENHRPRIDSVCQEGEQMIQEGHPRSDRFRKAIDELWDLWGQLEEVVSSRHQKLLENEVAQQYLFDASEAEAWMGEQELYLMGEERAKDEQGANNAMKRHEQLQKVVENYSAEIRNLGERSRAMLEANHPEAEAVAIKQARVDKMYAGLRELCVERRARLEEILKLYSLLRDILDLEAWIAERIAVASSHELGADYEHCCLLRERFAEFARETSELGRHRIGAANELCDALIDQGHGEAAEIAGWKDRVNEAWADLLELIDTRIQLLKTAWDLHKFLSDCQDVLDRIAEKASSIPEEVGRDAKAVAALQRKHATFEYDLSRLGSQVEGIIEAANGLLPSYAGDKERLICDRRDEVIHAWRQLQCSTEQRKIHLLDAADVHRFFAMVRELRMWMETMRTEMATKEKPRDVSGIDLLMNNHRSLKAEIDAREENFSICLSLGRTLLNRRHPREEEVREKCIQLVTERIQLIDQWTERWETLQLLLEVYQFARDAEVAEAWLMAQEPYLASKDLGETLDETLALLKKHLAFERAAATQEERFIALQKLTTLELKARERTPETEAARRAEKERRIAEAIREFQP------PPTLPTVPVTEAEQVTLDERTREIVGQV-----PSTPKRARDSKDSGRPPRDFE---------GLLTRKHEWQSGGKKAPSRSWHDLYFVLSASQGTLSAYKEQRLAKEKPGELYRHETPVNLAGASAAPAFNYTKRRFVFRLKLANGGETLFQARSDESMHEWVQAINAVVASLPAEQVESTSGAGGRAATLPSGAQPEPQPGSSSAATGKKKFLTLGRKK 2345          
BLAST of Spectrin beta chain vs. TrEMBL
Match: A0A419PFY3 (Spectrin beta chain OS=Clonorchis sinensis OX=79923 GN=beta-Spec PE=3 SV=1)

HSP 1 Score: 1909.81 bits (4946), Expect = 0.000e+0
Identity = 1061/2343 (45.28%), Postives = 1537/2343 (65.60%), Query Frame = 2
Query:   41 FMQTKDVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEK--DGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTAD-FDRAA----------IDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKL---DSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMK---NDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALS-DKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXX-XXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXX-XXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKIN---------EIGGVDTSLAKYSTLPNIKSDFEMP-VTEASSEKKKFPTLGRKQ 6973
            +   +D  E+ N++A LYERSRIKAL+++RE VQKKTFTKWVNSHL+       ++DL++DL+DGK LLKLLEILSGE++PP T+GK+RIHC+ENV KS+NFL DQHV  EN+GAHDIVDG+P L LGLIWTIILRFQIQD  ++E+     R +K++LLLWCQMKTAGY NVN+RNFT+SW+DGLAFNAL+HKHRP++++Y  L+KA P++NL  AF  AE    +  LLD  D+ V+QP+EKSI+TYV +     N++K++    KR+G ++N+AI  E +IN YE+L+ +LLEWI+  I+ + N   + SL GV+ QL  F+ YR  +KPPKF+++G LE+  F I+S++R++N+ +Y PPEGKLIS INRAW+ LE++EH  EL L +ELIRQ+KLEQL + F+RKA +R+ WL +N  LV Q  FG DL  + AA KKHEA+E DI+A++ER+NA+  +A++L+ ENY+ +  V+     ++ +W  L+  L  RR +LD    +Q + QE  YLMDW+ EI  RL+S D+GKHL+GVE+L++KH ++ +DIR L GR++     LQ AD F   A          I+ D V  + ++L   Y+EL  L + R   L   K MW++  D+ ++KEWIKE  QL  SPD GHDL SV RL+RK + I  D TV   ++ + L   D ++ + +       +E I + + E+ +L D L     +R+ +L +S +F QLLAD +DAD  + E++R   N DVG KL+ TE  LK ++E M  ++E  K I +L   +    +      DA     R+      + D+V L   R+  LL+    + LF   +T+ TWI  KE+LL TLVPS+EL EL VI+HRF+CFE ++  ++ KV   N++S  ++   HP+   I  +Q+ LN  WNQLADL + +K++L LA  YNQF++ES ET +WI++K KL+E TD+L +DL GIMQLQRRLG LQRD++AIEAKV +L+K+A++L  AKP     + +E   ++ELW+ELK ML+DRD RLN S+ELQ+F +DLD F +WL++ Q  VA++DIP +LQEAE     H ++  EI  +E ++ RL+ FGR+ +  K D QY    +RL+++E +W+AL  M+  +   L ++ +A TF RD+LQ D +L + E  ++K E P + EA +   R+++  + S+  N  +ID V+  G+ L+       +K++ KCEQ+ SR D+++ +   R  AL++ L L +F  +V  +EEW++EK +  ++      K+I+  Y RFK FE EL+AN++ + +VI++G  L+   P  E++I+P++  L+ QW EL  TA +KS ++ +ANRE +FDET KSMM+W+TE+ +QI+TT E + EE GLVELNE +KDQ+ KD++L  KR+ML D+  HAEKLKEQYP+R +EFE + QEV+++LTE+EAPL  RR  LL++KRV+QFLRD+EDEK+WI++KL  I        +L    Q +RR +    E++NH  RI  +  EGE+MI+   P SD+F  A+DEL  LW  L        Q   EN   Q+YL +A E E WM E+E  LM E++AKDE GA NAM++HE+L  V+ NY + +  L ++   +L  + P +  VA KQ RVDKMYA L E+C+E++ ++E++++ Y L R I  LE WIAER  VA S+E+G++ EHC LLRERF+EFA +T+E+G  R+  A+E+CD LI  GH E+ EIA WKDR+NEAWADLLELI+TRIQLLK A+D  KF+SD  ++LD I EK   IPE VG+DAK+VA  QRKH  F  ++ RL   +   +  A+ LLP Y G+KE+ I DR+ E+   W  LQ   E R   L+DA+D+++F+AMVREL  WM  +  ++   +K RDV G++L+++NHRSLKAEID+R+EN SIC++LGRTL+NR+HP+  +VR+K  +++ +   +++ W ER E L+++LEVYQFAR+A VAEAWL+AQE  L + D G+TL+ETL LL+KHL  ER  A Q +RF  L+KLT+ E   +  T E +  +  ++E+R+   IREF        P          +E + +  ++R +     I      P +    + S   P+  E         G LTRKHEW++  KKA +R W++LY V+  S+ ++   ++     +K  + Y+HE P++L GA ++PA NY KR  VFR+++ NG E LF+A     M++WV+ IN         ++     +  + +TLP+       P  + A++ KKKF TLGRK+
Sbjct:   22 YTSDEDDFESGNSTAKLYERSRIKALADEREIVQKKTFTKWVNSHLVVVS--CSIEDLYLDLRDGKMLLKLLEILSGERLPPPTRGKMRIHCLENVDKSLNFLCDQHVHLENVGAHDIVDGSPRLTLGLIWTIILRFQIQDIVVEEQMTSETRCAKDALLLWCQMKTAGYPNVNVRNFTTSWRDGLAFNALIHKHRPDLINYAALSKAEPMKNLTNAFSVAEERLHLTPLLDPSDVCVEQPDEKSIITYVVTYYHYFNKMKADTVHSKRIGKIVNQAIETEDMINQYEQLTSDLLEWIEKTIELLNNRTFSNSLSGVQHQLAGFNTYRTADKPPKFEEKGGLEVLLFTIRSRMRSNNQAIYNPPEGKLISDINRAWEELERAEHARELALRDELIRQEKLEQLASRFDRKAGLREAWLTDNQRLVAQDNFGQDLAAVEAATKKHEAIETDIYAYQERVNAMVNVAEELERENYHDLERVQLRRDNVLGLWGNLISSLTLRRHRLDLSLQLQHVFQEMSYLMDWIEEIKGRLRSTDYGKHLMGVEDLIQKHALIEADIRVLGGRMEQV---LQQADPFITCAFPQEVGSYRPIEPDVVQERGRELRAAYEELHDLKDARLQGLQDSKKMWQFFWDMEDEKEWIKEKSQLMSSPDLGHDLSSVGRLLRKHKAIEEDSTVHLGVLQNALKNGDKLIEEGNLG-----KEQIEQHMREMKQLWDQLVDQTADRKQRLMESQEFFQLLADCDDADVWLAEQQRSVSNEDVGLKLATTESLLKNNQEIMDNLDEYRKTIDQLH--QQAATVSDYPDCDAATIASRLDAVDRHYADVVGLCKLRQQRLLDALAMYKLFDVSDTVRTWITEKERLLTTLVPSDEL-ELEVIRHRFECFERELTANAEKVESVNKLSEGMLGTDHPDGSKILAQQDTLNASWNQLADLVDTRKRQLDLAYQYNQFLIESAETANWIKEKAKLVESTDELGNDLSGIMQLQRRLGGLQRDLKAIEAKVAHLDKQAEELCQAKPEQANVVSAERAKIHELWDELKEMLKDRDDRLNYSSELQRFLQDLDHFQMWLRRTQTDVASEDIPNNLQEAEALVDKHKQLGAEIDGYEADFHRLMDFGRRETEGKTDAQYEYLAKRLDLIEEDWDALHNMYDKRGEILSQNVEAHTFFRDALQADIVLAKLEQAVAKDETPTSLEAAEENLRQWDVLEASILKNDERIDHVLAQGQDLIDRKIFPVEKMQAKCEQLASRRDSLKKRAAERKEALEEQLHLQQFCQEVDDVEEWLTEKAVAVTEQPTPLAKNIALLYGRFKAFEGELDANKDKIADVIKEGQVLMQSHPMLEAQIQPRIEALQRQWVELETTAADKSAKMADANRETLFDETAKSMMTWITEVRTQIVTTTEDVTEEIGLVELNEHLKDQDRKDQELQSKRRMLEDMATHAEKLKEQYPDRQEEFEQVHQEVRIRLTELEAPLASRREKLLKQKRVRQFLRDIEDEKDWIKDKLALIEDSSKMGNSLLAAQQLLRRHRMLANEVENHRPRIDSVCQEGEQMIQEGHPRSDRFRKAIDELWDLWGQLEEVVSSRHQKLLENEVAQQYLFDASEAEAWMGEQELYLMGEERAKDEQGANNAMKRHEQLQKVVENYSTEIRNLGERSRAMLEANHPEAEAVAIKQARVDKMYAGLRELCVERRARLEEILKLYSLLRDILDLEAWIAERIAVASSHELGADYEHCCLLRERFAEFARETSELGRHRIGAANELCDALIDQGHGEAAEIAGWKDRVNEAWADLLELIDTRIQLLKTAWDLHKFLSDCQDVLDRIAEKASSIPEEVGRDAKAVAALQRKHATFEYDLSRLGSQVEGIIEAANGLLPSYAGDKERLICDRRDEVIHAWRQLQCSTEQRKVHLLDAADVHRFFAMVRELRMWMETMRTEMATKEKPRDVSGIDLLMNNHRSLKAEIDAREENFSICLSLGRTLLNRRHPREEEVREKCIQLVTERIQLIDQWTERWETLQLLLEVYQFARDAEVAEAWLMAQEPYLASKDLGETLDETLALLKKHLAFERAAATQEERFIALQKLTTLELKARERTPETEAARRAEKERRIAEAIREFQP------PPTLPTVPVTEAEQVTLDERTREI-----IGQVPSTPKRARDSKDSGRPPRDFE---------GLLTRKHEWQSGGKKAPSRSWHDLYFVLSASQGTLSAYKEQRLAKEKPGELYRHETPVNLAGASAAPAFNYTKRRFVFRLKLANGGETLFQARSDESMHEWVQAINAVVANLPAEQLESTSGAGGRAATLPSGAQPEPQPGSSSAATGKKKFLTLGRKK 2331          
BLAST of Spectrin beta chain vs. Ensembl Cavefish
Match: ENSAMXT00000030945.1 (spectrin beta chain, non-erythrocytic 1-like [Source:NCBI gene;Acc:103033421])

HSP 1 Score: 1417.14 bits (3667), Expect = 0.000e+0
Identity = 852/2342 (36.38%), Postives = 1363/2342 (58.20%), Query Frame = 2
Query:   56 DVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAA---IDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLI---VDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKN---DFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSA-------LQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEV--------KEKSKENPKLIETKSTTEPKT--GTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPTLGRKQK*ISTF 6991
            D  +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL  ++    + DL++DL+DG+ L+KLLE+LSGEK+P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVNI NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI V+ P+EKSI+TYV +     +++K+ + + KR+G V++ AI  EK+I  YE L+ +LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+  +  +A +L++ENY+ I  +      ++ +W  LL+ L+ RR +L+    +Q + QE  Y+MDWM E+ + L S+D+GKHLLGVE+LL+KH ++ +DI     R+   +   Q    D       D   +  +   +   YQEL  L+ +R   L   + +W++  ++  ++ WI+E  Q+  S D G DL +V RL+ K + +  + + R   +   V + + +V          RQ I      ++ E   +L++    RR +L  +   HQ  AD +D DA +L+  R+  ++DVG      +  +K+H++   ++     ++  L  +   L    ++Q  A E   R+      ++++ +L   RK  L +    + + S  +  E WI+ KE+ L ++   E+L++L VI+HRFD  E +M   + +V+  NQI+R LI+  HP  + I  +Q+ LN  W+Q  DL ++KK+ L   +    + LE  ET+SWI++K K++E T DL +DL G+M LQR+L  ++RD+ AIE K+  L KEAD+L        + I   +  + ++WEE+K  L+ R+  L  +++LQ+F ++LD F  WL + Q  VA++D P  L EAE+    H  +K EI  +E +Y ++   G  V+  + D Q++   +RL  L+  WN L+KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +E+ +  E  +A  ++ E F  ++ +N+ KI+AVV  G  L++   +S       E+I  + D+I ++  +   A       L+D+  L  F  D   L  W+SEKM+ A D SY + +++ +++ + + F  EL++N+E +D++ + G+ L++EKP  E+ ++ K+  L+  W EL +T   K++ L +AN+  +F ++   +  W++ +  QI + +     +G  L  +N  +K Q+  + Q++ ++K + ++   A+ L  Q  +  DE +  ++ V+VK  +++ PL  RR+ L+  + + QF RDVEDE  W+ E++   T        LQ     I++ +T   EI  H  R  D+       ++ + P S    + L++L ++W  +    E      EE    Q+Y  +A E E WMSE+E  +M E+KAKDE  ++  ++KH+ L   + +Y   V +L+     ++    P S  ++ +Q +VDK+YA L ++  E++ K+++  + + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   ++M D LI  GH ++  IA WKD +NEAWADLLELI+TR Q+L A+Y+  KF  D+ E+L  I +K + +P+ +G+D  +V T QR H  F  +I+ L   +      A +L   Y G+K  +I  R+ E+ + W SL +  + R   L+D SD ++F++MVR+L+ WM ++   I+A +K RDV  VEL+++NH+ +KAEID+R+++ + CI LG+ L+ RKH  + ++++K  ++  K   +++ W +R E+L ++LEV+QF+R+A VAEAWL+ QE  L++ + G  ++E   L+++H   E++ A   +RF  L++LT+ E     L   + +E+ + + +           P P     R+ E + Q      +P +  S + A    D      +           K K+ +   L      T P    G L RKHEWE   KKA NR W+ +Y VI N +M  YK+ K          Y  E PI L  +    A +YKKR +VF++++ +G EYLF+A D  EMN W++ I+      + ++ +ST P       +P + + S+         K+K  S F
Sbjct:   28 DEWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--ARVSCRITDLYMDLRDGRMLIKLLEVLSGEKLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVEHPDEKSIITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRTELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQVVVAVAGELEAENYHDIKRITARKDNVLRLWDYLLELLRARRQRLELNLGLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVKSVNSNAQKFADDSEGYKPCDPQVIRDRVAHMEFCYQELTQLAAERRGRLEESRRLWKFFWEMAEEEGWIREKEQILSSEDCGKDLTAVVRLLSKHKALEDERSGRAGRLQQTVQQGEELVAAGHFGADKIRQRI-----SDVQEQWASLERLFSARRTRLQDACALHQFQADADDMDAWMLDVLRIVSSADVGHDEFSAQSLVKKHKDVAEEISSYRPVLDALHEQARTL---PEEQARAGEVSGRLAGIEERYKEVAELTRLRKQALQDALALYKMLSEADACELWIVEKEQWLNSMEIPEKLEDLEVIQHRFDSLEPEMNSQASRVAVVNQIARQLIHSGHPSEKEIKGQQDKLNTRWSQFRDLVDRKKEALNSTLGVQNYYLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEDKLGDLGKEADRLSEEHGDKASGIKGRLGEIKDVWEEMKGTLRTREESLGEASKLQQFLRELDDFQAWLSRTQTAVASEDKPNTLAEAEKLLAQHEGIKNEIRNYEEDYQKMRDMGEMVTQGQTDAQHMFLRQRLQALDTGWNELQKMWENRQKLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMADTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNIS------AERIQEKVDSIDERRKKNRGAASELLTKLKDNRDLQRFLQDCQELSLWISEKMLTAKDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIQKAGSALVEEKPETEAVVQGKMEMLKKTWEELESTTQTKAQCLFDANKAELFTQSCADLDKWLSGLEGQIHSDD-----FGKDLTSVNILLKKQQMLESQVEVRQKEVEELRSQAQALS-QEGKGSDEVDGRRRGVEVKFQQVQEPLKKRRSNLMASREIHQFNRDVEDEILWVEERMALATSTDHG-NNLQTVQLLIKKNQTLQKEIQGHQPRYDDIFERSVRTLQEESPVSAGIRLRLEDLQRIWKLIQEEVEKRHGRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSSVAMLKKHQILEQAVEDYAETVHQLSKTSRALVAAGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERSRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDAVNKMADDLINSGHADAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEVLGRILDKHKKLPDELGRDQNTVETLQRMHTTFEHDIQALGTQVKQLQEDAVRLQSAYAGDKADDIQRREGEVLEAWRSLLEACDGRRVRLLDTSDKFRFFSMVRDLMLWMEDVIRLIDAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKALLARKHYASEEIKEKLLQLTDKRKEMIDKWEDRWEWLRLVLEVHQFSRDAGVAEAWLLGQEPYLSSREMGQNVDEVEKLIKRHEAFEKSAATWEERFSALERLTTME----LLEVRRMQEEEEKKRQPPPEEAPPAEEPSPQQ---REGEQVSQNG----LPTEQDSPREAAGGSDVVNGVAETSPSSSPTGSRKGKASQAATLPTKAQDTPPAQIEGFLNRKHEWEGHNKKASNRSWHNVYCVINNQEMGFYKDSKSASQGI---PYHSEIPISLKDSTCEIALDYKKRKHVFKLKLSDGNEYLFQAKDDEEMNSWIQAIS--CATPSEISSHST-PASGRAHTLPASASVSDSSPGKREKDKEKRFSLF 2329          
BLAST of Spectrin beta chain vs. Ensembl Cavefish
Match: ENSAMXT00000009444.2 (spectrin beta chain, non-erythrocytic 1-like [Source:NCBI gene;Acc:103033421])

HSP 1 Score: 1395.95 bits (3612), Expect = 0.000e+0
Identity = 841/2327 (36.14%), Postives = 1347/2327 (57.89%), Query Frame = 2
Query:  101 SRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAA---IDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLI---VDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKN---DFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSA-------LQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEV--------KEKSKENPKLIETKSTTEPKT--GTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPTLGRKQK*ISTF 6991
             R K L ++REAVQKKTFTKWVNSHL  ++    + DL++DL+DG+ L+KLLE+LSGEK+P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVNI NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI V+ P+EKSI+TYV +     +++K+ + + KR+G V++ AI  EK+I  YE L+ +LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+  +  +A +L++ENY+ I  +      ++ +W  LL+ L+ RR +L+    +Q + QE  Y+MDWM E+ + L S+D+GKHLLGVE+LL+KH ++ +DI     R+   +   Q    D       D   +  +   +   YQEL  L+ +R   L   + +W++  ++  ++ WI+E  Q+  S D G DL +V RL+ K + +  + + R   +   V + + +V          RQ I      ++ E   +L++    RR +L  +   HQ  AD +D DA +L+  R+  ++DVG      +  +K+H++   ++     ++  L  +   L    ++Q  A E   R+      ++++ +L   RK  L +    + + S  +  E WI+ KE+ L ++   E+L++L VI+HRFD  E +M   + +V+  NQI+R LI+  HP  + I  +Q+ LN  W+Q  DL ++KK+ L   +    + LE  ET+SWI++K K++E T DL +DL G+M LQR+L  ++RD+ AIE K+  L KEAD+L        + I   +  + ++WEE+K  L+ R+  L  +++LQ+F ++LD F  WL + Q  VA++D P  L EAE+    H  +K EI  +E +Y ++   G  V+  + D Q++   +RL  L+  WN L+KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +E+ +  E  +A  ++ E F  ++ +N+ KI+AVV  G  L++   +S       E+I  + D+I ++  +   A       L+D+  L  F  D   L  W+SEKM+ A D SY + +++ +++ + + F  EL++N+E +D++ + G+ L++EKP  E+ ++ K+  L+  W EL +T   K++ L +AN+  +F ++   +  W++ +  QI + +     +G  L  +N  +K Q+  + Q++ ++K + ++   A+ L  Q  +  DE +  ++ V+VK  +++ PL  RR+ L+  + + QF RDVEDE  W+ E++   T        LQ     I++ +T   EI  H  R  D+       ++ + P S    + L++L ++W  +    E      EE    Q+Y  +A E E WMSE+E  +M E+KAKDE  ++  ++KH+ L   + +Y   V +L+     ++    P S  ++ +Q +VDK+YA L ++  E++ K+++  + + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   ++M D LI  GH ++  IA WKD +NEAWADLLELI+TR Q+L A+Y+  KF  D+ E+L  I +K + +P+ +G+D  +V T QR H  F  +I+ L   +      A +L   Y G+K  +I  R+ E+ + W SL +  + R   L+D SD ++F++MVR+L+ WM ++   I+A +K RDV  VEL+++NH+ +KAEID+R+++ + CI LG+ L+ RKH  + ++++K  ++  K   +++ W +R E+L ++LEV+QF+R+A VAEAWL+ QE  L++ + G  ++E   L+++H   E++ A   +RF  L++LT+ E     L   + +E+ + + +           P P     R+ E + Q      +P +  S + A    D      +           K K+ +   L      T P    G L RKHEWE   KKA NR W+ +Y VI N +M  YK+ K          Y  E PI L  +    A +YKKR +VF++++ +G EYLF+A D  EMN W++ I+      + ++ +ST P       +P + + S+         K+K  S F
Sbjct:   68 GRFKQLQDEREAVQKKTFTKWVNSHL--ARVSCRITDLYMDLRDGRMLIKLLEVLSGEKLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVEHPDEKSIITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRTELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQVVVAVAGELEAENYHDIKRITARKDNVLRLWDYLLELLRARRQRLELNLGLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVKSVNSNAQKFADDSEGYKPCDPQVIRDRVAHMEFCYQELTQLAAERRGRLEESRRLWKFFWEMAEEEGWIREKEQILSSEDCGKDLTAVVRLLSKHKALEDERSGRAGRLQQTVQQGEELVAAGHFGADKIRQRI-----SDVQEQWASLERLFSARRTRLQDACALHQFQADADDMDAWMLDVLRIVSSADVGHDEFSAQSLVKKHKDVAEEISSYRPVLDALHEQARTL---PEEQARAGEVSGRLAGIEERYKEVAELTRLRKQALQDALALYKMLSEADACELWIVEKEQWLNSMEIPEKLEDLEVIQHRFDSLEPEMNSQASRVAVVNQIARQLIHSGHPSEKEIKGQQDKLNTRWSQFRDLVDRKKEALNSTLGVQNYYLECNETKSWIREKTKVIESTQDLGNDLAGVMALQRKLTGMERDLVAIEDKLGDLGKEADRLSEEHGDKASGIKGRLGEIKDVWEEMKGTLRTREESLGEASKLQQFLRELDDFQAWLSRTQTAVASEDKPNTLAEAEKLLAQHEGIKNEIRNYEEDYQKMRDMGEMVTQGQTDAQHMFLRQRLQALDTGWNELQKMWENRQKLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMADTLEGAEAAIKKQEDFMTTMDANEEKINAVVETGRRLVSDGNIS------AERIQEKVDSIDERRKKNRGAASELLTKLKDNRDLQRFLQDCQELSLWISEKMLTAKDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIQKAGSALVEEKPETEAVVQGKMEMLKKTWEELESTTQTKAQCLFDANKAELFTQSCADLDKWLSGLEGQIHSDD-----FGKDLTSVNILLKKQQMLESQVEVRQKEVEELRSQAQALS-QEGKGSDEVDGRRRGVEVKFQQVQEPLKKRRSNLMASREIHQFNRDVEDEILWVEERMALATSTDHG-NNLQTVQLLIKKNQTLQKEIQGHQPRYDDIFERSVRTLQEESPVSAGIRLRLEDLQRIWKLIQEEVEKRHGRLEEAHRAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSSVAMLKKHQILEQAVEDYAETVHQLSKTSRALVAAGHPESERISMRQSQVDKLYAGLKDLSEERRGKLDERSRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDAVNKMADDLINSGHADAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEVLGRILDKHKKLPDELGRDQNTVETLQRMHTTFEHDIQALGTQVKQLQEDAVRLQSAYAGDKADDIQRREGEVLEAWRSLLEACDGRRVRLLDTSDKFRFFSMVRDLMLWMEDVIRLIDAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKALLARKHYASEEIKEKLLQLTDKRKEMIDKWEDRWEWLRLVLEVHQFSRDAGVAEAWLLGQEPYLSSREMGQNVDEVEKLIKRHEAFEKSAATWEERFSALERLTTME----LLEVRRMQEEEEKKRQPPPEEAPPAEEPSPQQ---REGEQVSQNG----LPTEQDSPREAAGGSDVVNGVAETSPSSSPTGSRKGKASQAATLPTKAQDTPPAQIEGFLNRKHEWEGHNKKASNRSWHNVYCVINNQEMGFYKDSKSASQGI---PYHSEIPISLKDSTCEIALDYKKRKHVFKLKLSDGNEYLFQAKDDEEMNSWIQAIS--CATPSEISSHST-PASGRAHTLPASASVSDSSPGKREKDKEKRFSLF 2354          
BLAST of Spectrin beta chain vs. Ensembl Cavefish
Match: SPTBN1 (spectrin beta, non-erythrocytic 1 [Source:HGNC Symbol;Acc:HGNC:11275])

HSP 1 Score: 1375.15 bits (3558), Expect = 0.000e+0
Identity = 789/2106 (37.46%), Postives = 1265/2106 (60.07%), Query Frame = 2
Query:   65 ENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNN--------YQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEP 6343
            +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL  ++    + DL++DL+DG+ L+KLLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  R++K++LLLWCQMKTAGY NVNI NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI VD P+EKS++TYV +     +++K+ + + KR+G V++ AI  EK+I  YE L+ +LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+ A+  +A +L++ENY+ I  +      ++ +W+ LL+ L+ RR +L+    +Q + QE  Y+MDWM E+ + L S+D+GKHLLGVE+LL+KH ++ +DI     R+ + +   Q     + AID D     + Q++ +        YQEL  L+ +R   L   + +W++  ++  ++ WI+E  Q+  S D G DL    RL+ +   +  +++ R   +   +   +     D     +  I   + E+      L+Q    R+ +L ++   HQ  AD +D DA  L+  R+  + DVG     T+  +K H++   +V     +I  L  +   L  +  +  D       ++  ++++ +L   RK  L +    + +FS  +  E WI+ KE+ L ++   E+L++L VI+HRF+  E +M   + +V+  NQI+R L++  HP  + I  +Q+ LN  W+Q  DL +QKK+ L  A+    + L+  ET+SWI++K K++E T +L +DL G+M LQR+L  ++RD+ AIEAK+  L  EA++L    P     I   +  ++ +WEE+K  L++R+A L  +++LQ+F ++LD F  WL + Q  +A++D+P  L EAE+    H  +K EI  +E +Y ++   G  V+  + D QY+   +RL  L+  WN L KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +E+P   E  +A  ++ E F  ++ +N+ KI++VV  G  L +  N  +D+I+ +   I  R    ++        L+D+  L +F  D   L  W +EKM+ A D SY + +++ +++ + + F  EL++N+E +D++ ++G +L+ EKP  E+ ++ K+  L+ QW EL +T   K++ L +AN+  +F ++   +  W+  +  QI + +     YG  L  +N  +K Q+  + Q++ +++ + +++  A  L+++  +  DE +  ++ V+ K  E+  PL  R+N L+  + + QF RDVEDE  W+ E++   T        LQ     I++ +T   EI  H  R  D+    + +++ D PS +     L +L  LWD +I   E   +  EE  + Q+Y  +A E E WMSE+E  +M E+KAKDE  ++  ++KH+ L   + +Y   V +L+     ++  + P S  +  +Q +VDK+YA L ++  E++ K+++  + + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   + M D+LI  GH ++  +A WKD +NEAWADLLELI+TR Q+L A+Y+  KF  D+ E+L  I +K +++PE +G+D  +V T QR H  F  +I+ L   +      A +L   Y G+K  +I  R+ E+   W +L +  E R   L+D  D ++F++MVR+L+ WM ++   I A +K RDV  VEL+++NH+ +KAEID+R+++ + CI LG++L+ RKH  + +++ K  ++  K   +++ W +R E+L +ILEV+QF+R+A VAEAWL+ QE  L++ + G ++++   L+++H   E++ A   +RF  L++LT+ E                  E R +    E    PPTPEP
Sbjct:   30 DNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--ARVSCRITDLYMDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKRSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSVITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAVVSVARELEAENYHDIKRITARKDNVLRLWEYLLELLKARRQRLEMNLGLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIGIQADRVRNVNSNAQ-----KFAIDDDGYKPCDPQVIRDRVAHLEFCYQELTQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSDDVGKDLTGAVRLLSQHRALEDEMSGRGGHLQHTVREGL--AMADAGHFGETRIRERVAEVQAQWAALEQLAAVRKARLEEACGLHQFQADADDVDAWTLDALRIVSSGDVGHDEFSTQALVKTHKDAAAEVASYRPVIDALHEQSRALPPELAESADVSGRLAGIEERYKEVAELTRLRKQALQDALALYKMFSEADACEVWIVEKEQWLNSMEIPEKLEDLEVIQHRFESLEPEMNNQASRVAVVNQIARQLMHSGHPSEKDIKAQQDKLNTRWSQFRDLVDQKKESLNSALGVQNYHLDCNETKSWIREKTKVIESTQELGNDLTGVMALQRKLTGMERDLAAIEAKLGDLKGEAERLAGEHPEQAKAITGRLAEIDSVWEEMKDTLRNREASLGEASKLQQFLRELDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHEGIKNEIHNYEEDYQKMRDMGEMVTQGQTDAQYMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMPTTLEGAEAAIKKQEDFMTTMDANEEKINSVVEAGRRLASDGNINTDRIQERAASIDERHKKNREAAVELLMRLKDNRDLQKFLQDCQELSLWTNEKMLTAQDMSYDEARNLHSKWLKHQAFMAELQSNKEWLDKIEKEGMQLVAEKPETEAIVKEKLSALQKQWQELESTTQTKAQCLFDANKAELFTQSCADLDKWLGGLEGQIQSDD-----YGKDLTSVNILLKKQQMLENQVEVRKREVEELQSQAHVLRQEGKD-TDEVDGRREVVEKKFQEMLDPLMKRKNFLMASREIHQFNRDVEDEILWVEERMPIATSTDHG-HNLQTVQLLIKKNQTLQKEIQGHQPRCDDIFERSQSILKEDSPSVEAIKARLSDLQTLWDLIIQETEKRHERLEEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSSVTMLKKHQILEQAVEDYAETVHQLSKTSRGLVAANHPESERIGMRQSQVDKLYAGLKDLSEERRGKLDERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDSVNRMADELINAGHTDAATVAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEILSRILDKHKMLPEELGRDQNTVETLQRMHTTFEHDIQALGTQVRQLQEDAVRLQSAYAGDKADDIQRRETEVLDAWRNLLEACEGRRARLLDTGDKFRFFSMVRDLMLWMEDVIRLIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTACIELGKSLLARKHYASEEIKDKLLQLTDKRKEMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYLSSREMGQSVDDVEKLIKRHEAFEKSAATWEERFSALERLTTME----------------LLEVRRQQEEEERRRKPPTPEP 2103          
BLAST of Spectrin beta chain vs. Ensembl Cavefish
Match: sptbn2 (spectrin beta chain, non-erythrocytic 1-like [Source:NCBI gene;Acc:103032213])

HSP 1 Score: 1347.03 bits (3485), Expect = 0.000e+0
Identity = 821/2351 (34.92%), Postives = 1338/2351 (56.91%), Query Frame = 2
Query:   65 ENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDD---TSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSI--VHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKV--KLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEV-VGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENP---KLIETKS--------------TTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINE----------IGGVDTSLAKYSTLPNI--KSDFEMPVTEASSE------KKKFPTLGRKQ 6973
            +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL   +    + DL+ DL+DG+ L++LLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVN+ NFT+SW+DGLAFNA++HKHR +++++ TL ++N   NL  AF  AE+E G+ +LLD  D+ VDQP+EKSI+TYV +     +++K+   + KR+G V++ AI A++LI  YE L+ ELL+WI+  I  + + +L  SL  V+ QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLE L   F+RKA MR+ WL EN  LV Q  FG DL  + AA +KHEA+E DI A+ ER+ A+  +A +L++E Y+++  +      ++ +W+ L + L  RR++L   RD+Q +L+E  Y+MDWM ++  RLQS+D GKHL  VE+LL+KH ++ +DI     R+      +++  T +      +   V+ K   L   Y EL  L+ +R  +L   + +W+++ ++  +  WI+E  Q+  S DSG DL S   L+ K E    ++  R   + + + S   + +  +  +P   E+  R I +I     +L++A + R   L +S   HQ   D  D +A ILE  R   + +VG     T+   ++  E   +++    LI  L  +   L     Q  + +     ++  +E+L  L++ R+  L      + +FS     + WI  KE+ L  +    +L++L V++ RF+  E +M     ++++ NQ+S  L+   +   E I++ Q+ LN  W++   +A+++K+ L+ A++   + LE  E QSW+++K K++E T  L +DL G+M LQR+L  ++RD++AI+ K+  L  EA+KL    P     I + +  + E+WEEL+  ++ R+  L  +++LQ F +DLD F  WL + Q  VA++D P  L EAER    H  +K E+  +  +Y ++   G +V+  + D QY+   +RL  L+  W+ L +MW+ +   L ++ D QTF+RD+ Q +G L  QE  LS +E+PN+ +      ++ E F  ++ +++ KI+ VV  G  L++  NA +DKI+ K + I  R    +   +   + L+D+  L  F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N++ +D++ ++G  L+ EKP  E  +   +  L+ QW EL NT   K++ L +ANR  +F ++  ++ SW+     Q I++    +++G  L  +N  +K  +  + Q++ + K +  ++  A  L +   E     E+  Q+ +V    T+++ PL  RR  LL  K   QF RD+EDE  W++E++   T      +   V L  I++ +T   EI  H  RI D+   G  M   D       +  L EL + W   I+  +       E    Q++ ++A E E WM E+E  +M E+KAKDE  AL  ++KH+ L   + +Y   + +LA+    ++N + P S  +  +Q +VDK+YA L ++  E++ ++++ ++   L R +  LE+WIAER  VA S+E+G + EH  +LR++F EFA  T+ +G  RV   +   D+LI  GH E+  +A WKD +NEAWADLLEL++TR Q+L A+Y+  +F  D+ E L  + EK   +    +G+D  +V    R+H A+  ++  L   ++     A +L   Y GEK ++I   +  + + W  L    ++R   L+D  + ++F+ MVR+L+ WM  I +QI + D  RDV    L+I+NH+ +KAEI++R  + + C  +G +L+N  H  ++++R+K +++  K   I + W+++ + L+++LEV QF R+A+VAE+WL  QE  +   + G  ++E  +L+++H   E+  A   DRF  L+KLT+ EE +     E++    +         + +            + E+  + S D     QS SV    +  D+++  P++  + +S   P     ++T S              +TE   G L RKHE E+  KKA NR W  +Y V+    +  YK+ K   +      Y  E PI L  A    A +YKKR NVF++R+ +G E+LF+A D+AEM+ W+  I+             G    L++  T+P I   S     VT  + E      +K+F   G+K+
Sbjct:   34 DNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--GRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRSDLIEFDTLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIEKYETLASELLQWIEQTIVTLNDRQLANSLSAVQNQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGFDLGAVEAATRKHEAIETDIGAYGERVAAVESVARELEAEAYHEVRRILARKDNVLRLWEYLKELLTARRERLTTHRDLQRLLEEMRYIMDWMGDMKGRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVRGVQAAAKRFTTDEMPYKPCEPALVEEKVSLLGKTYDELGHLAGERRVKLEDSRRLWQFLWELGEEAAWIREQEQILSSGDSGRDLSSALHLLSKHEAFRDEMAARYGPLSNSIASGEQLVQEGHFGAP---EVTER-IKDIRAQWSHLEEASKLREQLLKESVALHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEIQSHRSLIDSLHEQAETLPAAYAQSPEVEGRLPAIEQRYEELETLSSARRQALEGALALYRMFSEAGACQLWIGEKEQWLHNMEIPSKLEDLEVVQQRFETLEPEMNNLGSRITDVNQVSEQLLKSDNRNKEQINQTQDQLNNRWSEFKRVADERKQALESALNIQNYHLECNEIQSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLGGLRSEAEKLASEHPEQAGEIRARLEEIQEVWEELRSTMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTAVASEDTPTSLAEAERLLAQHEAIKNEVDNYREDYEKMRATGAEVTQGQTDAQYMFLAQRLQALDTGWHELRRMWESRHCLLAQAFDFQTFLRDAKQAEGFLNSQEYVLSHTEMPNSLQGAVEAIKKHEDFLTTMEASEEKINGVVESGRRLVSDGNANADKIQEKADSIQERHQKNKQTANDLLTKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQALVVEKPELEETVSETLQGLQKQWEELENTTQTKAQCLFDANRAELFTQSCSALDSWL-----QNISSLLQSDDFGKDLTSVNILLKKHQMLEHQMEVREKEVQSLQSQALALAQ---EDAGVMEVDGQQRRVADSFTQLQEPLNQRRQQLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQL-LIKKNQTLQKEIQGHQPRIDDIQAHGRSM---DGERRADLDGRLSELGEEWSRFISETDKRHSRLAEANRAQQFYTDAAEAEAWMGEQELHMMSEEKAKDEQSALVMVKKHQILEQALEDYAQTIHQLANSSRLMVNSEHPESERITLRQAQVDKLYAGLKDLAEERRGRLQERLRLTQLKREVDDLEQWIAEREVVAGSHELGQDYEHVTMLRDKFREFARDTSAIGQERVDAVNAQADELIESGHPENASVAEWKDGLNEAWADLLELMDTRTQMLAASYELHRFHQDAREALGRVKEKKEALAGAELGRDLNTVQHLHRQHTAYEHDVHALSGQVTQVQDDAARLQKAYAGEKAEDIHRHERAVTEAWEGLLAATQSRRLLLLDTVEKFRFFNMVRDLMLWMDGINLQIQSHDSPRDVSSAGLVIANHQDIKAEIETRAGSFTACTDMGNSLLNNNHYASDEIREKLEQLKAKRDEIKQKWQDKMDHLQIVLEVLQFGRDASVAESWLAGQEPLVRAAELGSNVDEVESLIKRHEAFEKLAAGWEDRFVLLEKLTTLEEHEIQRLKEEEERARRPPTPPPAEEVVQSEA---------EHESAARTSLDQTTLNQSVSVNGVHSDQDTSQYRPEKGSESESVNGPGRDSGLDTASRHDPSATLPGRVDPSTEAMEGMLCRKHEMESHAKKAANRSWQNVYCVLRKGSLGFYKDNKSASNGI---PYHGEVPISLNEATCEVAHDYKKRKNVFKLRLGDGKEFLFQAKDEAEMSSWIRSIHSSMPSSGPGDRSPGGQRGLSRAMTMPPISPSSGEAGGVTMRNKEGKEKDREKRFSFFGKKK 2354          
BLAST of Spectrin beta chain vs. Ensembl Cavefish
Match: sptbn2 (spectrin beta chain, non-erythrocytic 1-like [Source:NCBI gene;Acc:103032213])

HSP 1 Score: 1345.49 bits (3481), Expect = 0.000e+0
Identity = 819/2346 (34.91%), Postives = 1332/2346 (56.78%), Query Frame = 2
Query:   65 ENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDD---TSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSI--VHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKV--KLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEV-VGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVK---------EKSKENPKLI---ETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINE----------IGGVDTSLAKYSTLPNI--KSDFEMPVTEASSE------KKKFPTLGRKQ 6973
            +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL   +    + DL+ DL+DG+ L++LLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVN+ NFT+SW+DGLAFNA++HKHR +++++ TL ++N   NL  AF  AE+E G+ +LLD  D+ VDQP+EKSI+TYV +     +++K+   + KR+G V++ AI A++LI  YE L+ ELL+WI+  I  + + +L  SL  V+ QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLE L   F+RKA MR+ WL EN  LV Q  FG DL  + AA +KHEA+E DI A+ ER+ A+  +A +L++E Y+++  +      ++ +W+ L + L  RR++L   RD+Q +L+E  Y+MDWM ++  RLQS+D GKHL  VE+LL+KH ++ +DI     R+      +++  T +      +   V+ K   L   Y EL  L+ +R  +L   + +W+++ ++  +  WI+E  Q+  S DSG DL S   L+ K E    ++  R   + + + S   + +  +  +P   E+  R I +I     +L++A + R   L +S   HQ   D  D +A ILE  R   + +VG     T+   ++  E   +++    LI  L  +   L     Q  + +     ++  +E+L  L++ R+  L      + +FS     + WI  KE+ L  +    +L++L V++ RF+  E +M     ++++ NQ+S  L+   +   E I++ Q+ LN  W++   +A+++K+ L+ A++   + LE  E QSW+++K K++E T  L +DL G+M LQR+L  ++RD++AI+ K+  L  EA+KL    P     I + +  + E+WEEL+  ++ R+  L  +++LQ F +DLD F  WL + Q  VA++D P  L EAER    H  +K E+  +  +Y ++   G +V+  + D QY+   +RL  L+  W+ L +MW+ +   L ++ D QTF+RD+ Q +G L  QE  LS +E+PN+ +      ++ E F  ++ +++ KI+ VV  G  L++  NA +DKI+ K + I  R    +   +   + L+D+  L  F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N++ +D++ ++G  L+ EKP  E  +   +  L+ QW EL NT   K++ L +ANR  +F ++  ++ SW+     Q I++    +++G  L  +N  +K  +  + Q++ + K +  ++  A  L +   E     E+  Q+ +V    T+++ PL  RR  LL  K   QF RD+EDE  W++E++   T      +   V L  I++ +T   EI  H  RI D+   G  M   D       +  L EL + W   I+  +       E    Q++ ++A E E WM E+E  +M E+KAKDE  AL  ++KH+ L   + +Y   + +LA+    ++N + P S  +  +Q +VDK+YA L ++  E++ ++++ ++   L R +  LE+WIAER  VA S+E+G + EH  +LR++F EFA  T+ +G  RV   +   D+LI  GH E+  +A WKD +NEAWADLLEL++TR Q+L A+Y+  +F  D+ E L  + EK   +    +G+D  +V    R+H A+  ++  L   ++     A +L   Y GEK ++I   +  + + W  L    ++R   L+D  + ++F+ MVR+L+ WM  I +QI + D  RDV    L+I+NH+ +KAEI++R  + + C  +G +L+N  H  ++++R+K +++  K   I + W+++ + L+++LEV QF R+A+VAE+WL  QE  +   + G  ++E  +L+++H   E+  A   DRF  L+KLT+ EE +     E++    +         + +              E+  + S D     QS SV    +  D+++    + V            S+ +P          +TE   G L RKHE E+  KKA NR W  +Y V+    +  YK+ K   +      Y  E PI L  A    A +YKKR NVF++R+ +G E+LF+A D+AEM+ W+  I+             G    L++  T+P I   S     VT  + E      +K+F   G+K+
Sbjct:   34 DNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--GRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAIVHKHRSDLIEFDTLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIEKYETLASELLQWIEQTIVTLNDRQLANSLSAVQNQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGFDLGAVEAATRKHEAIETDIGAYGERVAAVESVARELEAEAYHEVRRILARKDNVLRLWEYLKELLTARRERLTTHRDLQRLLEEMRYIMDWMGDMKGRLQSQDSGKHLHDVEDLLQKHTLVEADISAQAERVRGVQAAAKRFTTDEMPYKPCEPALVEEKVSLLGKTYDELGHLAGERRVKLEDSRRLWQFLWELGEEAAWIREQEQILSSGDSGRDLSSALHLLSKHEAFRDEMAARYGPLSNSIASGEQLVQEGHFGAP---EVTER-IKDIRAQWSHLEEASKLREQLLKESVALHQFQTDANDMEAWILETLRQVSSQEVGHDEFSTQTLARKQREVEEEIQSHRSLIDSLHEQAETLPAAYAQSPEVEGRLPAIEQRYEELETLSSARRQALEGALALYRMFSEAGACQLWIGEKEQWLHNMEIPSKLEDLEVVQQRFETLEPEMNNLGSRITDVNQVSEQLLKSDNRNKEQINQTQDQLNNRWSEFKRVADERKQALESALNIQNYHLECNEIQSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLGGLRSEAEKLASEHPEQAGEIRARLEEIQEVWEELRSTMKRREESLGEASKLQGFLRDLDDFQAWLSRTQTAVASEDTPTSLAEAERLLAQHEAIKNEVDNYREDYEKMRATGAEVTQGQTDAQYMFLAQRLQALDTGWHELRRMWESRHCLLAQAFDFQTFLRDAKQAEGFLNSQEYVLSHTEMPNSLQGAVEAIKKHEDFLTTMEASEEKINGVVESGRRLVSDGNANADKIQEKADSIQERHQKNKQTANDLLTKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQALVVEKPELEETVSETLQGLQKQWEELENTTQTKAQCLFDANRAELFTQSCSALDSWL-----QNISSLLQSDDFGKDLTSVNILLKKHQMLEHQMEVREKEVQSLQSQALALAQ---EDAGVMEVDGQQRRVADSFTQLQEPLNQRRQQLLASKEAHQFNRDLEDEILWVKERMPLATSTDHGKDLPSVQL-LIKKNQTLQKEIQGHQPRIDDIQAHGRSM---DGERRADLDGRLSELGEEWSRFISETDKRHSRLAEANRAQQFYTDAAEAEAWMGEQELHMMSEEKAKDEQSALVMVKKHQILEQALEDYAQTIHQLANSSRLMVNSEHPESERITLRQAQVDKLYAGLKDLAEERRGRLQERLRLTQLKREVDDLEQWIAEREVVAGSHELGQDYEHVTMLRDKFREFARDTSAIGQERVDAVNAQADELIESGHPENASVAEWKDGLNEAWADLLELMDTRTQMLAASYELHRFHQDAREALGRVKEKKEALAGAELGRDLNTVQHLHRQHTAYEHDVHALSGQVTQVQDDAARLQKAYAGEKAEDIHRHERAVTEAWEGLLAATQSRRLLLLDTVEKFRFFNMVRDLMLWMDGINLQIQSHDSPRDVSSAGLVIANHQDIKAEIETRAGSFTACTDMGNSLLNNNHYASDEIREKLEQLKAKRDEIKQKWQDKMDHLQIVLEVLQFGRDASVAESWLAGQEPLVRAAELGSNVDEVESLIKRHEAFEKLAAGWEDRFVLLEKLTTLEEHEIQRLKEEEERARRPPTPPPAEEVVQSEAEH---------ESAARTSLDQTTLNQSVSVNGVHSDQDTSQGSESESVNGPGRDSGLDTASRHDPSATLPGRVDPSTEAMEGMLCRKHEMESHAKKAANRSWQNVYCVLRKGSLGFYKDNKSASNGI---PYHGEVPISLNEATCEVAHDYKKRKNVFKLRLGDGKEFLFQAKDEAEMSSWIRSIHSSMPSSGPGDRSPGGQRGLSRAMTMPPISPSSGEAGGVTMRNKEGKEKDREKRFSFFGKKK 2349          
BLAST of Spectrin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008111.1 (pep scaffold:Pmarinus_7.0:GL478136:8967:48859:1 gene:ENSPMAG00000007298.1 transcript:ENSPMAT00000008111.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1376.3 bits (3561), Expect = 0.000e+0
Identity = 834/2319 (35.96%), Postives = 1357/2319 (58.52%), Query Frame = 2
Query:    8 ILYEMENKENQFMQTKDVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGR---IDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDV---------TVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETI--KQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKT----------------------GTLTRKHEWENSTKKAGN--RKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKI 6841
            I  + E+  N++  +++  +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL  ++    + DL+ DL+DG+ L+KLLE+LSGEK+P  T+GK+RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  LILGLIWTIILRFQIQD +++ +D K  R++K++LLLWCQMKTAGY NVNI NFT+SW+DGLAFNA++HKHRP+++++  L K+N   NL  AF  AE++ G+ +LLD  DI VDQP+EKSI+TYV +     +++K+   + KR+G V+  AI  +++I+ YE L+ ELLEWI+  I  + N K   SL GV++QL  FS YR  EKP KF ++G LE+  F IQSK+RA+N+K+Y P EGKL++ IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA +R+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+ A+  +A +L++E+Y+++  V      ++ +W+ L + L  RR +L+    +Q + QE  +++DWM E+ +RL S+D+GKHLLGVE+LL+KH ++ +DI     R   ++  +++  + D      D   V  +   L   Y EL  L+ +R  +L   + +W +  ++   + W++E   L  S D G DL  V RL+ +   +  ++         TVR+    +++    H  ++D        I   + E++ L  +L+     R+ +L  +   +Q  AD +D +  + +  R+  + ++G     T+   K+H++   ++     ++  L  +   L  +        +  E ++  + +LV+L+  RK  L +    + ++S  E  E WI  K + L  +   E+L++L VI+HRF+ FE +M   + +++  NQ++R L++  HP  + I  KQ+ LN  W+   +L +QKK+ L  A+    F LE  ET++WI++K K++E T +L +DL G+M LQR+L  ++RD+ AI+ K+  L  EA++L    P  E  I   +  +N++W+ LK  LQ+R+  L  +++LQ+F +DLD F  WL K Q  +A++D+P  L EAE+    H  +K EI  ++ +Y R+   G  V+  + DPQY+  ++RL  L+  WN L KMW+++   L +S   Q F++D+ Q DG L+ QE  L   E+P   E+ +   +  E    ++ +N  KI   +  G  LL   N  +DKI+ K + I  R    +   +   + L+D+  L  F  D   L  W++EKM+ A D SY + +++ T++ + + F  EL +N+E ++++ E+G +L+ EKP  E  ++ K+ EL   W EL NT   K+++L +ANR  +F ++   +  WV +I SQI + +       L  +N  +K Q+  + Q++ ++K + +++  A  L ++   R DE +  +  V+ +  ++ APL  RR+ LL  K V Q++RD+EDE  W+ E++      +     LQ     I++ +    EI  H  RI D+   GE++I       +  +  L++L  LW  +I   +D     EE+ + Q+Y  +  E E WMSE+E  ++ ++KAKDE  A+  ++KH+ L   + NY  ++ +L++   +++    P S  +  +Q + DK+YA L ++  E++ ++E+  + + L R +  LE+WIAER  VA S+E+G + EH  +L ERF+EFA  T  +G  RV   + + D LI  GH +S  +A WKD +NEAWADLLELI+TR Q+L A+Y+  +F  D+ E+L  I+EK   +PE +G+D  +V + QRKH  F  +I+ L   +      A++L   Y GEK ++I  R+ E+   W  L    E R   L D  + ++F+++VR+L+ WM     QINA +K RDV  VEL+++NH+ +KAEID+R++N +  I LG++L+ R+H   +++++K  ++  K   ++  W ER  +L++ILEV+QFAR+A VAEAWL+AQE  + T + G++++E   LL++H   E++++   +RF  L+K T+ E     L   +K+++ +D E++ +    E +        + + + I  ++++++ I   Q    Q +  +D S     + E     K  P+   +    +P+T                      G L RKHEWE+  KKA +  R W+ LY V+ N +   YK+ K         TY +E P++L  A+   A++YKK+ +V R+++ +G +YL +A D  EM  W+  I
Sbjct:   15 IQQQYESINNRWEASEEDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--ARVSCRITDLYTDLRDGRMLIKLLEVLSGEKLPKPTRGKMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDISVETEDNKERRSAKDALLLWCQMKTAGYQNVNIHNFTTSWRDGLAFNAIVHKHRPDLIEFDKLKKSNAHHNLQNAFNIAEQKLGLTKLLDPEDISVDQPDEKSIITYVVTYYHYFSKMKALAVEGKRIGKVLESAIETDQMIDKYETLASELLEWIEQTIIILNNRKFANSLTGVQQQLQAFSTYRTVEKPNKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLVNEINKAWERLEKAEHERELALRNELIRQEKLEQLARRFDRKAALRETWLSENQRLVTQDNFGVDLPAVEAATKKHEAIEADIAAYEERVQAVVDVARELEAEDYHEVRRVCSRRDNVLRLWEYLQELLAARRHRLEANLALQRVFQEMLHIVDWMDEMKVRLLSQDYGKHLLGVEDLLQKHALVEADITVQADRVKAVNAAAQRFSSEDDAYKPCDSHVVSERATHLEERYAELCSLAAERRSKLEESRKLWRFFWEMAELEGWVREKEPLLSSGDVGKDLTGVLRLLGQHRAVEDELNGRSADLKQTVREG---EEMADAGHFGADD--------IRARVAEMHVLWASLEDLAAQRKRRLQVAESLYQFQADADDIEVWMEDTLRIVSSDEMGHDEFSTQSLNKKHKDVTEEISSYRPVLDALHEQAQGLPDEVTVSAGVPDRLEALEQRYRELVELSRVRKQRLQDALALYKMYSEAEACELWIDEKSQWLNAMDVPEKLEDLEVIQHRFEGFEPEMNSQASRIAVVNQLARQLMHAGHPSEQDIKAKQDHLNSVWSDFRELVDQKKEALSSALSIQNFHLECNETKAWIREKTKVIESTQELGNDLAGVMALQRKLSGMERDLAAIQTKLADLQGEAERLASMHPEQEDAILGRLAEINQVWDNLKETLQNREESLGEASKLQQFLRDLDDFQTWLSKAQTAIASEDMPNTLPEAEKLLAQHEAIKNEIDNYQDDYQRMRDMGEVVTRDQSDPQYMFLHQRLQALDTGWNELNKMWENRHSLLSQSHGFQAFLKDARQADGFLSNQEYVLGHVEMPATLESAEEAIKNHEDVMTTMDTNDEKIVGALETGRRLLTEDNTYADKIQEKVDSIDERHKKNRMTAEDVLARLKDNRDLQRFLQDCQELTLWINEKMLTAQDMSYDEARNLHTKWQKHQAFMAELASNKEWLEKIDEEGQQLMVEKPETEPMVKEKLSELHELWDELENTTQLKAQRLFDANRAELFTQSCADLDKWVNQIESQISSDDHGN---DLTSVNILIKKQQMLENQMEVRKKEVEELQSQATVLCQEGKGR-DEVDSQRLTVENRFEQVLAPLQQRRDKLLASKEVHQYIRDLEDEILWVEERMPLAAS-RDHGNNLQTVQLLIKKNQNLQKEIQGHEPRIEDIRERGEDLIARGSVDPEAIHERLEDLRALWATMIVEAKDRHIRLEESLKAQQYYFDVAEAEAWMSEQELYMIADEKAKDEQSAVAMLKKHQILEQSVENYSDVIHQLSETSRNLVTSRHPESERIGLRQSQADKLYAGLKDLAEERRGRLEERHKLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLSERFAEFARDTATIGQERVDSVNRIADALIEAGHSDSASVADWKDGLNEAWADLLELIDTRTQMLAASYELHRFNHDAREVLSRINEKQMQLPEELGRDQNTVESLQRKHTTFENDIQALGVQVKVLQEDAERLRGSYAGEKVEDIERREEEVVTAWKGLLDACEARKLRLADTGEKFRFFSLVRDLMLWMENTIRQINAQEKPRDVSSVELLMNNHQGIKAEIDTRNDNFTTVIELGKSLLARQHYATDEIKEKLGQLTDKRKEMVSKWEERAHWLKLILEVHQFARDAGVAEAWLLAQEPHITTQEVGESVDEVEQLLKRHEAFEKSVSTWDERFNVLEKHTTLE-----LLELRKQQEKEDEERKQQKLQAELDEKKREEHHIAEQQRIQSQEVTQNGISSDQESPRQGSNMLDPSVNGNGENEADGARKLTPEPSPSSDRRKPQTLHSQSVSTLPGKAEEASAFRKEGFLLRKHEWESHNKKASSSVRSWHTLYCVLHNQEFGFYKDSKNMNTG---NTYHNEIPVNLANAVCDVASDYKKKKHVLRLKLPDGNDYLLQAKDDEEMANWIHSI 2307          
BLAST of Spectrin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001834.1 (pep scaffold:Pmarinus_7.0:GL482425:158920:175005:1 gene:ENSPMAG00000001663.1 transcript:ENSPMAT00000001834.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 756.133 bits (1951), Expect = 0.000e+0
Identity = 447/1165 (38.37%), Postives = 677/1165 (58.11%), Query Frame = 2
Query:  281 PPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDAR-DIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTS----RKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLI---RKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLF-ENSDVGDKLSLTEYYLKQHEEQMLQVEELEKL-ITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSR 3736
            P  T+GK+RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  LILGLIWTIILRFQIQD ++  +D K  R++K++LLLWCQMKTAGY NVN+ NFT+SW+DGLAFNA++HKHRP++VD+  L K+N   NL  AF  AE+  GV +LLD   D+ VDQP+EKSI+TYV S     +++K+   + KR+G V++ AI A++++  YE L+ ELLEWI   I  + +     SL GV++QL  FS+YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y P EGKL++ INRAW+ LEK+EH  EL L +ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E D+ A+E R+ A+  +A +L++E Y+++  V      ++++W++L + L  RR +L+    +Q    E  Y   WM E+ +RL S++ GKHLLGVE+LL+KH ++ +D+     R+   +    R  +  D  R   D +    +  QL  +Y EL  L   R   L   + +  ++ +    + W++++  L  S D+GHDL +V RL+   R FE  LS    +    +   +    +   D    R         E+++L  +L+ A   R  +L  S   HQLL+D  D +A   +   L     DVG+    T+   ++H +    VEE+E   I  L  +   L     +     E   R++  + +L  LA  R   L +    + + S       W+  K + L  L   E+L++L V++HRF+  E +M   + +V+  NQ++R L+  +H   + I  KQ++LN  W++  +LAE KK+ LQ  +    F LE  ETQ+WI++K +L+E T  L +DL G+M LQR+L  ++RD+ AIE KV  L  EA++L    P     +  ++    ++W  L+  L+ R+  L  +++LQKF +D+D F  WL K Q  VA++D+P  L EAE+    H  +K EI  +  ++ R+ + G +V+  + DPQ++   +RL  L   W  L  MW ++   L        F RD+ Q DG+L+ QE  LS+ E+P   ++ +A  ++ E    S+ +N  K+ +V++ G  L+   N  +DKI+ K + I  R
Sbjct:    1 PKPTRGKMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDISVQTEDSKETRSAKDALLLWCQMKTAGYPNVNVHNFTTSWRDGLAFNAVIHKHRPDLVDFEKLKKSNAQHNLQHAFNAAEQHLGVTKLLDPEADVSVDQPDEKSIITYVVSFYHYFSKMKALAVEGKRIGKVLDSAIEADRMVERYESLASELLEWIGRTITALNSRDFPNSLVGVQQQLHAFSSYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLVAEINRAWERLEKAEHGRELALRDELIRQEKLEQLARRFDRKAAMRETWLAENQRLVMQDNFGADLAAVEAATKKHEAIETDMAAYEGRVRAVEGVARELEAERYHEVARVVRRRDGVLQLWRRLQELLAARRTRLEMTLALQRAFHEMLYTGAWMDEMKLRLLSQECGKHLLGVEDLLQKHALVEADVAAQADRVKAVNAAALRFAEEVDGYR-PCDPEVASERAGQLEASYAELCALCAARRARLEEARALHLFLWEAEEVEAWVRQVEPLLASEDAGHDLAAVLRLLARHRAFEDELSGRRAQLQQTLRLGEEEKREAERDAQAARARSA-----ELDKLWASLELAASRRAERLRASEALHQLLSDSADVEAWARDASLLVAAGGDVGNDEFSTQALARKHRD---VVEEIEGYRIDSLQEQAAALPASLAEPAGVRERLRRLEEAYGELAALAAERGRRLQDALALYTIHSETAACLLWLDEKSQWLDALDIPEKLEDLEVVQHRFESLEPEMNGLASRVAVVNQLARQLLGSEHASEDDIKAKQDLLNARWSEFRELAESKKEALQAQLTLQSFQLECHETQAWIREKTRLIESTQGLGNDLAGVMALQRKLSGMERDLAAIEVKVGDLQGEAERLAQHHPERAGAVRGQLADTADVWGALRGTLRAREDSLGEASKLQKFLQDVDDFQAWLSKTQKAVASEDVPSTLPEAEKLLAQHEAIKNEISNYSEDHRRMREMGEEVTRDQSDPQHVFLRQRLQALHTGWAELHSMWDNRRALLAACHAYLAFARDARQADGVLSNQEYALSRVEMPATLQSAEAAIKKHEELTTSMEANDEKVGSVLDTGRKLVGEGNFNADKIQEKMDSISER 1156          

HSP 2 Score: 125.946 bits (315), Expect = 6.227e-29
Identity = 133/611 (21.77%), Postives = 266/611 (43.54%), Query Frame = 2
Query: 4364 EVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLM---REDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLI--PEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLI-NRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNL 6178
            +++    E+ A    RR  L + + +  FL + E+ + W+R+ +E +   + A   L   L+ + R +    E+     ++      GEE  R     +        EL+KLW  L  A     +    +  + + LS++ + E W   R+  L+     D   DE       RKH +++  I  Y   +  L ++    L   L     V ++  R+++ Y +L  +  E+  +++D +  Y ++        W+ E+SQ   + +I  +LE   +++ RF     + N + S RV   +++  +L+   H    +I   +D +N  W++  EL E++ + L+A      F  +  E    I EK RLI   + +G D   V   QRK +    ++  +E  + +  G A++ L  +  E+   +  +  +   +W +L+     R +SL +AS L KF   V +   W+ + +  + ++D    +   E +++ H ++K EI +  E+      +G  +  ++  P+   +R++ + +      +   W  R+  L        FAR+A  A+  L  QE  L+  +   TL      ++KH +L  ++
Sbjct:  516 QLEASYAELCALCAARRARLEEARALHLFLWEAEEVEAWVRQ-VEPLLASEDAGHDLAAVLRLLARHRAFEDELSGRRAQLQQTLRLGEEEKREAERDAQAARARSAELDKLWASLELAASRRAERLRASEALHQLLSDSADVEAWA--RDASLLVAAGGDVGNDEFSTQALARKHRDVVEEIEGYR--IDSLQEQAA-ALPASLAEPAGVRERLRRLEEAYGELAALAAERGRRLQDALALYTIHSETAACLLWLDEKSQWLDALDIPEKLEDLEVVQHRFESLEPEMNGLAS-RVAVVNQLARQLLGSEHASEDDIKAKQDLLNARWSEFRELAESKKEALQAQLTLQSFQLECHETQAWIREKTRLIESTQGLGNDLAGVMALQRKLSGMERDLAAIEVKVGDLQGEAER-LAQHHPERAGAVRGQLADTADVWGALRGTLRAREDSLGEASKLQKFLQDVDDFQAWLSKTQKAVASEDVPSTLPEAEKLLAQHEAIKNEISNYSEDHRRMREMGEEVTRDQSDPQHVFLRQRLQALHTGWAELHSMWDNRRALLAACHAYLAFARDARQADGVLSNQEYALSRVEMPATLQSAEAAIKKHEELTTSM 1118          

HSP 3 Score: 119.013 bits (297), Expect = 7.724e-27
Identity = 168/809 (20.77%), Postives = 333/809 (41.16%), Query Frame = 2
Query: 2555 ETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPEL-EIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEA----DKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSH-SKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFL--SKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRY-------NRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKF--------NIALDELNKLWDD---LITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVI 4903
            ETW+   ++L++      +L  +     + +  E DM  + G+V     ++R+L  E++ E+  ++  +  +L L W +L +L   ++  L++ +   +   E   T +W+ D+MKL   + +    L G+  L ++   ++ DV A   +VK +N  A    +++   +P D          +   + EL  +   R ARL  +  L  F  + +  + W+++V+  +A++D   DL    R    H   ++E+     +  + L+ G +    ++ D Q      R   L+  W +LE     +   L  S+     + DS  ++    +  S L  +  ++ N+  +T+A  R+       +   +  ID++     +L AS A    +R +  ++      +      R   LQD L L     +  A   W+ EK      + + D  DI  +        +RF+  E E+      V  V +   +L+  +   E +I+ K   L  +WSE    A  K + L+       F        +W+ E +  I +T+ +  +  L  +    +     ++ L      + D++  AE+L + +PER         +       +   L  R + L +  ++Q+FL+DV+D + W+ +  + +    + P TL    + + + +    EI N++     +   GEE+ R+       F        +    EL+ +WD+   L+ AC     F  + R+    L          S +E+ L R +       A  A++KHEEL + +
Sbjct:  336 ETWLAENQRLVMQDNFGADLAAVEAATKKHEAIETDMAAYEGRVRAVEGVARELEAERYHEVARVVRRRDGVLQL-WRRLQELLAARRTRLEMTLALQRAFHEMLYTGAWM-DEMKLRLLSQECGKHLLGVEDLLQKHALVEADVAAQADRVKAVNAAALRFAEEVDGYRPCDPEVASERAGQLEASYAELCALCAARRARLEEARALHLFLWEAEEVEAWVRQVEPLLASEDAGHDLAAVLRLLARHRAFEDELSGRRAQLQQTLRLGEEEKREAERDAQAA--RARSAELDKLWASLELAASRRAERLRASEALHQLLSDSADVEA-WARDASLLVAAGGDVGNDEFSTQALARKHRDVVEEIEGYR--IDSLQEQAAALPASLAEPAGVRERLRRLEEAYGELAALAAERGRRLQDALALYTIHSETAACLLWLDEK------SQWLDALDIPEKLEDLEVVQHRFESLEPEMNGLASRVAVVNQLARQLLGSEHASEDDIKAKQDLLNARWSEFRELAESKKEALQAQLTLQSFQLECHETQAWIREKTRLIESTQGLGND--LAGVMALQRKLSGMERDLAAIEVKVGDLQGEAERLAQHHPERAGAVRGQLADTADVWGALRGTLRAREDSLGEASKLQKFLQDVDDFQAWLSKTQKAVASEDV-PSTLPEAEKLLAQHEAIKNEISNYSEDHRRMREMGEEVTRDQSDPQHVFLRQRLQALHTGWAELHSMWDNRRALLAACHAYLAFARDARQADGVL----------SNQEYALSRVEMPATLQSAEAAIKKHEELTTSM 1118          

HSP 4 Score: 94.7449 bits (234), Expect = 2.093e-19
Identity = 177/874 (20.25%), Postives = 346/874 (39.59%), Query Frame = 2
Query: 1526 QTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRI---DDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLI--VDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLE----LDSQQQNDADEACERMKNDFEDL------VDLANTRKHLLLNNKDKFH-LFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEI-------ISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTD--DLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLK-KVQIQVATQDIPKDLQEA---ERYCTN------HLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALSDKI--RNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDT-KDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKV 4033
            Q + ++L R  D +  ++ET     W+ E    +   +FG  L  VE   +KH+ + +D+   EGR+   +  +R+L+   +   A     V  +   ++  ++ L  L   R   L     +     ++     W+ E+     S + G  L  VE L++K   + +DV  + D +  V+       +  +   P   E+      ++      L      RR +L ++   H  L + E+ +A + +   L  + D G  L+     L +H               EL GR+  L+    L  +++ +A+   +  +    +L      ++LA +R+   L   +  H L S+   +E W      LLV        DE +         +   + H   V E      D + EQ   L         + E+   L   + +LA LA ++ + LQ A+       E+     W+ +K    +W D  D+ + LE +  +Q R  SL+ ++  + ++V  +N+ A +L  ++ A E  I ++   +N  W E + + + +   L +   LQ F  +      W++ K ++  +TQ +  DL      +R  +        +EVK   L  E E  RL Q   + + +           +L    + W AL    + ++ SL E+   Q F++D       L++ +  ++  ++P+     +    + EA KN +++       +   GE +    +    +  R + + +H+    +    D R + L      L F+ D    +  +S +    S      T +       + ++    +EAN E V  V++ G KL+ E      +I+ K+
Sbjct:  318 QEKLEQLARRFDRKAAMRET-----WLAENQRLVMQDNFGADLAAVEAATKKHEAIETDMAAYEGRVRAVEGVARELEAERYHEVA----RVVRRRDGVLQLWRRLQELLAARRTRLEMTLALQRAFHEMLYTGAWMDEMKLRLLSQECGKHLLGVEDLLQKHALVEADVAAQADRVKAVNAAALRFAEEVDGYRPCDPEVASERAGQLEASYAELCALCAARRARLEEARALHLFLWEAEEVEAWVRQVEPLLASEDAGHDLAAVLRLLARHR----------AFEDELSGRRAQLQQTLRLGEEEKREAERDAQAARARSAELDKLWASLELAASRRAERLRASEALHQLLSDSADVEAWA-RDASLLVAAGGDVGNDEFST--------QALARKHRDVVEEIEGYRIDSLQEQAAALPASLAEPAGVRERLRRLEEAYGELAALAAERGRRLQDALALYTIHSETAACLLWLDEKS---QWLDALDIPEKLEDLEVVQHRFESLEPEMNGLASRVAVVNQLARQLLGSEHASEDDIKAKQDLLNARWSEFRELAESKKEALQAQLTLQSFQLECHETQAWIREKTRLIESTQGLGNDLAGVMALQRKLSGMERDLAAIEVKVGDLQGEAE--RLAQHHPERAGA--------VRGQLADTADVWGALRGTLRAREDSLGEASKLQKFLQDVDDFQAWLSKTQKAVASEDVPSTLPEAEKLLAQHEAIKNEISNYSEDHRRMREMGEEVTRDQSDPQHVFLRQRLQALHTGWAELHSMWDNRRALLAACHAYLAFARDARQADGVLSNQEYALSRVEMPATLQSAEAAIKKHEELTTSMEANDEKVGSVLDTGRKLVGEGNFNADKIQEKM 1150          

HSP 5 Score: 91.2781 bits (225), Expect = 2.250e-18
Identity = 148/774 (19.12%), Postives = 307/774 (39.66%), Query Frame = 2
Query: 1919 EWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEI-IHRE---IDEINELLDNLDQAMRNR----RNQLNQSHDFHQLLADIEDADAM----ILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACER------MKNDFEDLVDLANTRKHLLLNNKDKFH--LFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINE----QHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQ-DIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLAS-NALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEK--MIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWV 4156
            EWI   I    S D  + L  V++ +  F    +     K      L+ ++    +      Q++   RE   + EIN   + L++A   R    R++L +     QL    +   AM    + E +RL    + G  L+  E   K+HE     +   E  +  + G   +LE  +++ ++      R      +    ++L+    TR  + L  +  FH  L++       W+   +  L++    + L  +  +  +    E D+   + +V   N  +     E    +  + E+ SE+   L   + +L  L   ++  L+ A   + F+ E++E ++W++    LL  ++D   DL  +++L  R  + + ++    A+++   +  ++ K     D     +    +++LW  L++    R  RL +S  L +   D    + W +   + VA   D+  D    +     H +V EEI  +  +   L +    +  S  +P  +   ERL  LE  +  L  +  ++   L ++    T   ++      L ++  +L   ++P   E  +  +  FE+ +  +     ++  V      LL S +A  D I+ K + +++R    ++  + +  ALQ  L L  F  +    + W+ EK  +I ++     D   +     +    ER+L A    V ++  +  +L    P     +  ++ +  + W  L  T   +   L EA++   F +      +W+
Sbjct:  217 EWIGRTITALNSRDFPNSLVGVQQQLHAFSSYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLVAEINRAWERLEKAEHGRELALRDELIRQEKLEQLARRFDRKAAMRETWLAENQRLVMQDNFGADLAAVEAATKKHEAIETDMAAYEGRVRAVEGVARELE--AERYHEVARVVRRRDGVLQLWRRLQELLAARRTRLEMTLALQRAFHEMLYTG-----AWMDEMKLRLLSQECGKHLLGVEDLLQKHALVEADVAAQADRVKAVNAAALRFAEEVDGYRPCDPEVASERAGQLEASYAELCALCAARRARLEEARALHLFLWEAEEVEAWVRQVEPLLA-SEDAGHDLAAVLRLLARHRAFEDELSGRRAQLQQTLRLGEEEKREAERDAQAARARSAELDKLWASLELAASRRAERLRASEALHQLLSDSADVEAWARDASLLVAAGGDVGNDEFSTQALARKHRDVVEEIEGYRIDS--LQEQAAALPASLAEPAGV--RERLRRLEEAYGELAALAAERGRRLQDALALYTIHSETAACLLWLDEKSQWLDALDIPEKLEDLEVVQHRFESLEPEMNGLASRVAVVNQLARQLLGSEHASEDDIKAKQDLLNARWSEFRELAESKKEALQAQLTLQSFQLECHETQAWIREKTRLIESTQGLGNDLAGVMALQRKLSGMERDLAAIEVKVGDLQGEAERLAQHHPERAGAVRGQLADTADVWGALRGTLRAREDSLGEASKLQKFLQDVDDFQAWL 978          

HSP 6 Score: 77.411 bits (189), Expect = 3.850e-14
Identity = 130/702 (18.52%), Postives = 293/702 (41.74%), Query Frame = 2
Query: 2873 QSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRL-----LQFGRQV-SHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGE-----------SLLASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRY--NRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESE---IEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNY 4912
            ++W+ +  +L+   D+   DL  +    ++  +++ D+ A E +V+ +   A +L+  +  + A +      V +LW  L+ +L  R  RL  +  LQ+ F ++     W+ ++++++ +Q+  K L   E     H  V+ ++   + + V+      L+F  +V  +   DP+  + +ER   LE  +  L  +   +   L E++    F+ ++ +++  + Q E  L+  +  ++  A         AF++ ++  + ++   +  GE           +  A +A  DK+    E   SR      + +R  ++   H LL + +D    +E W  +  ++ +        + ST+    + +D   E+E  R  +D + E+   L    P   +E   +  ++  LE  + EL   A E+ ++L++A         T + + W+ E S  +   +   +   L +L       E  + +++     ++ + Q A +L        D+ +  Q  +  + +E       ++  L  +  +Q F  +  + + WIREK   I   +     L   +   R+L     ++     ++ DL  E E + ++    +      L +   +W  L       +    E  ++Q++L +  + + W+S+ +  +  ED       A   + +HE + + I+NY
Sbjct:  336 ETWLAENQRLV-MQDNFGADLAAVEAATKKHEAIETDMAAYEGRVRAVEGVARELEAERYHEVARVVRRRDGVLQLWRRLQELLAARRTRLEMTLALQRAFHEMLYTGAWMDEMKLRLLSQECGKHLLGVEDLLQKHALVEADVAA-QADRVKAVNAAALRFAEEVDGYRPCDPE--VASERAGQLEASYAELCALCAARRARLEEARALHLFLWEAEEVEAWVRQVEPLLASEDAGHDLAAVLRLLARHRAFEDELSGRRAQLQQTLRLGEEEKREAERDAQAARARSAELDKLWASLELAASR------RAERLRASEALHQLLSDSAD----VEAWARDASLLVAAGGDVGNDEFSTQALARKHRDVVEEIEGYR--IDSLQEQAAAL----PASLAEPAGVRERLRRLEEAYGELAALAAERGRRLQDALALYTIHSETAACLLWLDEKSQWLDALDIPEK---LEDLEVVQHRFESLEPEMNGLASRVAVVNQLARQLLGSEHASEDDIKAKQDLLNARWSEFRELAESKKEALQAQLTLQSFQLECHETQAWIREKTRLIESTQGLGNDLAGVMALQRKLSGMERDLAAIEVKVGDLQGEAERLAQHHPERAGAVRGQLADTADVWGALRGTLRAREDSLGEASKLQKFLQDVDDFQAWLSKTQKAVASEDVPSTLPEAEKLLAQHEAIKNEISNY 1014          

HSP 7 Score: 74.3294 bits (181), Expect = 3.458e-13
Identity = 111/559 (19.86%), Postives = 222/559 (39.71%), Query Frame = 2
Query: 4577 TEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHE----------ELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIAR-------WKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEV--VGKDAKSVATAQRKHNAFATEIE--RLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQL--NTDDFGDTLNETLNLLQKHLDLERNLAV 6184
            T++  + GR+  +     E+    +    +     D + +LW  L       +   E    +Q    E +    WM E +  L+ ++  K   G  + ++KH           + +  +N      ++  D Y     CD     + +++  +++  YA+L  +C  ++ ++E+    +      + +E W+ +   +  S + G +L   + L  R   F    +E+   R +       + + LG +E  E  R           +++ WA L      R + L+A+    + +SDS+++     +   L+     VG D  S     RKH     EIE  R++ L   A  +   L    G      + +R   L++ +  L      R   L DA  LY  ++     + W+ E    ++A D    +  +E++     SL+ E++      ++   L R L+  +H   +D++ K   +  +     E    ++E L+  L +  F  E    +AW I ++ +L  +T   G+ L   + L +K   +ER+LA 
Sbjct:  370 TDMAAYEGRVRAVEGVARELEAERYHEVARVVRRRDGVLQLWRRLQELLAARRTRLEMTLALQRAFHEMLYTGAWMDEMKLRLLSQECGKHLLGVEDLLQKHALVEADVAAQADRVKAVNAAALRFAEEVDGYR---PCD---PEVASERAGQLEASYAELCALCAARRARLEEARALHLFLWEAEEVEAWVRQVEPLLASEDAGHDLAAVLRLLARHRAF---EDELSGRRAQ-----LQQTLRLGEEEKREAERDAQAARARSAELDKLWASLELAASRRAERLRASEALHQLLSDSADVEAWARDASLLVAAGGDVGNDEFSTQALARKHRDVVEEIEGYRIDSLQEQAAALPASLAEPAG------VRERLRRLEEAYGELAALAAERGRRLQDALALYTIHSETAACLLWLDEKSQWLDALDIPEKLEDLEVVQHRFESLEPEMNGLASRVAVVNQLARQLLGSEHASEDDIKAKQDLLNARWSEFRELAESKKEALQAQLTLQSFQLECHETQAW-IREKTRLIESTQGLGNDLAGVMALQRKLSGMERDLAA 907          
BLAST of Spectrin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004049.1 (pep scaffold:Pmarinus_7.0:GL476488:489896:554954:1 gene:ENSPMAG00000003699.1 transcript:ENSPMAT00000004049.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 403/974 (41.38%), Postives = 596/974 (61.19%), Query Frame = 2
Query:  119 SEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDD---TSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDN-------LDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKN---DFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAI 2995
            +++RE VQKKTFTKWVNSHL  S+    + DL+ DL+DG+ L+KLLE+LSGE++P  TKGK+RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D +  +++K++LLLWCQMKTAGY NV + NFT+SW+DGLAFNAL+HKHRP+++D+  L  A+P  N+  AF  AE++ G+ QLLDA DI V+ P+EKS++TYV +     +++K+   + KR+G V+  A+  +++I  Y+ L+ +LL+WI+  I  + N     SL GV++QL  FS+YR  EKP KF ++G LE+  F IQS++RA+N+K+++P EGKLIS IN+AW+ LEK+EH  EL L EELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E D+ A+EER++A+ ++A +L++ENY+ +  V      ++ +W+ L + L  RR +L+    +Q  L E  +L+  M E+  RL S+DFGKHLLGV++LL+KH +L +D   L  R+ +    +RK         A D   V  +   L     EL+ ++ +R   L   + +W+ + +I+ ++ WI+E  ++  S D G DL S+ RL+ K   +  ++  R        +  V +   D     +E  H   D+I E   N       L +A   R+ +L Q+    Q LAD +DADA  ++  RL  + D+G     T+   K+H +    VEE+    + + G +   +    +        +RM N    + DL+ LA  RK  L +    F LFS  +  E WI  K+K L  L   E+L++L V++HRF+  E +M     ++   N ++  LI + HP    I  K++ LN  W+       QKK+ L  A+    + LE +ET SWIQDK+KL+  T DL +DL G+M LQR+L  ++RD+ AI
Sbjct:    1 ADEREEVQKKTFTKWVNSHL--SRVSCRIGDLYADLRDGRMLIKLLEVLSGERLPKPTKGKMRIHCLENVEKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDSREVKSAKDALLLWCQMKTAGYPNVRVHNFTTSWRDGLAFNALIHKHRPDLIDFDALDPADPYGNMQTAFNVAEQKLGLTQLLDAEDIAVEHPDEKSVITYVVTYYHYFSKMKALAVEGKRIGKVLESAMETDQMIEKYDSLASDLLDWIEQTIAILNNRTFANSLTGVQQQLQAFSSYRTVEKPAKFTEKGNLEVLLFTIQSRMRANNQKVFLPGEGKLISEINKAWERLEKAEHERELALREELIRQEKLEQLARRFDRKAAMRESWLTENQCLVLQDNFGSDLAAVEAATKKHEAIETDMAAYEERVHAVLHVAQELQAENYHDVARVAARRDNVLRLWRYLQELLCGRRARLEANVALQRTLHEMLHLLHSMEELKGRLLSQDFGKHLLGVDDLLQKHALLEADAAVLATRVHNVTAAARKFAENSDGYQACDPQVVSARVAMLEGCLDELLRMAAERRAGLLESRRLWKLVGEISEEEAWIREKERILSSDDFGRDLTSIVRLLSKQRALEDELQHR--------EQRVRQAVADGRGMVEE-RHFAADKIAERAGNLLSLWSELGRAAALRKLRLEQAASL-QFLADADDADAWTMDHFRLVSSGDIGHDEFSTQALAKKHRD---IVEEIGNYASAIRGLQEQADALPDEVARCGGVSDRMSNTKQQYGDLLQLAAQRKQQLDDALALFKLFSEADACELWIDEKQKWLDQLEIPEKLEDLEVVQHRFEGLEPEMSAQDSRIGVVNGVAEHLIRDGHPSETAIHAKRDNLNSRWDVFRKHVAQKKEALLSALSIQNYHLECRETNSWIQDKIKLVASTQDLGNDLAGVMALQRKLFGIERDLAAI 959          

HSP 2 Score: 80.8777 bits (198), Expect = 3.275e-15
Identity = 86/412 (20.87%), Postives = 179/412 (43.45%), Query Frame = 2
Query: 4322 QYPERGDEFELIQ-QEVKVKLTEIEAPL-------TDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERF----SEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEV--VGKDAKSVATAQRK 5515
            ++ E  D ++    Q V  ++  +E  L        +RR  LL+ +R+ + + ++ +E+ WIREK   ++      + L   ++ + + +    E+ +   R+     +G  M+     ++DK       L  LW +L  A    +   E+   +Q +L++A + + W  +    +   D   DE       +KH +++  I NY S +  L ++   + + ++     V+ +     + Y DLL++  ++K +++D +  + L+      E WI E+ +     EI  +LE   +++ RF     E + Q + +G +     + + + LI  GH     I   +D +N  W    + +  + + L +A     +  +  E    I +KI+L+     +G D   V   QRK
Sbjct:  545 KFAENSDGYQACDPQVVSARVAMLEGCLDELLRMAAERRAGLLESRRLWKLVGEISEEEAWIREKERILSSDDFGRD-LTSIVRLLSKQRALEDELQHREQRVRQAVADGRGMVEERHFAADKIAERAGNLLSLWSELGRAAALRKLRLEQAASLQ-FLADADDADAWTMDHFRLVSSGDIGHDEFSTQALAKKHRDIVEEIGNYASAIRGLQEQADALPD-EVARCGGVSDRMSNTKQQYGDLLQLAAQRKQQLDDALALFKLFSEADACELWIDEKQKWLDQLEIPEKLEDLEVVQHRFEGLEPEMSAQDSRIGVV-----NGVAEHLIRDGHPSETAIHAKRDNLNSRWDVFRKHVAQKKEALLSALSIQNYHLECRETNSWIQDKIKLVASTQDLGNDLAGVMALQRK 948          

HSP 3 Score: 62.003 bits (149), Expect = 1.625e-9
Identity = 94/472 (19.92%), Postives = 209/472 (44.28%), Query Frame = 2
Query: 1922 WIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEI--IHREIDEINELLDNLDQAMRNRRNQLNQS-------HDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQ---QQNDADEACE---------RMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQ-NILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKL--KVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAE 3265
            W+ E   L    + G DL +VE   +K E I +D+   ++    ++ +++H      +    ++  +    D +  L   L + +  RR +L  +       H+   LL  +E+    +L +       D G  L   +  L++H         LE     L  R +++   ++   + +D  +AC+          ++   ++L+ +A  R+  LL ++  + L       E WI  KE++L +     +L  +  +  +    ED+++    +V +A    R ++ E+H   + I+E+  N+L+L W++L   A  +K  L+ A    QF+ ++ +  +W  D  +L+  + D+  D      L ++   +  ++    + ++ L ++AD L  +VA+      +   ++   + + +L  +   R  +L+ +  L K F + D+ ++W+ + Q  +   +IP+ L++ E
Sbjct:  389 WLTENQCLVLQDNFGSDLAAVEAATKKHEAIETDMAAYEE----RVHAVLHVAQELQAENYHDVARVAARRDNVLRLWRYLQELLCGRRARLEANVALQRTLHEMLHLLHSMEELKGRLLSQ-------DFGKHLLGVDDLLQKHAL-------LEADAAVLATRVHNVTAAARKFAENSDGYQACDPQVVSARVAMLEGCLDELLRMAAERRAGLLESRRLWKLVGEISEEEAWIREKERILSSDDFGRDLTSIVRLLSKQRALEDELQHREQRVRQAVADGRGMVEERHFAADKIAERAGNLLSL-WSELGRAAALRKLRLEQAASL-QFLADADDADAWTMDHFRLVS-SGDIGHDEFSTQALAKKHRDIVEEIGNYASAIRGLQEQADALPDEVARCGG---VSDRMSNTKQQYGDLLQLAAQRKQQLDDALALFKLFSEADACELWIDEKQKWLDQLEIPEKLEDLE 836          

HSP 4 Score: 62.003 bits (149), Expect = 1.681e-9
Identity = 111/524 (21.18%), Postives = 217/524 (41.41%), Query Frame = 2
Query: 4682 DELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHE-------ELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILL--RERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETR-IQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEV-VGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKL---LPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYA-------MVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNIL-ENWRERQEFLEMILEVYQFAREAAVAEAWLIAQ-ELQLNTDDFGDTLNETLNLLQKHLDLERNLAV 6184
            D + +LW  L       +   E N  +Q  L E +   + M E +  L+ +D  K   G  + ++KH         L + ++N  +   K A+       CD     +V+ +   ++    +LL M  E++  + +  + + L   I   E WI E+ ++  S++ G +L   + L  ++R  E  +Q  E    RV+ A      ++   H  + +IA     +   W++L      R ++L +AA    +F++D+ +      +  RL+    +G D  S     +KH     EI      I      AD L   +   GG     ++DR    ++ +  L +    R   L DA  L+K ++        + E   W+ ++EI    +D       +E++      L+ E+ ++D    +   +   LI   HP    +  K ++ L   +++  ++  +++E L   L +  +  E     +W+  + +L  +T D G+ L   + L +K   +ER+LA 
Sbjct:  456 DNVLRLWRYLQELLCGRRARLEANVALQRTLHEMLHLLHSMEELKGRLLSQDFGKHLLGVDDLLQKHALLEADAAVLATRVHNVTAAARKFAENSDGYQACD---PQVVSARVAMLEGCLDELLRMAAERRAGLLESRRLWKLVGEISEEEAWIREKERILSSDDFGRDLTSIVRLLSKQRALEDELQHREQ---RVRQAVADGRGMVEERHFAADKIAERAGNLLSLWSELGRAAALRKLRLEQAAS--LQFLADADDADAWTMDHFRLVSSGDIGHDEFSTQALAKKHRDIVEEIGNYASAIRGLQEQADALPDEVARCGG-----VSDRMSNTKQQYGDLLQLAAQRKQQLDDALALFKLFSEADACELWIDEKQKWLDQLEIPEKLED-------LEVVQHRFEGLEPEMSAQDSRIGVVNGVAEHLIRDGHPSETAIHAK-RDNLNSRWDVFRKHVAQKKEALLSALSIQNYHLECRETNSWIQDKIKLVASTQDLGNDLAGVMALQRKLFGIERDLAA 958          

HSP 5 Score: 60.8474 bits (146), Expect = 3.915e-9
Identity = 85/367 (23.16%), Postives = 153/367 (41.69%), Query Frame = 2
Query: 5111 EEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVG-SLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHE----KIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKE---QEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRE-------RQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDL 6166
            E W+ E   +   +  GS+L       ++    AI+T+      RV     +  +L A  + +   +A  +D +   W  L EL+  R   L+A     + +    E+L L+H     K RL+ +  GK    V    +KH     +   L   + N    A K      G +    Q ++ R   L+     L +    R   L+++  L+K    + E   W+ E E  +++DD  RD+  +  ++S  R+L+ E+  R++     +  GR ++  +H  A+ + ++A        N+L  W E       R+  LE    + QF  +A  A+AW +     +++ D G     T  L +KH D+
Sbjct:  387 ESWLTENQCLVLQDNFGSDLAAVEAATKKHE--AIETDMAAYEERVHAVLHVAQELQAENYHDVARVAARRDNVLRLWRYLQELLCGRRARLEANVALQRTLH---EMLHLLHSMEELKGRLLSQDFGKHLLGVDDLLQKHALLEADAAVLATRVHNVTAAARKFAENSDGYQACDPQVVSARVAMLEGCLDELLRMAAERRAGLLESRRLWKLVGEISEEEAWIREKERILSSDDFGRDLTSIVRLLSKQRALEDELQHREQRVRQAVADGRGMVEERHFAADKIAERAG-------NLLSLWSELGRAAALRKLRLEQAASL-QFLADADDADAWTMDHFRLVSSGDIGHDEFSTQALAKKHRDI 740          
BLAST of Spectrin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000684.1 (pep scaffold:Pmarinus_7.0:GL483163:49540:93186:-1 gene:ENSPMAG00000000623.1 transcript:ENSPMAT00000000684.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 339.732 bits (870), Expect = 6.824e-103
Identity = 201/487 (41.27%), Postives = 298/487 (61.19%), Query Frame = 2
Query:  146 KTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDII-VDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEK--LINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGD-DLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYL 1594
            +TFT W NSHL K+     +D +  D +DG  L+ LLE++S E++P   KGK+R+H I NV K+++F+  + V   ++GA +IVDGN  + LG+IWTIILRF IQD +I+      ++KE LLLWCQ KTA Y NVN++NF +SWKDGLAFNAL+H+HRP+++DY  L K +P+ NLN AFE AE+   +P++LDA DI+   +P+EK+IMTYV     A +  +  E    R+  V+  A++ E+  L         +LLEWI   I  +E+     ++P ++ +L DF +YR   KPPK  D+  LE+NF  +Q+KLR  NR  ++P EGKL+S I  AW +LE++E   E  L  E+ R ++L+ L   F +KA++ K W      ++ QK +    L  + A +KKHEA E D+ AH++R+  +  IA +L   NY+ +  V      I + W  L +  QTR+D L R    + +L+  D+L
Sbjct:    4 QTFTAWCNSHLRKAGT--QIDSIDEDFRDGLKLMLLLEVISSERLPKPEKGKMRVHKINNVNKALDFIASKGVKLVSIGAEEIVDGNTKMTLGMIWTIILRFAIQDISIENT----SAKEGLLLWCQRKTAPYKNVNVQNFHTSWKDGLAFNALIHRHRPDLIDYDKLRKDDPIGNLNNAFEVAEKYLDIPKMLDAEDIVNTARPDEKAIMTYVSCYYHAFSGAQKAETAANRICKVL--AVNHERVDLSCACVRARLQLLEWINRTIPVLEDRNTQNNMPAMQGKLEDFRDYRRVHKPPKAGDKCQLEINFNTLQTKLRLMNRPAFMPSEGKLVSDIGNAWSHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKAKIHKSWTEGKQQMLQQKDYESVSLAELKALLKKHEAFESDLAAHQDRVEQIAAIAQELNDLNYHDVASVNTKCKEICDEWDDLGEWTQTRKDSLSR---TEKVLETIDHL 479          
BLAST of Spectrin beta chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009295.1 (pep scaffold:Pmarinus_7.0:GL479988:2885:20778:1 gene:ENSPMAG00000008383.1 transcript:ENSPMAT00000009295.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 332.028 bits (850), Expect = 2.292e-96
Identity = 188/474 (39.66%), Postives = 295/474 (62.24%), Query Frame = 2
Query:  149 TFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDII-VDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGD-DLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDI 1564
            TFT W NSHL K+     ++++  D ++G  L+ LLE++SGE++    +GK+R+H I NV K+++F+  + V   ++GA +IVDGN  + LG+IWTIILRF IQD +++E     ++KE LLLWCQ KTA Y NVN++NF  SWKDGLAFNAL+H+HRP+++DY  L K +P+ NLN AFE AE+   +P++LDA DI+   +P+EK+IMTYV     A +  +  E    R+  V+      EKL+ +YE ++ +LL+WI+ +  W+EN     ++  ++ +L  F +YR   KPPK Q++  LE++F  +Q+KLR  NR  ++P EGK++S I   W  LE++E   E  L  E+ R ++L+ L   F +KA++ + W    + ++ ++ +    L  + A ++KHEA E D+ AH++R+  +  IA +L   +Y+ +  V      I   W KL D  Q R+D L+R   +
Sbjct:    1 TFTAWCNSHLRKAGTG--IENIDEDFRNGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEET----SAKEGLLLWCQRKTAPYKNVNVQNFHISWKDGLAFNALIHRHRPDLIDYEKLRKDDPITNLNNAFEVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSCYYHAFSGAQKAETAANRICKVLAVNQENEKLMEDYEHMASDLLDWIR-RTPWLENRVPENTMQAMQGKLEGFRDYRRVHKPPKAQEKCQLEISFNTLQTKLRLMNRPAFMPSEGKMVSDIANGWSMLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQKAKIHEAWTAGKEAMLEKRDYDSVSLTELKALLRKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDVASVNARCQDICAEWDKLGDLTQRRKDTLERTEKV 467          
BLAST of Spectrin beta chain vs. Ensembl Nematostella
Match: EDO42431 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1C0])

HSP 1 Score: 1188.71 bits (3074), Expect = 0.000e+0
Identity = 750/2082 (36.02%), Postives = 1193/2082 (57.30%), Query Frame = 2
Query:   77 NSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAID-EKDGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRK----LQTADFD---RAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSN---DPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLL---VTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKD--DLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKL--KVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALS-DKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQ------QEVKVKLTE----IEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRI-RRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFN-ILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFE 6229
            ++A L+ERSRIK L+++RE VQKKTFTKW+NSHL +      V++L+ DLQDG+ L+ LLE+LSGEK+P  +KG++RIH +ENV KS+ FL  Q V  EN+GAHDIVDGN  + LGLIWTIILRFQIQD  I+ E   KR++K++LLLWCQ KT GY +V I NFT+SW+DGLAFNA++H+HRP+++++  LTKA+  +NL  AFE AE + G+  LLDA D+ VD P+EKSI+TYV +      ++K+ E    R+G VI      E+LI +YE+L+ +LLEWI++KI  +   +   +L GV++Q+ +F+ YR  EKPP+F ++G LE+  F + SK+RA+++K Y+PPEG+ +  INRAW+ LEKSEH  EL L EEL+RQ++LE L   F+RK  MR+ WL EN  LV    FG+DL  + AA KKHEA+E DI A+EER+NA+  +A++L  ENY+    ++ C   I+++W+ LL  ++ RR +L++C  +Q + QE   ++DWM EI I L S D+GKHLLGVE+LL+KH ++ +DI     R+   + +    L   D +   +   D+  +   + +L   Y EL+ L+  R   L     +  +  + + ++ W+ E     QS D GHDL +   L+ K E +  ++T R     +     V +      +  P   + I   +D I    D L      R+ ++ ++    Q +A+  D  +      R+  N D+G      E  +K+H      ++     +     + + L  + +   +  + C  +   +  L+  A  R+  L +      L      +ETWI  +E  L   +T+    +L+E  VI+ RF+ F+ ++  +  +V   N++  +LI + H   + I E  + LN  W  L D A QK+ +L  A+   QF  ++ ET++WI +K  LL   +D+ +  DL  +M LQRRL ++QRD+ A+E K   L  +A +L  +     +E  +  +IT V+  W E+K  ++ RD  L  S ELQ+F  DLD F +WL+    +VA++DIP  L EAER    H ++K+EI   EP++ +L++ G + +  + D Q     E+L+ L++ W  L  +W+++   L ++ + Q FIRD+ Q + +L QQ+ FLSK E+    EA +   ++ E F   +     KI+ ++ F + L      + DKI  K + +H R +A + K++     L+D L L +F  D   + +W++EK  +AS+ SYRD  +I  +  + + FE EL+AN+E +D++ E G  L DEKP  + EI+  + +L+ +W EL   +  K  +L++A R+  F+   ++M  WV E+ + IIT E+  +      L               + +++   I    E+LKE   +  D  +         QE K+ L E    +EAPL ++   L Q  +  QF RDV+DE+ WI EK   +          +V  Q++ ++ +T   EID H      + N+G+E++    P ++       EL + WDDL    +  +   + + + ++Y  +A E E WMSE+E ++M +++ KDE  A   +++HE L + I +Y   V++L +  + ++  + P S  +  +Q ++DK+YA L ++  E++ K+++ ++ Y L R +  LE WIA++ QVA S +IG +L HC LL E+F +FA  T  +G+ RV   + +CD+LI  GH ++  IA WKD INE+WADLLELIETR ++L+AA +  K+  D+ E+L +I EK  L+ E +G+D  SV   QR H +F  ++  L   +S     A +LL  Y GEK  EI  ++ E+ + W +L      R + L DA DLY+F   V++ + WM ++   I   +KA+DV GVE+++  H+S   EI+ R+E+    I +G  L+ + H  + ++R+K   +L +H + +L  W++R E L +ILEV QFAR+A  AEAW++AQE  L  ++ G  L E   LL+KH + E+ +A Q +RF  L++LT FE
Sbjct:    5 SAARLFERSRIKVLADERERVQKKTFTKWINSHLQRV--GARVNELYHDLQDGRKLILLLEVLSGEKLPKPSKGRMRIHNLENVEKSLVFLKKQRVHLENVGAHDIVDGNQKITLGLIWTIILRFQIQDITIEGETTEKRSAKDALLLWCQSKTVGYVHVTITNFTTSWRDGLAFNAIIHRHRPDLIEFEKLTKADAEQNLEQAFEVAETQLGITPLLDAEDVNVDFPDEKSILTYVAAYYHYFAKMKTVEVSGSRIGKVIERIKENEELIIDYEKLASDLLEWIEIKIIQLGEREFANTLLGVQQQMLEFNQYRTQEKPPRFVEKGNLEVQLFILTSKIRANHQKPYIPPEGRGMIDINRAWERLEKSEHERELALREELMRQERLEMLAAKFDRKYAMRETWLNENQRLVAVDNFGNDLAAVEAATKKHEAIETDIMAYEERVNAIVAVAEELHRENYHDSERIQVCKGRIIQLWELLLVLIKQRRVRLEKCMQLQRVFQEMINIIDWMDEIKIGLLSEDYGKHLLGVEDLLQKHSLVEADIAAQADRVKTVNAQAEAFLHVEDEEGKTQHKPDEAQIRDHQAELEGAYNELLQLAAARRARLEESLKLQSFYRNADEEEMWVTEKDYFVQSTDYGHDLNTAMILLTKHEAVEREMTAR-----NAQTKAVARNGEELLEAVPYATDTIQNRLDTIRSKWDKLHDNAAYRKKKIQENLKLQQFIAEYNDIMSWCDMMERIVANDDLGYDEHSAEVLVKKHHAVEEGIQGYASEVKAFHCQVDGLGDEDKSSPEVVDRCNTLDERYSALLQQAAARRQKLQDALSLHKLNREAYIVETWIDERENRLDTALTVDKGMDLEECQVIEQRFEGFQQELDANERRVQLVNELGGNLIEKGHINSDEIKETIDRLNTRWCNLRDTANQKRAKLDKALRLQQFYAQTLETKTWISEKSSLLITEEDVTNMKDLATVMVLQRRLNNIQRDLPALEDKCTSLENDAQQLCSEYEGEPEEEIVKEKITVVSSSWVEMKDNVKQRDEALAESGELQRFVIDLDDFQIWLRHTHNEVASEDIPNSLSEAERSLKEHEDIKDEIDTHEPDFQKLIEDGPKWAQDESDLQQQSLKEQLDQLQSGWKDLLVLWENRKRLLIQALNHQLFIRDAKQCEALLGQQDLFLSKEEVGATVEAVQELIKKHEEFSKRMDVQDEKINQMIQFAQRLANDGHYAQDKITEKAQNLHERRNANRQKLEAALQRLRDALQLQQFIQDAEDMYDWLNEKHQVASEESYRDLSNIQGKVMKHEAFEAELQANKERLDQISESGRDLADEKPENKPEIDELLQKLDQKWLELAEVSKHKGSKLKDAQRQEEFNAGVQTMQEWVKELETVIITQEKATDLTTATRL-------------YQKHKQLEKQINAKKERLKELDAQAADMVDAGHFDPNAVQETKIILEEKYECLEAPLAEKGAELDQAMQFFQFDRDVDDEETWINEKEPLLQSTNYGNNLFEV--QKLQKKHQTLCAEIDIHQKHKERICNQGDELVLGYHPQAEDIERRRKELEEKWDDLKKQSDAYKAQLDLSLQAKQYYFDAAEAESWMSEQELNMMGDERGKDEASATEMLKRHETLEAAIADYAETVNELGETANGLVESNHPESEQIKIRQNQIDKLYAGLKDLAEERRGKLDETLKLYQLNREVDDLELWIADKEQVAGSQDIGQDLAHCELLIEKFRDFARDTTHIGTERVASTNGVCDQLIGTGHSDAATIAEWKDGINESWADLLELIETRTKMLEAALELHKYYHDAKEVLAMIQEKDNLMTEELGRDLNSVQQLQRTHQSFEADLAPLGHQVSGIQEEAGRLLGSYAGEKASEIQAKEDEVVQAWKNLNLRVRQRTDKLHDADDLYRFLIAVQDQMLWMNDMLKHILTYEKAKDVSGVEVLMDQHQSRHVEIEGREESFFGVIKMGEQLLAKSHYASAEIREKIN-MLHRHKDEMLLEWKKRWEHLGLILEVMQFARDAYTAEAWIMAQESYLRNENLGIDLAEVEKLLEKHGNFEKVVAAQEERFLALERLTQFE 2063          

HSP 2 Score: 72.0182 bits (175), Expect = 3.489e-12
Identity = 38/119 (31.93%), Postives = 67/119 (56.30%), Query Frame = 2
Query: 6530 GTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYST 6886
            G L RK   +   +KA  R+W + YV++ + ++  +K++K       +  +    P+  + ++   A++Y KR +VFR R+ NG E+LF+A D+ +MN W++ + E   V  S AK ST
Sbjct: 2161 GYLHRKPTMDGPNRKAAIRQWKQYYVILRDMELHFFKDQKSA-----RNDHAAAHPLATLDSVCEVASDYTKRKHVFRFRVSNGQEFLFQAKDEEDMNIWIKHVQECAQVPESPAKPST 2274          
BLAST of Spectrin beta chain vs. Ensembl Nematostella
Match: EDO49576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP7])

HSP 1 Score: 440.654 bits (1132), Expect = 7.237e-134
Identity = 283/781 (36.24%), Postives = 452/781 (57.87%), Query Frame = 2
Query:   83 ALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAI--DEKDGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAA-IDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVR---KDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVG----DKLSLTEYY------LKQHEEQMLQVEELEKLITE 2377
            A  +E+ RIK L  +R   QKKTFTKWVNS L KS    HV+DLF DL DGK L+ LLEI+SGEK+    +GK R+H I+NV K++ FL  + V  E++GA D+VDGN  LILGLIW IILRFQI D +   D    ++++KE+LLLWCQ  T GY  V+I+NF++SW++GLAFNALLHKHRP+++DY TL  +    NLN AF  A  + G+ +LLDA D+   +P+++S+MTYV +      ++KS E   +R+  +I   +  EK+  +YE +  +LL WI  KI  +      +++  V+ +LG F ++R  EKPPK+ +R  +E + F +Q+K +A+N++ + PPEGKL+  INRAW  +E +EH     L  ELIRQQ LE++   F RKA +R+ WL +   ++  ++ G D  T+ AA+K+HEA+  D+ A EER   +  +A +L  E+YYK   +     +I+  W KL+  L+ RR+ L     +  + ++ D     M +I   L+S D+G+HLL V+N+L+KH ++ S I++   R    + + Q+  F  A   + + +  +++ L   +Q L+ L ++R   L     ++ + ED+  +  +IKE  +L  S + G DL S+ RL ++ E + +++  R    + I+ K  +++ K        + +I   + + I      L +    RR +L  +    Q  +D  DA++ + E+  +  + D G      +SL + +      +K   + + Q++E  KL+ E
Sbjct:    6 APTFEKDRIKTLKNERIFSQKKTFTKWVNSFLDKS--GLHVNDLFEDLADGKILISLLEIISGEKIGFAARGKFRVHNIQNVNKALEFLQ-KSVKLESIGAEDVVDGNERLILGLIWMIILRFQIADISYQDDMSKERKSAKEALLLWCQRMTRGYPGVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAAEKLGITRLLDAEDVDCPRPDDRSVMTYVAAYYQYFAKLKSEETGGRRIAKIIGVIMEIEKMEKSYESMVSDLLHWISSKITELAR-PFEKNIFAVQRELGAFKHFRTVEKPPKYTERVNIEAHLFNLQTKRKANNQRPFAPPEGKLVKDINRAWQVMESAEHERAQALRNELIRQQMLEKMAEKFQRKADLRESWLDDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELIDEDYYKADVIRKREDVIMVKWDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQSQHERTLAINTQAQS--FVAAKHPETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWI-----KLKELAGTRRERLKDAAQSLQYYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQRHSHIEDEIKAFADDIAQLKEQSKLMGE 775          

HSP 2 Score: 65.855 bits (159), Expect = 2.196e-10
Identity = 82/365 (22.47%), Postives = 167/365 (45.75%), Query Frame = 2
Query: 1922 WIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKD---LIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLL----------ADIEDADAMILEE---RRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQI---SRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQR 2959
            W+ +++Q+      G D  +VE  +++ E I +DV  R++   ++ +    ++     D    + ++I +  D I    D L + +  RRN L     F QL+          AD+ D +A +  E   R L +  ++ DK SL E  ++   E+ L +    +  + +  +  + E+  Q+Q    +A       F+ LV L   R+  L ++ + +  F + E  + +I   +KL  +     +L  L  ++ R +  E ++   +G+ S    I    + LI++ H   + I  K   L  +W +L +LA  +++ L+ A    Q+  ++ + +SW+++KM ++   D  +D+   +  LQR
Sbjct:  404 WLDDMVQVIDDELLGQDAATVEAALKRHEAISTDVKAREERFQMVFNLAQELI-----DEDYYKADVIRKREDVIMVKWDKLVKKLEARRNTLT---GFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQIQSQHERTLAINTQAQ--SFVAAKHPETEVIKQRQRLLTQA-------FQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEI---NGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQYYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQR 748          

HSP 3 Score: 64.6994 bits (156), Expect = 4.672e-10
Identity = 65/319 (20.38%), Postives = 139/319 (43.57%), Query Frame = 2
Query: 3101 WEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSH--SKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALSDK-IRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSY-RDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELE 4045
            W++L   L+ R   L    +L   F+D+DS    +  ++  + ++D  + L + +     H  V+ +I   + ++ R L    Q     +   P+  +  +R  +L   + AL ++ K++   L +S +  TF  D  + D  + + +   +  E+  +  +    ++  EA +  +       + ++  G++L+       K I+ K +Q+ +    +++    R   L+D    L++  D    E WM EKM +     Y RD +   +   R    E E++A  + + ++ E+ +KL+ E     S+  P  V L+
Sbjct:  477 WDKLVKKLEARRNTLTGFTQLVGVFRDMDSAHADMLDIEAGLRSEDYGRHLLDVQNMLDKHSLVESQI---QSQHERTLAINTQAQSFVAAKHPETEVIKQRQRLLTQAFQALVQLGKERRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQYYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQRHSHIEDEIKAFADDIAQLKEQ-SKLMGEAIKNTSQQVPHFVSLK 791          

HSP 4 Score: 60.4622 bits (145), Expect = 8.073e-9
Identity = 45/175 (25.71%), Postives = 86/175 (49.14%), Query Frame = 2
Query: 5687 RHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLK 6211
            R   L D+ +LY F+  V E   ++ E +    + +  RD+  +  +   H +L+AEI+ R  +    I  G+ LI++ H  A +++ K K++      + E    R+E L+   +  Q+  +A  AE+W+  +   + ++D+G      ++LLQ+H  +E  +   AD    LK
Sbjct:  593 RRARLEDSLELYTFFEDVEEEDIFIKETDKLAASKEVGRDLASLTRLQQRHEALEAEINGRFSHCEGIIAKGQALIDKGHFGAKEIKAKIKQLQANWIKLKELAGTRRERLKDAAQSLQYYSDANDAESWMKEKMFVVCSEDYGRDEQSAVSLLQRHSHIEDEIKAFADDIAQLK 767          
BLAST of Spectrin beta chain vs. Ensembl Nematostella
Match: ALPHA-ACTININ (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4X0])

HSP 1 Score: 346.28 bits (887), Expect = 1.605e-100
Identity = 203/485 (41.86%), Postives = 305/485 (62.89%), Query Frame = 2
Query:  140 QKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDII-VDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGD-DLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKL----------LDDLQTRRDKLDRCR 1558
            QKKTFT W NSHL K+ +   + ++  DL+DG  LL+LLEI+SGE++P   +GKLR H I NV K+++F+  + V   ++GA +IVDGN  + LG+IWTIILRF IQD AI++      +K+ LLLWCQ KTA Y NV+++NFT+S+KDGLAF AL+H+HRP+++DY +L K +P+ NLN AF+ AE+   +P++LD  D++  ++P+E+++MTYV S   A    +  +   KR+G V+N     E+++ +YE L+ +LL+WI   + W+ +   + +L  ++ +L +  NYR  EKPPK +++G LE NF  +Q+KLR  NR  Y+P EGK+I+ IN AW  LE +E   E  L  E+ R ++L+ L   F  K  + + W    D ++ +  + D  L  I A +KKHEA E D+ AH++R++ +  IA +L +  Y KI EV      I + WK L          L+D Q R   LD+ R
Sbjct:   29 QKKTFTAWCNSHLRKTGK--QIGEIEEDLRDGVLLLQLLEIISGERLPHPERGKLRFHRIANVNKALDFVAGKGVKLVSVGAEEIVDGNLKMTLGMIWTIILRFAIQDIAIEDS----FAKDGLLLWCQRKTAPYKNVSVKNFTTSFKDGLAFCALIHRHRPDLIDYDSLRKEDPLYNLNKAFDVAEQYLDIPRMLDPEDMVETERPDERAVMTYVSSYYHAFTSSQQADTAAKRIGKVLNINRDNERMMEDYERLASDLLDWINKTMPWLTSRDTDGTLKDMQRKLDELRNYRKGEKPPKVEEKGQLETNFNTLQTKLRLSNRPAYLPSEGKMINDINDAWGGLEMAEKDFEDWLLMEMRRMERLDHLAEKFRHKCNIHESWTNGKDAVLSKDDYSDATLADINALMKKHEAFESDLAAHQDRVDQIVAIAQELNALEYSKIDEVNARCQNICDDWKDLGELTMHRLQKLEDAQQRLQSLDQLR 507          
BLAST of Spectrin beta chain vs. Ensembl Nematostella
Match: EDO29101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4L2])

HSP 1 Score: 308.531 bits (789), Expect = 1.024e-93
Identity = 170/362 (46.96%), Postives = 244/362 (67.40%), Query Frame = 2
Query:   83 ALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAI--DEKDGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAW 1162
            A  +E+ RIK L  +R   QKKTFTKWVNS L K +   HV+DLF DL DGK L+ LLEI+SGEK+    +GK R+H I+NV K++ FL  + V  E++GA D+VDGN  LILGLIW IILRFQI D +   D    ++++KE+LLLWCQ  T GY +V+I+NF++SW++GLAFNALLHKHRP+++DY TL  +    NLN AF  AE + G+ +LLDA D+   +P+++S+MTYV +      ++KS E   +R+  +I   +  EK+  +YE +  +LL WI  KI  +      +++  V+ +LG F ++R  EKPPK+ +R  +E + F +Q+K +A+N++ + PPEGKL+  INRAW
Sbjct:    6 APTFEKDRIKTLKNERIFSQKKTFTKWVNSFLDKVRSGLHVNDLFEDLADGKILISLLEIISGEKIGFAARGKFRVHNIQNVNKALEFLQ-KSVKLESIGAEDVVDGNERLILGLIWMIILRFQIADISYQDDMSKERKSAKEALLLWCQRMTRGYPDVDIQNFSTSWRNGLAFNALLHKHRPDLIDYATLRPSQHEANLNNAFTVAEEKLGITRLLDAEDVDCPRPDDRSVMTYVAAYYQYFAKLKSEETGGRRIAKIIGVIMEIEKMEKSYESMVSDLLHWISSKITELA-RPFEKNIFAVQRELGAFKHFRTVEKPPKYTERVNIEAHLFNLQTKRKANNQRPFAPPEGKLVKDINRAW 365          
BLAST of Spectrin beta chain vs. Ensembl Nematostella
Match: EDO49575 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP6])

HSP 1 Score: 322.783 bits (826), Expect = 3.548e-88
Identity = 289/1268 (22.79%), Postives = 573/1268 (45.19%), Query Frame = 2
Query: 2450 MKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLL-ASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHA----------EKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIP-EVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKL 6217
            + N +  L++ +  R+  L      +H     E ++ W+  KE+   ++     LD +  ++ + + F  ++     +VS+ NQ++ +LI + H     +  K+  +N  W +L  L  ++++ L        F+   +E +SWIQ+K   L   ++L  D+E +    RR   ++RD+ A+E KV  L  +A  L V  P     I ++   V  LW  LK     R   L+ +   Q F  D      W  +++    + + P+D+  A      H E  +EI      + +L ++GR +  +   PQ +   + +  L+ E  AL   W  ++  LH+  D Q+ +    +++ +L + E F+                        ++ + + K+ ++ +  ++++ A +   D + ++ E + +R D ++++   R  AL    +L  F  D      W+ EK  IA D S++D K++     R K FE E+ AN++ +D + + G  LI  K     +++ K+  L   W  L+   TEK  +L++A R+   +   + +  W+ E  + +   +   +  G+  L +K +  E             SDIE HA          ++L  Q     D  +   + ++ +   +      RR++L     + QF+ D+E E  W+RE L+  +   +    + V   + R L   N E+ NH  RI  + + G+++I + + ++DK     +EL  LWD+L+      +Q   ++   Q+YLSEA E + WM+++      +D  KD   A   + +H+ L   +  + + + +LA++   ++      S  ++  Q  +++ +  L  +   +  ++ +  + +   R ++ +  +++E+ Q A S + G++ EH  +++ RF +F            ++ D +   L++ GH ++  I   +D     W  L + I  R + L +A +  +F  D +EL+  I EK   I  E +G+D  S    QRKH  F  E+  LE  I      + +L   Y G+  + +   +  +  LW  L++    +   L DA + YK    VR+L++W  E    I +DD    V   E ++       AE+D+R+E+ +  +  G  +I   H    ++  K + +L +   +  +W  R+E L     ++ F ++A   +++  +QE  L   + G++++E   LL+KH + E+ +  Q ++   L+ L
Sbjct:  538 ITNTYNRLIETSEMRRLSLQKAIKYYHFCHECEDMDLWMSNKERQFKSIESQNTLDAIQTVRQKLERFATEIATKCSRVSDINQLADELIQDGHAHSAAVKAKRKEINERWEKLQRLKVKEEENLAEKHGVELFLDVCEEMRSWIQEKDAAL-CKEELGKDIETVRAQLRRHQGIERDLAAVEDKVAKLQDQAKSLVVRHPRQARQIKAKEGEVISLWAILKSKANKRKGLLDEAYGQQGFLADARDLMSWSAELKESFISAEDPQDIASASELIQQHEEKFDEIQTRFERFDQLDEYGRNLLATS--PQAVQVKQSMAALKAEKAALSSSWAKRNDRLHQGLDLQSSVD---EVEWLLKKHEDFV-----------------------KTLTAQEEKVRSLADMAKTIIHARHQARDWVASRAESVINRRDNVKNQASDRQKALLTSQVLQNFIRDADEFGGWIKEKSQIAEDESFKDPKNLQGNLKRHKAFEAEITANKDGIDRINKAGKDLIRTKHFGAQKVKDKLKGLNEAWLNLVADTTEKGNKLQQAERQRQLNRAMEDVRIWMNETEAVLGLEDTGRDLAGVKFLTKKHQLLE-------------SDIEMHATVIVDVADKAQELVSQGHFNSDTIKSDSENLQSRYRSLLCLTDKRRSVLEDAFALHQFIYDIEVEMTWVREHLQQASSGDLGTSLISVQRLQKRHLAFEN-ELTNHQTRIDTVLSSGQDLIDSCYSATDKVEERCEELQNLWDELVDMAAQRKQRLHDSFLSQKYLSEANEADSWMNDKAGLAASQDYGKDGASAETLLTRHKALQVDVAAFSTTIDELAEEARRLVQSSHFDSEKISSTQRDLEEQFCGLNTLVKTRHTRLTESKKLHEYRREVEEISAYVSEQLQTAASEDYGTDFEHLQVIQGRFGDFQRSVASYAE-NFRNVDNLAKMLVSEGHTDTVAIKEQQDITRSMWLHLEDQIRLRQKRLTSAEEIHRFNRDLNELISRIQEKDAAINLEDLGRDLASTQVLQRKHEVFECELVTLEKQIEELTVESARLQATYQGQTARSVEQHEKYVLSLWEELKRKTSRKRRKLHDAYEFYKLGNTVRDLISWCIETSRLIASDDPVHTVSDAERMMRELDEHHAEMDAREESFARVLETGEKMIEDGHFAEEEITDKLELLLSERERLYASWDTRKEELSEAYYLHVFLKDAKQVDSFTSSQEAVLLCAELGNSVDEVEFLLKKHENTEKLVLSQEEKLSALQVL 1761          

HSP 2 Score: 318.546 bits (815), Expect = 7.034e-87
Identity = 379/1707 (22.20%), Postives = 770/1707 (45.11%), Query Frame = 2
Query: 1217 IRQQKLEQLG--NHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKIT--EVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLG-----VENLLEKHKILLSDIRNLEGRIDDTSRKLQTAD--FDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDS--IVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKN---DFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQV---SHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLL-ASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELI-------SVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRL--IPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKS 6244
            +RQ++L      + FNR        + E D  ++ +  G DL +     +KHE  E ++   E++I  L   +  L++  Y   T   VE     ++ +W++L      +R KL    +   +      L+ W  E T RL + D   H +      +  L E H         ++ R +  +R L+T +   +     ++ +  K + L++  + L    + R++EL+    +  +++D      +      +    + G+ +  VE L++K E     V  +++    KL +  ++ K   D    + ++I   +  + +  + L   +  RR +L  SH   Q   D+ ++++ I+E+ +   +    D ++L E  L++H+    ++   E+ I  +  R    +L S     A E   R++     +E+L++ + T+   L   +D        +  ++ I  KE ++++     + +    ++ +   F+ D+ + + +V   N ++  LI + H     I ++QN L   WN+L D A +++++L  A + + F    ++  S I +K  + + + ++  DL  +  L R+   ++R++  IE K++ L  EA +L  ++P     + ++   + E WE L  +   R   L ++  LQ F  D      W+  +  ++++ ++  ++++AE     H E K ++      Y   + FG  +    H   D    +  + ++ L  E   L+++W+ + + L +S D Q F+ D+ + +  +  ++      E   + +  ++  +    F+ S+++ +  I ++ +  +  L   +  ++ IR+K  +I  + +A++     R+  L +  LL +F  D   LE WM+EK+ IA++ SYR+  ++  +  + + FE E+ A++  +D + + G  L+   P  +  +E ++ +L + WS L + +  K+++L+EA ++  F+     + +W+     + +      E+YG  +  +N  +K  +     + +    +S++ + A +         DE      +V  +  ++  P T+R   L     + QFL D + E +WI++K E I K +     L      +++++   +EI++H   +  L   GE+++     +          L +LW++L    +   +  + +    +Y  +  E + W+SE+   +   D  +DE  A   +RKH+ L        S I +  SI S+L+D        D   S L  + Q+ +++ Y  L ++  ++  ++ D  + ++  R    L  W+ E+  +  S++ G +LEH  +L ++F  F       G  R+    E    L+   H +S  I +  + I E W  L E   TR++ L  A D   F     E+   I EKI    + E    D + V   QRKH  F  +++ L   +   L  AD L       K + I +++ E+QK W  LQ+   ++ + L+ +  L  F    R+L++W+     Q+  +        VE +I+ ++ L+ EIDSR  +     +    L+   +P A D+R K+  V      +  + R R + L+   E+ +F REA   EAWL A+E  L ++D GD+L     LL+K  + E+ L  Q ++F +L   TSF   +KS
Sbjct: 1477 LRQKRLTSAEEIHRFNRDLNELISRIQEKDAAINLEDLGRDLASTQVLQRKHEVFECELVTLEKQIEELTVESARLQA-TYQGQTARSVEQHEKYVLSLWEELKRKTSRKRRKLHDAYEFYKLGNTVRDLISWCIE-TSRLIASDDPVHTVSDAERMMRELDEHHA-------EMDAREESFARVLETGEKMIEDGHFAEEEITDKLELLLSERERLYASWDTRKEELSEAYYLHVFLKDAKQVDSFTSSQEAVLLCAELGNSVDEVEFLLKKHENTEKLVLSQEE----KLSALQVLGKELIDNQHNQSDMIRNRLSGVCDRREKLKAELDKRREKLQNSHKIMQFYQDVVESESWIMEKLQTATDESFKDPINL-ESKLQKHQAFESELTAHERAIDSV--RDKGEQLISCGHFAASEVEVRIEALYIQWEELLEASATKGRKLQEARDHQQFNQEVDIADSCITDKETIVLSSDYGRDFEHCVRLQRKMKEFDQDLAVDAARVEAINVLAEKLIGQGHAGSVRIQQRQNALTERWNRLQDKASERRQKLAEACEIHAFNRNCRDVSSMINEKAAV-QTSGEVGRDLPAVEALIRKHDDVERELTVIEGKMEELEGEAYRLVRSQPHMARAVQAKQADIIEQWERLNDLFDQRKVILEANRLLQIFLVDYRDLMSWMNDLGTRMSSGELADNVRDAEAMLGLHEERKGQMNARMDSYNATVAFGMSLVEQGHVSAD----VIKQNVDDLVLENTELQQLWQSRKLMLQQSTDLQMFLADAEKAENWIKNKQMVAQSIESRESLDNVESLLKSHINFEKSLSTYEENIRSLESSAKQFLQVKHYHAEAIRSKYLEILDKWEALKKLAASRSGKLGESKLLFQFLRDAKELESWMNEKLQIAAEASYREATNLQQKLQKHQTFEAEVSAHKSELDAITQTGQSLMRNSPSCQETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWI-----EEVENALASEDYGKDMRSVNNLIKRHQSLQMDIARYEDRVSELLKQAGEFVAAEHFLKDEIADRAADVAERFEQLVEPATERELRLQDSLALHQFLADTQVEVDWIKDK-EPIAKSEDYGRNLLGVQSLMKKMEGLESEINSHELLVQALLETGEQLVLRGHYAERDIGAKSQMLLELWEELRINAQTRNEKLQASLATHQYYDQVFEMDAWVSEKLSLVSSTDYGRDETSAETLLRKHDALQLELDANESKIRDLRSIYSELSDA------GDTEFSKL-EKIQDELEERYTHLRDVARDRHRRLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDLVSSGE-RIAKLTEHAQMLLDDEHTDSEMIEQRAEVICERWDGLKERTSTRLEELDRARDLHAFRRSVDEIHAWIQEKIDALGVAENGAPDLRHVQALQRKHQGFQRDLQALGEKVDLVLRDADDLSAKVPAHKHELIMEKQ-EVQKAWKKLQQLASSKQSHLLQSEGLQAFLDDYRDLMSWIETTSAQVAEETLGSTFADVETLIAQNQELQTEIDSRANSVEEFQSRADQLLGSGNPSAEDIRNKSSHVRDTWDRLGASLRTRTQQLQHNKEIQRFKREADQLEAWLNAREHDLLSEDVGDSLEAVEELLKKQDEFEKMLLTQGEKFNSLTN-TSFSVHKKS 3146          

HSP 3 Score: 291.582 bits (745), Expect = 9.009e-79
Identity = 377/1674 (22.52%), Postives = 739/1674 (44.15%), Query Frame = 2
Query: 1220 RQQKL--EQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRK---FEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACER-MKNDFEDLVDLANTRKHLLLNNKDKFHLFSN-FETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEA-TIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQV---SHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLAS-NALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLE----------KKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHC-ILLRERFS-EFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLE 6169
            RQ+ L   Q+  +F R A     W+ E   +   + F D    +   +K+H+A E +I A+++ I+ +     DL    ++   +V+D    + E W  L+ D   + +KL +    + + +  + +  WM E    L   D G+ L GV+ L +KH++L SDI      I D + K Q     +   + D +    + L + Y+ L+ L+++R   L     + ++I DI  +  W++E +Q   S D G  L SV+RL ++   FE  L++   R D ++     ++     D      + +    +E+  L D L      R+ +L+ S    + L++  +AD+ + ++  L  + D G   +  E  L +H+   + V      I EL      L   S   ++   + +R ++  F  L  L  TR H  L    K H +    E I  ++  + +   +     + + L VI+ RF  F+  +  ++      + +++ L++E H +   I E+Q+I    W  L D    ++K L  A + ++F  +  E  S IQ+K   +   +DL  DL     LQR+    + ++  +E +++ L  E+ +L+       A +++     V  LWEELK     +  +L+ + E  K    +     W  +    +A+ D    + +AER      E   E+   E  + R+L+ G ++    H  ++       ++L +L +E   L   W  +   L E+     F++D+ Q+D   + QE+ L  +EL N+ +  +   ++ E  +  V S + K+ A+   G+ L+ + +  SD IRN+   +  R + ++ ++D+R   LQ+   +++F  DV+  E W+ EK+  A+D S++D  ++ ++  + + FE EL A+  ++D V +KG +LI       SE+E ++  L  QW ELL  +  K ++L+EA     F++      S +T+  + +++++   +    V L  KMK+ +        + +    I   AEKL  Q        +  Q  +  +   ++   ++RR  L +   +  F R+  D    I EK    T  ++  + L      IR+      E+    G++ +L  E   ++R+    +        ++ + W+ L    +  +   E NR +Q +L +  +   WM++    +   + A +   A   +  HEE        G + +++ D Y+  +     G  LV Q     D +  ++ ++ LE          +KL ++            +  E WI  +  VA S E    L++   LL+   + E ++ T E     ++  +    + + + H  +  I      I + W  L +L  +R   L  +   F+F+ D+ EL   ++EK+++  E   ++A ++    +KH  F  E+   +  + +A+    + L       ++ +  R  +L  LW  L    +N+   L +A     F   V EL  W+ E+E  + ++D  +D+  V  +I  H+SL+ +I   ++  S  +      +  +H   +++  +A +V  +   ++E   ER+  L+  L ++QF  +  V   W+  +E    ++D+G  L    +L++K   LE
Sbjct:  949 RQKALLTSQVLQNFIRDADEFGGWIKEKSQIAEDESFKDP-KNLQGNLKRHKAFEAEITANKDGIDRINKAGKDLIRTKHFGAQKVKDKLKGLNEAWLNLVADTTEKGNKLQQAERQRQLNRAMEDVRIWMNETEAVLGLEDTGRDLAGVKFLTKKHQLLESDIEMHATVIVDVADKAQEL-VSQGHFNSDTIKSDSENLQSRYRSLLCLTDKRRSVLEDAFALHQFIYDIEVEMTWVREHLQQASSGDLGTSLISVQRLQKRHLAFENELTNHQTRIDTVLSSGQDLI-----DSCYSATDKVEERCEELQNLWDELVDMAAQRKQRLHDSFLSQKYLSEANEADSWMNDKAGLAASQDYGKDGASAETLLTRHKALQVDVAAFSTTIDELAEEARRLVQSSHFDSEKISSTQRDLEEQFCGLNTLVKTR-HTRLTESKKLHEYRREVEEISAYVSEQLQTAASEDYGTDFEHLQVIQGRFGDFQRSVASYAENFRNVDNLAKMLVSEGHTDTVAIKEQQDITRSMWLHLEDQIRLRQKRLTSAEEIHRFNRDLNELISRIQEKDAAIN-LEDLGRDLASTQVLQRKHEVFECELVTLEKQIEELTVESARLQATYQGQTARSVEQHEKYVLSLWEELKRKTSRKRRKLHDAYEFYKLGNTVRDLISWCIETSRLIASDDPVHTVSDAERMMRELDEHHAEMDAREESFARVLETGEKMIEDGHFAEEE----ITDKLELLLSERERLYASWDTRKEELSEAYYLHVFLKDAKQVDSFTSSQEAVLLCAELGNSVDEVEFLLKKHENTEKLVLSQEEKLSALQVLGKELIDNQHNQSDMIRNRLSGVCDRREKLKAELDKRREKLQNSHKIMQFYQDVVESESWIMEKLQTATDESFKDPINLESKLQKHQAFESELTAHERAIDSVRDKGEQLISCGHFAASEVEVRIEALYIQWEELLEASATKGRKLQEARDHQQFNQEVDIADSCITDKETIVLSSDYGRDFEHCVRLQRKMKEFDQDLAVDAARVEA---INVLAEKLIGQGHAGSVRIQQRQNALTERWNRLQDKASERRQKLAEACEIHAFNRNCRDVSSMINEKAAVQTSGEVGRD-LPAVEALIRKHDDVERELTVIEGKMEELEGEAYRLVRSQPHMARAVQAKQADIIEQWERLNDLFDQRKVILEANRLLQIFLVDYRDLMSWMNDLGTRMSSGELADNVRDAEAMLGLHEE------RKGQMNARM-DSYNATVAF---GMSLVEQGHVSADVIKQNVDDLVLENTELQQLWQSRKLMLQQSTDLQMFLADAEKAENWIKNKQMVAQSIESRESLDNVESLLKSHINFEKSLSTYEEN---IRSLESSAKQFLQVKHYHAEAIRSKYLEILDKWEALKKLAASRSGKLGESKLLFQFLRDAKELESWMNEKLQIAAEASYREATNLQQKLQKHQTFEAEVSAHKSEL-DAITQTGQSLMRNSPSCQETVESRLKDLADLWSLLGDLSDNKAQRLKEAIQKQTFERNVIELQAWIEEVENALASEDYGKDMRSVNNLIKRHQSLQMDIARYEDRVSELLKQAGEFVAAEHFLKDEIADRAADVAERFEQLVEPATERELRLQDSLALHQFLADTQVEVDWIKDKEPIAKSEDYGRNLLGVQSLMKKMEGLE 2591          

HSP 4 Score: 105.531 bits (262), Expect = 2.521e-22
Identity = 296/1529 (19.36%), Postives = 616/1529 (40.29%), Query Frame = 2
Query: 1751 TADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACE-RMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIA-KEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNAL-SDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTR--YNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITK--FKIAPETLQVCLQR-------IRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHE----ELISVINNYGSIVSKLADKYHHILNCDLPG--SHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNE----------IGSEL-EHCILLRERFSEFAIQTNEVGSLRVKDA----DEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLI--HEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLT 6220
            TA FDR     D V +++  + N Y  LI  SE R   L      + +  +  +   W+    + F+S +S + L +++ + +K E+  +++  +   + D ++ +  +   D       +  +   EINE  + L +        L + H     L   E+  + I E+       ++G  +      L++H+     +  +E  + +L  +   L +   +Q    +A E  + + +  L   AN RK LL     +    ++   + +W    KE  +    P +      +I+   + F D+++    +  + ++  R+L+      +++   KQ++                              ++  + SW +   +L +   DL+  ++ +  L ++     + + A E KV+ L   A  +  A+      + S   +V    + +K    DR   L +S  LQ F +D D F  W+K+ + Q+A  +  KD +  +     H   + EI   +    R+ + G+ +  +K      +  ++L  L   W  L     +K   L +++  +   R    +   + + E+ L   +   +    K   ++ +  ++ +  +   I  V +  + L++     SD I++  E + SR  ++    D+R S L+D   L +F  D+     W+ E +  AS      T  IS +    R   FE EL  ++  +D V+  G  LID       ++E +  EL+N W EL++ A ++ ++L ++     +        SW+              ++YG         +   +     +      + ++ + A +L +      ++    Q++++ +   +   +  R   L + K++ ++ R+VE+   ++ E+L+      +    E LQV   R       +     N   +DN A  +    +     I+     +    + L++  +L    +T+ E+  +F   NR++ E +S        + E++  +  ED  +D        RKHE    EL+++      +  + A      L     G  +  V Q ++ V  ++ +L      K+ K+ D  +FY L  +++ L  W  E S++  S++          +  EL EH   +  R   FA +  E G   ++D     +E+ DKL  L  +        ++R+  +W       +TR + L  AY    F+ D+ ++       E + L  E +G     V    +KH      +   E  +S AL +  K L      +   I +R   +      L+ + + R   L ++  + +FY  V E  +W+ E ++Q   D+  +D   +E  +  H++ ++E+ + +         G  LI+  H  A++V  + + + I+   +LE    +   L+   +  QF +E  +A++ +  +E  + + D+G      + L +K  + +++LAV A R E +  L 
Sbjct:  523 TAHFDR-----DNVAVRQITITNTYNRLIETSEMRRLSLQKAIKYYHFCHECEDMDLWMSNKERQFKSIESQNTLDAIQTVRQKLERFATEIATKCSRVSD-INQLADELIQDGHAHSAAVKAKR-KEINERWEKLQRLKVKEEENLAEKHGVELFLDVCEEMRSWIQEKDAALCKEELGKDIETVRAQLRRHQGIERDLAAVEDKVAKLQDQAKSLVVRHPRQARQIKAKEGEVISLWAILKSKANKRKGLLDEAYGQQGFLADARDLMSWSAELKESFISAEDPQDIASASELIQQHEEKF-DEIQTRFERFDQLDEYGRNLLATSPQAVQV---KQSM------------------------AALKAEKAALSSSWAKRNDRLHQGL-DLQSSVDEVEWLLKKHEDFVKTLTAQEEKVRSLADMAKTIIHARHQARDWVASRAESVINRRDNVKNQASDRQKALLTSQVLQNFIRDADEFGGWIKE-KSQIAEDESFKDPKNLQGNLKRHKAFEAEITANKDGIDRINKAGKDLIRTKHFGAQKV-KDKLKGLNEAWLNLVADTTEKGNKLQQAERQRQLNRAMEDVRIWMNETEAVLGLEDTGRDLAGVKFLTKKHQLLESDIEMHATVIVDVADKAQELVSQGHFNSDTIKSDSENLQSRYRSLLCLTDKRRSVLEDAFALHQFIYDIEVEMTWVREHLQQASSGDL-GTSLISVQRLQKRHLAFENELTNHQTRIDTVLSSGQDLIDSCYSATDKVEERCEELQNLWDELVDMAAQRKQRLHDSFLSQKYLSEANEADSWM-----NDKAGLAASQDYGKDGASAETLLTRHKALQVDVAAFSTTIDELAEEARRLVQSSHFDSEKISSTQRDLEEQFCGLNTLVKTRHTRLTESKKLHEYRREVEEISAYVSEQLQTAASEDYGTDFEHLQVIQGRFGDFQRSVASYAENFRNVDNLAKMLVSEGHTDTVAIKEQQDITRSMWLHLEDQIRLRQKRLTSAEEIHRF---NRDLNELISR-------IQEKDAAINLEDLGRDLASTQVLQRKHEVFECELVTLEKQIEELTVESAR-----LQATYQGQTARSVEQHEKYVLSLWEELKRKTSRKRRKLHDAYEFYKLGNTVRDLISWCIETSRLIASDDPVHTVSDAERMMRELDEHHAEMDAREESFA-RVLETGEKMIEDGHFAEEEITDKLELLLSE--------RERLYASW-------DTRKEELSEAYYLHVFLKDAKQVDSFTSSQEAVLLCAE-LGNSVDEVEFLLKKHENTEKLVLSQEEKLS-ALQVLGKELIDNQHNQSDMIRNRLSGVCDRREKLKAELDKRREKLQNSHKIMQFYQDVVESESWIME-KLQTATDESFKDPINLESKLQKHQAFESELTAHERAIDSVRDKGEQLISCGHFAASEVEVRIEALYIQWEELLEASATKGRKLQEARDHQQFNQEVDIADSCITDKETIVLSSDYGRDFEHCVRLQRKMKEFDQDLAVDAARVEAINVLA 1973          

HSP 5 Score: 80.1073 bits (196), Expect = 1.354e-14
Identity = 172/901 (19.09%), Postives = 362/901 (40.18%), Query Frame = 2
Query: 1334 LVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLE---GRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSN--DPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQND-ADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPS-EELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDW-NQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQV---SHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNAL-SDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSY-RDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDE 3997
            L  I    +K E    +I     R++ +  +AD+L  + +     V+     I E W+KL        + L     +++ L   + +  W++E    L   + GK +  V   L +H+ +  D+  +E    ++ D ++ L      R       +  KE ++++ +  L   + +R+  L+       ++ D  +   W  E+ + F S +   D+ S   LI++ E+   ++  R     ++ D +     N    SPQ  + + + +  +      L  +   R ++L+Q  D    + ++                          E+ LK+HE+ +  +   E+ +  L      +     Q  D      E + N  +++ + A+ R+  LL ++   +   + +    WI  KEK  +    S ++   L     R   FE ++  +   +   N+  +DLI  +H   + + +K   LN  W N +AD  E+  K LQ A    Q     ++ + W+ +   +L   +D   DL G+  L ++   L+ D++     +  +  +A +L      +  TI S+   +   +  L  +   R + L  +  L +F  D++    W+++   Q ++ D+   L   +R    HL  + E+   +     +L  G+ +    +S  D       ER   L+N W+ L  M   +   LH+S  +Q ++ ++ + D  +  +    +  +   +  + +      +A +  VA+    ID +      L+ S+   S+KI +    +  +   +   +  R++ L +   L E+  +V  +  ++SE++  A+   Y  D + +     RF DF+R + +  E+   V      L+ E
Sbjct:  592 LDAIQTVRQKLERFATEIATKCSRVSDINQLADELIQDGHAHSAAVKAKRKEINERWEKLQRLKVKEEENLAEKHGVELFLDVCEEMRSWIQEKDAALCKEELGKDIETVRAQLRRHQGIERDLAAVEDKVAKLQDQAKSLVV----RHPRQARQIKAKEGEVISLWAILKSKANKRKGLLDEAYGQQGFLADARDLMSWSAELKESFISAEDPQDIASASELIQQHEEKFDEIQTR----FERFDQLDEYGRNLLATSPQAVQ-VKQSMAALKAEKAALSSSWAKRNDRLHQGLDLQSSVDEV--------------------------EWLLKKHEDFVKTLTAQEEKVRSLADMAKTIIHARHQARDWVASRAESVINRRDNVKNQASDRQKALLTSQVLQNFIRDADEFGGWI--KEKSQIAEDESFKDPKNLQGNLKRHKAFEAEITANKDGIDRINKAGKDLIRTKHFGAQKVKDKLKGLNEAWLNLVADTTEKGNK-LQQAERQRQLNRAMEDVRIWMNETEAVL-GLEDTGRDLAGVKFLTKKHQLLESDIEMHATVIVDVADKAQELVSQGHFNSDTIKSDSENLQSRYRSLLCLTDKRRSVLEDAFALHQFIYDIEVEMTWVREHLQQASSGDLGTSLISVQRLQKRHLAFENELTNHQTRIDTVLSSGQDLIDSCYSATDK----VEERCEELQNLWDELVDMAAQRKQRLHDSFLSQKYLSEANEADSWMNDKAGLAASQDYGKDGASAETLLTRHKALQVDVAAFSTTIDELAEEARRLVQSSHFDSEKISSTQRDLEEQFCGLNTLVKTRHTRLTESKKLHEYRREVEEISAYVSEQLQTAASEDYGTDFEHLQVIQGRFGDFQRSVASYAENFRNVDNLAKMLVSE 1449          

HSP 6 Score: 75.485 bits (184), Expect = 3.571e-13
Identity = 115/512 (22.46%), Postives = 226/512 (44.14%), Query Frame = 2
Query: 1178 SEHRMELRLYEEL-----IRQQKLE-QLGNH--FNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGH-DLRSVERLIRK---FEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSH-------DFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFE 2656
            ++ +M L L+EEL      R +KL+  L  H  +++  +M   W+ E   LV    +G D  +    ++KH+AL+ ++ A+E +I  L  I  +L      + +++E     + E +  L D  + R  +L     +   L+E D L  W+ E    + S D G+ L  VE L++K ++   D+ +   RI   +   Q    D    D + ++ + + +   +  L   +  R +EL+  + +  +   ++    WI+E I      ++G  DLR V+ L RK   F++ L  +  + DL++   D +  K    P+ + + I+ ++  E+ +    L Q   ++++ L QS        D+  L++ IE   A + EE      +DV   ++  +    + + +   VEE +    +L G  N          D       +++ ++ L     TR   L +NK+        + +E W+ A+E  L++    + L+ +  +  + D FE
Sbjct: 2624 AKSQMLLELWEELRINAQTRNEKLQASLATHQYYDQVFEMDA-WVSEKLSLVSSTDYGRDETSAETLLRKHDALQLELDANESKIRDLRSIYSELSDAGDTEFSKLEKIQDELEERYTHLRDVARDRHRRLLDSSRLFNFLREADELGAWVEEKEAIVSSDDCGRDLEHVEMLMQKFEVFTRDLVSSGERIAKLTEHAQML-LDDEHTDSEMIEQRAEVICERWDGLKERTSTRLEELDRARDLHAFRRSVDEIHAWIQEKIDALGVAENGAPDLRHVQALQRKHQGFQRDLQALGEKVDLVLRDADDLSAKV---PAHKHELIMEKQ--EVQKAWKKLQQLASSKQSHLLQSEGLQAFLDDYRDLMSWIETTSAQVAEETLGSTFADVETLIAQNQELQTEIDSRANSVEEFQSRADQLLGSGNP------SAEDIRNKSSHVRDTWDRLGASLRTRTQQLQHNKEIQRFKREADQLEAWLNAREHDLLSEDVGDSLEAVEELLKKQDEFE 3122          

HSP 7 Score: 63.5438 bits (153), Expect = 1.546e-9
Identity = 75/341 (21.99%), Postives = 138/341 (40.47%), Query Frame = 2
Query: 2729 HPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSEL--------------------PNNYEATKATEREFEAFKNSVASNKPKIDAV--VNFGESLLAS 3685
            H + + ++ +Q  ++  +N+L + +E ++  LQ A+ Y  F  E ++   W+ +K    +   +  +   G ++L  R     R ++A E +V  L                            W  LK     R   L+ +   Q F  D      W  +++    + + P+D+  A      H E  +EI      + +L ++GR +  +   PQ +   + +  L+ E  AL   W  ++  LH+  D QTFIRD+  +D +   QE+FL+K +L                    P N +      + FEA    + +NK  ID +  + FG +L+  
Sbjct:  139 HFDRDNVAVRQITISNTYNRLIETSEMRRLSLQKAIKYYHFCHECEDMDLWMSNKTLAPKTCSEEVEVETGEVELVVRHPRQARQIKAKEGEVIGL----------------------------WAGLKSKANKRKGLLDEAYGQQGFLVDARDLMSWSAELKESFISAEDPQDIASASELIQQHEEKFDEIQTRFERFDQLDEYGRNLLATS--PQAVQVKQSMAALKAEKAALSSSWAKRNDRLHQGLDLQTFIRDAEHVDAVTASQETFLAKEDLGFGGWIKEKSQIAEDESFKDPKNLQGNLKRHKAFEA---EITANKDGIDRINKLRFGSTLVVG 446          
BLAST of Spectrin beta chain vs. Ensembl Medaka
Match: sptbn1 (spectrin beta chain, non-erythrocytic 1-like [Source:NCBI gene;Acc:101164035])

HSP 1 Score: 1348.95 bits (3490), Expect = 0.000e+0
Identity = 830/2337 (35.52%), Postives = 1330/2337 (56.91%), Query Frame = 2
Query:  101 SRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTS---RKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLI---RKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKN---DFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLL-VTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQ--------LSEDIIVP---LQSRSVQSAVAIDDSAE---APPKQEVKEKSKENPKLIETKSTTEP--KTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPTL---------GRKQK*ISTF 6991
             R K L ++REAVQKKTFTKWVNSHL  S+    + DL++DL+DG+ L+KLLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  R++K++LLLWCQMKTAGY NVNI+NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI VD P+EKS++TYV +     +++K+ + + KR+G V++ AI  E LI  YE L+  LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y+P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+ A+  ++ +L+ E Y+ I  +      ++ +W+ LL+ L+ RR +L+    +Q + QE  Y+MDWM E+ + L S+D+GKHLLGVE+LL+KH ++ +DI     R+   S    K    D      D   +  +   L   YQEL  L+ +R   L   + +W++  ++  ++ WI+E  Q+  S + G DL    RL+   R  E  +S         + +  ++V    N       +I+ R I ++      L+Q     R +L ++   HQ  AD +D DA  L+  R+  + + G     T+  +++H++   +V     +I  L  +   L      + +A+    R+      ++++ +L   RK  L +   +  +FS     + WI  KE+ L  T +P E+L++L V++HRFD  E +M   + +V+  NQI R L++   P  + I  +Q+ LN  W    DL + KK+ L  A+    + L+  ET+SWI++K K++E T +L +DL G++ LQR+L  ++RD+ AIE K+  L  EA +L    P     I   +  +  +WEE+K  L+ R+  L  + +LQ+F +DLD F  WL + Q  VA++D+P  L EAE+    H  +K EIL +E +Y ++   G  V+  + D QY+   +RL  L+  WN L KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +E+P   E  +A  ++ E F  ++ +N+ KI+ V+  G  L +  N  ++KI+ K   I  R    ++        L+D+  L +F  +   L  W+SEKM+ A D +Y + +++ +++ + + F  EL++N+E ++++ + G  L+ EKP  E  ++ K+  L + W EL +T   K++ L +AN+  +F ++   +  W+       +  +   E+YG  L  +N  +K Q+  + Q++ +++ + +++   + L ++  +  DE +  +Q V+ K  E+  PL  RRN+L+  +   QF RDVEDE  W +E++   T        LQ     +++ +T   E+  H  RI D+    + ++R+    ++  +  L EL +LWD L           +E  + Q+Y  +A E E WMSE+E  +M E+KAKDE  A+  ++KH+ +   + +Y  +V +L+     ++  + P S  +  +Q +VDK+YA L ++  E++ K+E+ ++ + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   + + D+LI  GH ++  +A WKD +NEAWADLLELI+TR Q+L A+++  KF  D  E+L  I +K + +PE +G+D  +V T QR H +F  +++ L   +      A +L   Y G+K  +I  +  E+ + W  L +  ++R + L+D  + ++F++MVR+L+ WM ++   I A +  RDV  VEL+++NH+ +KAEID+R+++ S C+ LG+ L+ RKH  A ++++K  ++  K   +++ W +R E+L +ILEV+QF+R+A VAEAWL+ QE  L++ + G +++E   L+++H   E++ A   +RF                +A ++   L+  E R +    E    PP+PE + + E  ++        L  D   P   L+   + + +    S E   AP     K+        +  KS   P    G L RKHEWE   KKA NR W+ +Y V+ + +MS +K+ K          Y ++ P+ L  A    A++YKK+  VF++R+ +G EYLF+A D+ EM+ W++ I          A  S L + +S F  P T  S   +  P           G+K+K  S F
Sbjct:   14 GRFKQLQDEREAVQKKTFTKWVNSHL--SRVSCRITDLYLDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKERRSAKDALLLWCQMKTAGYPNVNIQNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTRLLDPEDISVDHPDEKSVITYVVTYYHYFSKMKALKVEGKRIGKVLDNAIETENLIEKYESLASALLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYMPREGKLISDINKAWERLEKAEHERELALRMELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGLDLQAVEAATKKHEAIETDIAAYEERVQAVVAVSKELELECYHDIKRIAARKDNVLRLWEYLLELLKARRQRLEMNLGLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRAVSCNANKYSVTDGGYKPCDPRVIQDRVAHLEFCYQELTQLAAERRARLEDSRRLWKFFWEMAEEEGWIREKEQILSSLEQGRDLTGAVRLLSQQRALEDEMSGRAGHLQHTITEGRAMVQVGHNGSD----KILER-IGDLQAQWAELEQHAAVTRRRLEEALALHQFQADADDVDAWTLDALRIVSSGETGHNEFSTQALVRKHKDAAAEVASYRPVIDSLHEQAATLP-----KEEAESVRGRLAGIEERYKEVAELTKLRKEALQDALARHKMFSEANACQVWIEEKEQWLNATEIP-EKLEDLEVVQHRFDSLEPEMNNQASRVAVVNQIGRQLMHAGSPS-DDIKAQQDKLNNRWGLFRDLLDLKKESLNSALGVQNYHLDCNETKSWIKEKTKVIESTQELGNDLMGVLALQRKLTGMERDLVAIEDKLGDLRGEAQRLAEEHPDQAKAITGRLAEITAVWEEMKNTLKRREESLGEARKLQQFLRDLDDFQSWLSRTQTAVASEDMPNTLAEAEKLMAQHDGIKNEILNYEEDYQKMRDMGDMVTRGQTDAQYMFLQQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHAEMPPTLEGAEAAIKKQEDFMTTMDANEDKINGVMEAGRRLASDGNINAEKIKEKVASIDDRHKKNREAAVELLMRLKDNRDLQKFLQECQELSLWISEKMLTAQDMTYDEARNLHSKWLKHQAFMAELQSNKEWLNKIEKDGTLLVSEKPETEVVVKEKLTALHSMWEELESTTQTKAQCLFDANKTELFTQSCTDLDKWL-----GGLEGQIQSEDYGKDLTSVNILLKKQQMLENQVEVRQREVVELQSQVKALGQEAKD-TDEVDGRRQGVEKKFQELLEPLRHRRNLLVASREGHQFNRDVEDEILWAQERMPVATSTDHG-HNLQTVQLLMKKNQTLEKELQGHQPRIDDILERSQSLLRDQTSGTEGIHRRLAELQELWDRLREEGRRRHARLQEAHKAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAITMLKKHQIMEQAVEDYAEVVHQLSKTSRGLVANEHPESERIGMRQSQVDKLYAGLKDLSEERRGKLEERLRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDGVNHLADELINAGHGDAATVAEWKDGLNEAWADLLELIDTRTQILAASFELHKFYHDGKEILARIADKQKKLPEEMGRDQNTVETLQRMHTSFERDVQALGAQVRQLQEDAVRLQSSYAGDKADDIQRKDGEVLEAWRILLEACDSRRSRLLDTGERFRFFSMVRDLLLWMDDVIRLIEAQENPRDVSSVELLMNNHQGIKAEIDARNDSFSTCVELGKALLARKHYAAAEIKEKLLQLTDKRKEMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGQEPYLSSREVGQSVDEVEKLIKRHEAFEKSAATWEERF----------------SALERLTTLELLEVRRQQEEMERRRRPPSPEQLHQEEVQQEKSVVMQNGLPSDEDSPWTGLEGGGLVNGLVERSSMEPSPAPSPTMTKKNKHSQSSTLPLKSQDSPVQMEGLLHRKHEWEGHNKKASNRSWHNVYCVVCHQEMSFFKDSKAAAQGA---AYHNQPPVSLKDATCDVASDYKKKKYVFKLRVADGNEYLFQAKDEEEMSSWIQVILN--------AAASELTDTQSSF--PGTPVSGRAQTLPATITLTTESSPGKKEKRFSLF 2300          
BLAST of Spectrin beta chain vs. Ensembl Medaka
Match: SPTBN1 (spectrin beta chain, non-erythrocytic 1 [Source:NCBI gene;Acc:101159770])

HSP 1 Score: 1341.25 bits (3470), Expect = 0.000e+0
Identity = 777/2079 (37.37%), Postives = 1248/2079 (60.03%), Query Frame = 2
Query:   56 DVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNN--------YQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLI---RKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMK-LLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLE-------FSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTS 6223
            D  +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL  S+    + DL++DL+DG+ L+KLLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVNI NFT+SW+DG+AFNAL+HKHRP+++D+  L K+N   NL  AF  AE+  G+ +LLD  DI VD P+EKSI+TYV +     +++K+ + + KR+G V++ AI  EK+I  YE L+ +LLEWI+  I  + N K   SL GV++QL  F+ YR  EKPPKF ++G LE+  F IQSK+RA+N+K+Y P EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLEQL   F+RKA MR+ WL EN  LV Q  FG DL  + AA KKHEA+E DI A+EER+ A+  +A +L++E+Y+ I  +      +  +W+ LL+ L+ RR +L++   +Q + QE  Y+MDWM E+ + L S+D+GKHLLGVE+LL+KH ++ +DI     R+ + +   Q     R A D +     + Q++ +        YQELI L+ +R   L   + +W++  ++  ++ WI+E  Q+  S D G DL    RL+   + FE  +S         + + + +V    N     +   I   I +I E    L++    R+++L ++ + HQ  AD +D D  +L+  R+  + DVG     T+  +K+H++   +++    +I  L  +   L  +     +       ++  ++++ +L   RK  L +    + + S     E WI  KE+ L ++   E+L++L V++HRF+  E +M   + +V+  NQ++R LI+  HP  + I  +Q+ LN  W+Q  DL +QKK+ L  A+    + LE  ET+SWI++K K L+E T +L +DL G+M LQR+L  ++RD+ AIE K+  L KEA++L    P     I   +  +  +W+E+K  L++R+  L  +++LQ+F +DLD F  WL + Q  +A++D+P  L EAE+    H  +K EI  +E +Y ++   G  V+  + D Q++   +RL  L+  WN L KMW+++   L +S   Q F+RD+ Q +  L  QE  L+ +E+P   EA +A  ++ E F  ++ +N+ KI  VV+ G  L+A   +S       E+I  + D+I  +  +   A  D L+ L+       F  D   L  W++EKM+ A D +Y + +++ +++ + + F  EL++N+E +D++ + G  L+ EKP  E  ++ K+  L+  W EL +T   K+K L +AN+  +F ++   +  W+  +  Q+ + +     +G  L  +N  +K Q+  + Q++ ++K + +++  ++ L+++  +  DE +  +  V+ K   ++ PL  RR+ L+  + + QF RDVEDE  W+ E++   T        LQ     I++ +T   EI  H  R  D+    + ++R   P+++     L EL  LW+ +    E       E  E Q+Y  +A E E WMSE+E  +M E+KAKDE  A+  ++KH+ L   + +Y   V +L+     ++    P S  +  +Q +VDK+YA L ++  E++ K+++  + + L R +  LE+WIAER  VA S+E+G + EH  +L+ERF EFA  T  +G  RV   + + D+LI  GH ++  IA WKD +NEAWADLLELI+TR Q+L A+Y+  KF  D+ E+L+ I +K + +PE +G+D  +V   QR H AF  +I+ L   +      A +L   Y G+K  +I  R+ E+ + W +L    E R   L+D  D ++F++MVR+L+ WM ++   I A +K RDV  VEL+++NH+ +KAEID+R+++ + CI LG+ L+ RKH  + ++++K  ++  K   +++ W +R E+L ++LEV+QF+R+A VAEAWL+ QE  L++ + G +++E   L+++H   E++ A   +RF  L++LT+
Sbjct:   28 DDWDNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--SRVSCRITDLYMDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLIDFDKLKKSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSIITYVVTYYHYFSKMKALKVEGKRIGKVLDHAIETEKMIEKYESLASDLLEWIEQTIIILNNRKFANSLVGVQQQLQAFNTYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYTPREGKLISDINKAWERLEKAEHERELALRTELIRQEKLEQLARRFDRKAAMRETWLSENQRLVSQDNFGFDLQAVEAATKKHEAIETDIAAYEERVQAVVSVAKELEAESYHDIKRITARKDNVNRLWEYLLELLKARRHRLEQNLGLQRVFQEMLYIMDWMDEMKMLLLSQDYGKHLLGVEDLLQKHALVEADIAIQADRVRNVNSNAQ-----RFASDTEGYKPCDPQIIRDRVAHLEFCYQELIQLAAERRARLEESRRLWKFFWEMAEEEGWIREKEQILSSEDYGKDLTGALRLLSQHKAFEDEMSGRAAHLQQTIKQGEDLV--ADNHFGADK---IRERIRDIQEQWATLERLTAVRKSRLQEACNHHQFQADADDIDTWMLDVLRIVSSVDVGHDEFSTQALVKKHKDVAEEIDSYRPVIEALHDQSRTLPPEKANSEEVKSRLAGIEERYKEVAELTRLRKQALQDALALYKMLSEASACELWIDEKEQWLNSMDIPEKLEDLEVVQHRFESLEPEMNSQASRVAVVNQVARQLIHCGHPSEKEIKAQQDKLNTRWSQFRDLVDQKKESLVSALGVQNYHLECNETKSWIKEKNKVLIESTQELGNDLAGVMALQRKLTGMERDLVAIEDKMGDLGKEAERLASEHPEQSEAIKGRLAEITGVWQEMKDGLKNREESLGEASKLQQFLRDLDDFQSWLSRTQTAIASEDMPNTLAEAEKLLAQHENIKNEIRNYEEDYQKMRDMGEMVTQGQTDAQHMFLRQRLQALDTGWNELHKMWENRQNLLSQSHAYQLFLRDTKQAEAFLNNQEYVLAHTEMPTTLEAAEAAIKKQEDFMTTMDANEEKISNVVDTGRRLVADGNVS------SERIQEKVDSIDQRHKKNRQAASDLLMRLKDNRDLQKFLQDCQELNLWINEKMLTAQDMTYDEARNLHSKWLKHQAFMAELQSNKEWLDKISKDGQTLMTEKPETEGVVKEKLASLKTMWEELESTTQTKAKCLFDANKAELFTQSCADLDKWLNGLEGQLQSDD-----FGKDLTSVNILLKKQQMLESQVEVRQKEVDELKGQSQALRQEGKD-SDEVDGQRIIVEKKFQTLQEPLKKRRDKLMASREIHQFNRDVEDEILWVEERMPLATSTDHG-HNLQTVQLLIKKNQTLQKEIQGHQPRYDDIFERSQHVLREGSPTAELIRQRLAELQSLWEQIKKETEKRHTRLSEAHEAQQYYFDAAEAEAWMSEQELYMMSEEKAKDEQSAVAMLKKHQILEQAVEDYADTVHQLSSTSRGLVAAGHPDSERIGMRQSQVDKLYAGLKDLSEERRGKLDERFRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTMLQERFREFARDTGNIGQERVDGVNRLADELINSGHGDAATIAEWKDGLNEAWADLLELIDTRTQILAASYELHKFYHDAKEVLNRILDKHKKLPEELGRDQNTVEALQRMHTAFEHDIQALGTQVRQLQDDAVRLQSAYAGDKADDIQKREGEVLEAWKNLLAAVEGRRAKLVDTGDKFRFFSMVRDLMLWMEDVIRLIEAQEKPRDVSSVELLMNNHQGIKAEIDARNDSFTTCIELGKALLARKHYASEEIKEKLLQLTDKRKEMIDKWEDRWEWLRLVLEVHQFSRDAGVAEAWLLGQEPYLSSREIGQSVDEVEKLIKRHEAFEKSAATWEERFSALERLTT 2081          
BLAST of Spectrin beta chain vs. Ensembl Medaka
Match: sptbn2 (spectrin beta chain, non-erythrocytic 1 [Source:NCBI gene;Acc:101155789])

HSP 1 Score: 1321.22 bits (3418), Expect = 0.000e+0
Identity = 818/2306 (35.47%), Postives = 1310/2306 (56.81%), Query Frame = 2
Query:   65 ENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDY-------VDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTS--NDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERG-DEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPV-----RKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEI--------GGVDTSLAKYSTLPNI 6898
            +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL  S+    + DL+ DL+DG+ L++LLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVNI NFT+SW+DGLAFNA++HKHRP+V+++  L ++N   NL  AF  AE+E G+ +LLD  D+ VDQP+EKSI+TYV +     +++K+   + KR+G V++ AI A++LI+ YE L+ ELL+WI+  I  + + +L  SL  V+ QL  F++YR  EKPPKF ++G LE+  F IQSK+RA+N+K+YVP EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLE L   F+RKA MR+ WL EN  LV Q  FG DL  + AA +KHEA+E DI A+ ER+ A+  +A +L++E Y+ +  +      ++ +W+ L + L  RR++L   RD+Q + QE  Y+ DWM++   RLQS+D GKHL  V +LL+KH ++ +DI     RI    + +Q A    ++ +Q Y       V  K ++L   Y+EL  L+  R + L   + +W+++ D+  +  WI+E  Q+  S D G DL S   L+ K E    ++  R    +   +SI    +  N+      E+  R I +I     +L++    R   L ++   HQ   D  D +A I+E  R   + ++G     T+   ++  E   +++    LI  L  +   L          D     ++  +++L  L+ TR+  L      + +FS  +    W+  KE+ L  +    +L++L V++ RF+  E +M     +V+  N ++  L++  +   + I + ++ LN  W +   LA QKK+ L+ A++   + LE  E +SW+++K K++E T  L +DL G+M LQR+L  ++RD++AI+ K+  L  EA KL    P     I   +  + E+WEEL   ++ R+  L  +++LQ F +DL+ F  WL + Q  VA++DIP  L EAE   T H  +K E+  ++ +Y ++   G +V+  + D Q++   +RL  L+  W+ L +MW+++   L +  D Q F+RD+ Q +  L  QE  L  +E+P N +A +   R+ E F  +  +++ KI++VV+ G  L+  SNA SDKI+ K + I  R +  ++      + L+D+  L  F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N++ +D++ ++G  L+ EKP  +  ++  + +L++QW E+  T   K++ L +ANR  +F ++  ++ SW+       I ++   ++YG  L  +N  +K Q+  + Q++ + K +  ++  A  L ++  + G  E +  Q++V    + ++ PL  R+  LL  K   QF RD+EDE  W+ E++   T  +   +   V L  I++ +T   EI  H  RI D+   GE   + D          L EL  LWD LI+  ++      E R  Q++ ++A E E WM E+E  +M E+KAKDE  AL  ++KH+ L   + +Y   + +LA+    ++  + P S  +  +Q +VDK+YA L ++  E++ ++++ ++   L R +  LE+WIAER  VA S+E+G + EH  +LR++F EFA  T+ +G  RV   + + D LI  GH E+  +A WKD +NEAWADLLELI+TR Q+L A+Y+  +F  D+ E+L  + EK   +P  +G+D  +V    R+H     +I+ L   ++     A +L   Y GEK  +I   +  +   W +LQ+  ++R   L D  + ++F   VR+L+ WM  + +QI+A D  RDV   EL+I NH+ +K+EID+R ++ +  I +G  LIN+ H  A+++++K  ++  +   I + W+++  +L+++LEV QF R+A+VAE+WL  QE  +   + G  ++E  +LL++H   E+      +RF  L++LT+ EE +                        E    PPTP  V      K ET    SE      +S SV       DS  A  + E    S   P      S  E   G L RK E E+  KKA  R W+ +Y  ++   +  +K+ K         TY  E P  L  A+   A +YKKR +VF++R +NG EYLF+A D+AEMN W++ I            G   +L++  T+P I
Sbjct:   34 DNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--SRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGLAFNAIVHKHRPDVIEFDNLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIDKYETLASELLQWIEQTIGTLNDRQLANSLNAVQNQLQAFNSYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYVPKEGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGTDLGAVEAATRKHEAIETDINAYLERVVAVEDVAKELEAEGYHDVRRILARRDNVLRLWEYLKELLAARRERLTAHRDLQRLFQEMRYITDWMKDEQGRLQSQDTGKHLHDVLDLLQKHNLVEADISAQAERI----KGVQAAAKPFSSYEQAYKPCEPGLVGEKVERLGQAYEELGQLASARRERLEDSRRLWQFLWDLGEEAAWIREQEQILASGDCGRDLTSALHLLSKHEAFRDEMAAR---FMPLNNSIAAGEALINEGHFGASEVTER-IQDIRAQWAHLEEL---REQSLKEAVALHQFQTDANDMEAWIMETLRQLSSQELGHDEFSTQTLARKQREIDEEIQSHRPLINTLHEQAQALPQAYVSHPQVDGRLPAIEQSYKELESLSATRRQALDGALSLYQMFSEADACLLWVEEKEQWLDGMEIPTKLEDLEVVQQRFESLEPEMNNLGARVTHVNDVAEFLLDSDNCRKDQIHQTRDQLNNRWAEFEQLAGQKKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLKSEAGKLASEHPDQAEEIQGRLAEIQEVWEELNATMKRREESLGEASKLQGFLRDLNDFQSWLSRTQTAVASEDIPTSLPEAENLLTQHESIKNELDNYKEDYEKMRAVGEEVTQGQTDAQHMFLAQRLQALDTGWHELRRMWENRHSLLAQGFDFQGFMRDAKQAEAFLNSQEYVLHHTEMPTNLQAAEEAIRKHEDFLTTTEASEEKINSVVDSGRRLINDSNANSDKIQEKVDSIQERHNKNKEMAKELLTKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQALVAEKPELKPVVQQILEDLQHQWEEVEGTTRTKAQCLFDANRAELFTQSCSALGSWL-----NNIESQLHSDDYGKDLTSVNILLKKQQMLEHQMEVREKEVQSLQAQALALSQE--DAGLTEIDGQQRQVTDNFSNLQQPLRLRKQKLLASKEAHQFNRDLEDEILWVTERMPLATSTEHGKDLSTVQL-LIKKNQTLQKEIQGHQPRIDDILKRGETQSQVDGERQALLEERLAELRDLWDQLISETDNRNTRLLEARRAQQFYADAAEAEAWMGEQELHMMSEEKAKDEQSALVMVKKHQILEQTLEDYAQTIHQLANSSRLMVTNEHPESERITLRQAQVDKLYAGLKDLAEERRGRLQERLRLTQLKREVDDLEQWIAEREMVAGSHELGQDYEHVSMLRDKFREFARDTSTIGQERVDGVNALADDLIESGHPENASVAEWKDGLNEAWADLLELIDTRTQMLGASYELHRFHQDAMEVLGRVKEKREALPADLGRDLNTVKHLHRQHQTLENDIQALSWQVNQVQDDAARLQKAYAGEKADDIHRSEHAVSSAWEALQEACQSRRLLLQDTVEKFRFLNAVRDLMLWMDGVNLQIDAHDSPRDVSSAELVIGNHQDIKSEIDTRADSFTASIDMGNALINKSHYAADEIQEKLAQLQERRDEINKKWQDKMNYLQIVLEVLQFGRDASVAESWLAGQEPLVRAAELGTNVDEVESLLKRHEAFEKLATAWEERFVQLERLTTLEEQELQRRR----------------EEEERARRPPTPPQVEEVTQSKAETQAHDSEGS----ESESVNGPGR--DSGLASSRLEA---SATLPGRGGADSDAECVEGMLCRKQEMESHNKKAATRSWHNVYCTLKKGGLHFFKDNKSVSSGI---TYHGEMPFSLEEAVCEVALDYKKRKHVFKLRNENGKEYLFQAKDEAEMNSWIQSIRRFITTRSQDSPGAPRALSRAMTMPPI 2290          
BLAST of Spectrin beta chain vs. Ensembl Medaka
Match: sptbn2 (spectrin beta chain, non-erythrocytic 1 [Source:NCBI gene;Acc:101155789])

HSP 1 Score: 1316.21 bits (3405), Expect = 0.000e+0
Identity = 818/2349 (34.82%), Postives = 1318/2349 (56.11%), Query Frame = 2
Query:   65 ENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDY-------VDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTS--NDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERG-DEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIK----------QLSEDIIVPLQSRSVQSAVAIDDSA-----------EAPPKQEVKEKSKEN---------------------------PKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEI--------GGVDTSLAKYSTLPNI 6898
            +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL  S+    + DL+ DL+DG+ L++LLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVNI NFT+SW+DGLAFNA++HKHRP+V+++  L ++N   NL  AF  AE+E G+ +LLD  D+ VDQP+EKSI+TYV +     +++K+   + KR+G V++ AI A++LI+ YE L+ ELL+WI+  I  + + +L  SL  V+ QL  F++YR  EKPPKF ++G LE+  F IQSK+RA+N+K+YVP EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLE L   F+RKA MR+ WL EN  LV Q  FG DL  + AA +KHEA+E DI A+ ER+ A+  +A +L++E Y+ +  +      ++ +W+ L + L  RR++L   RD+Q + QE  Y+ DWM++   RLQS+D GKHL  V +LL+KH ++ +DI     RI    + +Q A    ++ +Q Y       V  K ++L   Y+EL  L+  R + L   + +W+++ D+  +  WI+E  Q+  S D G DL S   L+ K E    ++  R    +   +SI    +  N+      E+  R I +I     +L++  + R   L ++   HQ   D  D +A I+E  R   + ++G     T+   ++  E   +++    LI  L  +   L          D     ++  +++L  L+ TR+  L      + +FS  +    W+  KE+ L  +    +L++L V++ RF+  E +M     +V+  N ++  L++  +   + I + ++ LN  W +   LA QKK+ L+ A++   + LE  E +SW+++K K++E T  L +DL G+M LQR+L  ++RD++AI+ K+  L  EA KL    P     I   +  + E+WEEL   ++ R+  L  +++LQ F +DL+ F  WL + Q  VA++DIP  L EAE   T H  +K E+  ++ +Y ++   G +V+  + D Q++   +RL  L+  W+ L +MW+++   L +  D Q F+RD+ Q +  L  QE  L  +E+P N +A +   R+ E F  +  +++ KI++VV+ G  L+  SNA SDKI+ K + I  R +  ++      + L+D+  L  F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N++ +D++ ++G  L+ EKP  +  ++  + +L++QW E+  T   K++ L +ANR  +F ++  ++ SW+       I ++   ++YG  L  +N  +K Q+  + Q++ + K +  ++  A  L ++  + G  E +  Q++V    + ++ PL  R+  LL  K   QF RD+EDE  W+ E++   T  +   +   V L  I++ +T   EI  H  RI D+   GE   + D          L EL  LWD LI+  ++      E R  Q++ ++A E E WM E+E  +M E+KAKDE  AL  ++KH+ L   + +Y   + +LA+    ++  + P S  +  +Q +VDK+YA L ++  E++ ++++ ++   L R +  LE+WIAER  VA S+E+G + EH  +LR++F EFA  T+ +G  RV   + + D LI  GH E+  +A WKD +NEAWADLLELI+TR Q+L A+Y+  +F  D+ E+L  + EK   +P  +G+D  +V    R+H     +I+ L   ++     A +L   Y GEK  +I   +  +   W +LQ+  ++R   L D  + ++F   VR+L+ WM  + +QI+A D  RDV   EL+I NH+ +K+EID+R ++ +  I +G  LIN+ H  A+++++K  ++  +   I + W+++  +L+++LEV QF R+A+VAE+WL  QE  +   + G  ++E  +LL++H   E+      +RF  L++LT+ EE +                        E    PPTP  V +V   K          + S D     Q  SV    + +D++           ++ PK+  K K  E                            P      S  E   G L RK E E+  KKA  R W+ +Y  ++   +  +K+ K         TY  E P  L  A+   A +YKKR +VF++R +NG EYLF+A D+AEMN W++ I            G   +L++  T+P I
Sbjct:   34 DNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--SRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGLAFNAIVHKHRPDVIEFDNLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIDKYETLASELLQWIEQTIGTLNDRQLANSLNAVQNQLQAFNSYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYVPKEGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGTDLGAVEAATRKHEAIETDINAYLERVVAVEDVAKELEAEGYHDVRRILARRDNVLRLWEYLKELLAARRERLTAHRDLQRLFQEMRYITDWMKDEQGRLQSQDTGKHLHDVLDLLQKHNLVEADISAQAERI----KGVQAAAKPFSSYEQAYKPCEPGLVGEKVERLGQAYEELGQLASARRERLEDSRRLWQFLWDLGEEAAWIREQEQILASGDCGRDLTSALHLLSKHEAFRDEMAAR---FMPLNNSIAAGEALINEGHFGASEVTER-IQDIRAQWAHLEETTKLREQSLKEAVALHQFQTDANDMEAWIMETLRQLSSQELGHDEFSTQTLARKQREIDEEIQSHRPLINTLHEQAQALPQAYVSHPQVDGRLPAIEQSYKELESLSATRRQALDGALSLYQMFSEADACLLWVEEKEQWLDGMEIPTKLEDLEVVQQRFESLEPEMNNLGARVTHVNDVAEFLLDSDNCRKDQIHQTRDQLNNRWAEFEQLAGQKKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLKSEAGKLASEHPDQAEEIQGRLAEIQEVWEELNATMKRREESLGEASKLQGFLRDLNDFQSWLSRTQTAVASEDIPTSLPEAENLLTQHESIKNELDNYKEDYEKMRAVGEEVTQGQTDAQHMFLAQRLQALDTGWHELRRMWENRHSLLAQGFDFQGFMRDAKQAEAFLNSQEYVLHHTEMPTNLQAAEEAIRKHEDFLTTTEASEEKINSVVDSGRRLINDSNANSDKIQEKVDSIQERHNKNKEMAKELLTKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQALVAEKPELKPVVQQILEDLQHQWEEVEGTTRTKAQCLFDANRAELFTQSCSALGSWL-----NNIESQLHSDDYGKDLTSVNILLKKQQMLEHQMEVREKEVQSLQAQALALSQE--DAGLTEIDGQQRQVTDNFSNLQQPLRLRKQKLLASKEAHQFNRDLEDEILWVTERMPLATSTEHGKDLSTVQL-LIKKNQTLQKEIQGHQPRIDDILKRGETQSQVDGERQALLEERLAELRDLWDQLISETDNRNTRLLEARRAQQFYADAAEAEAWMGEQELHMMSEEKAKDEQSALVMVKKHQILEQTLEDYAQTIHQLANSSRLMVTNEHPESERITLRQAQVDKLYAGLKDLAEERRGRLQERLRLTQLKREVDDLEQWIAEREMVAGSHELGQDYEHVSMLRDKFREFARDTSTIGQERVDGVNALADDLIESGHPENASVAEWKDGLNEAWADLLELIDTRTQMLGASYELHRFHQDAMEVLGRVKEKREALPADLGRDLNTVKHLHRQHQTLENDIQALSWQVNQVQDDAARLQKAYAGEKADDIHRSEHAVSSAWEALQEACQSRRLLLQDTVEKFRFLNAVRDLMLWMDGVNLQIDAHDSPRDVSSAELVIGNHQDIKSEIDTRADSFTASIDMGNALINKSHYAADEIQEKLAQLQERRDEINKKWQDKMNYLQIVLEVLQFGRDASVAESWLAGQEPLVRAAELGTNVDEVESLLKRHEAFEKLATAWEERFVQLERLTTLEEQELQRRR----------------EEEERARRPPTPPQVEEVTQSKAETQAHDSEARTSLDQTTLNQDVSVNGVHSDNDTSQSLSLSLSVGKKSEPKRVFKPKQPERGSESESVNGPGRDSGLASSRLEASATLPGRGGADSDAECVEGMLCRKQEMESHNKKAATRSWHNVYCTLKKGGLHFFKDNKSVSSGI---TYHGEMPFSLEEAVCEVALDYKKRKHVFKLRNENGKEYLFQAKDEAEMNSWIQSIRRFITTRSQDSPGAPRALSRAMTMPPI 2345          
BLAST of Spectrin beta chain vs. Ensembl Medaka
Match: sptbn2 (spectrin beta chain, non-erythrocytic 1 [Source:NCBI gene;Acc:101155789])

HSP 1 Score: 1309.28 bits (3387), Expect = 0.000e+0
Identity = 816/2355 (34.65%), Postives = 1315/2355 (55.84%), Query Frame = 2
Query:   65 ENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGK--RTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDY-------VDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTS--NDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYG--LVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERG-DEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIK----------QLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVK-------------EKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQ-------------------------------AEMNQWVEKINEI--------GGVDTSLAKYSTLPNI 6898
            +N+N+SA L+ERSRIKAL+++REAVQKKTFTKWVNSHL  S+    + DL+ DL+DG+ L++LLE+LSGE++P  TKG++RIHC+ENV K++ FL +Q V  EN+G+HDIVDGN  L LGLIWTIILRFQIQD +++ +D K  +++K++LLLWCQMKTAGY NVNI NFT+SW+DGLAFNA++HKHRP+V+++  L ++N   NL  AF  AE+E G+ +LLD  D+ VDQP+EKSI+TYV +     +++K+   + KR+G V++ AI A++LI+ YE L+ ELL+WI+  I  + + +L  SL  V+ QL  F++YR  EKPPKF ++G LE+  F IQSK+RA+N+K+YVP EGKLIS IN+AW+ LEK+EH  EL L  ELIRQ+KLE L   F+RKA MR+ WL EN  LV Q  FG DL  + AA +KHEA+E DI A+ ER+ A+  +A +L++E Y+ +  +      ++ +W+ L + L  RR++L   RD+Q + QE  Y+ DWM++   RLQS+D GKHL  V +LL+KH ++ +DI     RI    + +Q A    ++ +Q Y       V  K ++L   Y+EL  L+  R + L   + +W+++ D+  +  WI+E  Q+  S D G DL S   L+ K E    ++  R    +   +SI    +  N+      E+  R I +I     +L++  + R   L ++   HQ   D  D +A I+E  R   + ++G     T+   ++  E   +++    LI  L  +   L          D     ++  +++L  L+ TR+  L      + +FS  +    W+  KE+ L  +    +L++L V++ RF+  E +M     +V+  N ++  L++  +   + I + ++ LN  W +   LA QKK+ L+ A++   + LE  E +SW+++K K++E T  L +DL G+M LQR+L  ++RD++AI+ K+  L  EA KL    P     I   +  + E+WEEL   ++ R+  L  +++LQ F +DL+ F  WL + Q  VA++DIP  L EAE   T H  +K E+  ++ +Y ++   G +V+  + D Q++   +RL  L+  W+ L +MW+++   L +  D Q F+RD+ Q +  L  QE  L  +E+P N +A +   R+ E F  +  +++ KI++VV+ G  L+  SNA SDKI+ K + I  R +  ++      + L+D+  L  F  D   L  W++EKM+ A D SY + +++ +++ + + F  EL +N++ +D++ ++G  L+ EKP  +  ++  + +L++QW E+  T   K++ L +ANR  +F ++  ++ SW+       I ++   ++YG  L  +N  +K Q+  + Q++ + K +  ++  A  L ++  + G  E +  Q++V    + ++ PL  R+  LL  K   QF RD+EDE  W+ E++   T  +   +   V L  I++ +T   EI  H  RI D+   GE   + D          L EL  LWD LI+  ++      E R  Q++ ++A E E WM E+E  +M E+KAKDE  AL  ++KH+ L   + +Y   + +LA+    ++  + P S  +  +Q +VDK+YA L ++  E++ ++++ ++   L R +  LE+WIAER  VA S+E+G + EH  +LR++F EFA  T+ +G  RV   + + D LI  GH E+  +A WKD +NEAWADLLELI+TR Q+L A+Y+  +F  D+ E+L  + EK   +P  +G+D  +V    R+H     +I+ L   ++     A +L   Y GEK  +I   +  +   W +LQ+  ++R   L D  + ++F   VR+L+ WM  + +QI+A D  RDV   EL+I NH+ +K+EID+R ++ +  I +G  LIN+ H  A+++++K  ++  +   I + W+++  +L+++LEV QF R+A+VAE+WL  QE  +   + G  ++E  +LL++H   E+      +RF  L++LT+ EE +                        E    PPTP  V +V   K          + S D     Q  SV    + +D+++    + V              E S   P      S  E   G L RK E E+  KKA  R W+ +Y  ++   +  +K+ K         TY  E P  L  A+   A +YKKR +VF++R +NG EYLF+A D+                               AEMN W++ I            G   +L++  T+P I
Sbjct:   34 DNENSSARLFERSRIKALADEREAVQKKTFTKWVNSHL--SRVTCRIGDLYTDLRDGRMLIRLLEVLSGEQLPKPTKGRMRIHCLENVDKALQFLKEQKVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVETEDNKEKKSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGLAFNAIVHKHRPDVIEFDNLKRSNAHYNLQNAFNVAEKELGLTKLLDPEDVNVDQPDEKSIITYVATYYHYFSKMKALAVEGKRIGKVLDYAIEADQLIDKYETLASELLQWIEQTIGTLNDRQLANSLNAVQNQLQAFNSYRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYVPKEGKLISDINKAWERLEKAEHERELALRNELIRQEKLEMLAARFDRKAAMRETWLSENQRLVSQDNFGTDLGAVEAATRKHEAIETDINAYLERVVAVEDVAKELEAEGYHDVRRILARRDNVLRLWEYLKELLAARRERLTAHRDLQRLFQEMRYITDWMKDEQGRLQSQDTGKHLHDVLDLLQKHNLVEADISAQAERI----KGVQAAAKPFSSYEQAYKPCEPGLVGEKVERLGQAYEELGQLASARRERLEDSRRLWQFLWDLGEEAAWIREQEQILASGDCGRDLTSALHLLSKHEAFRDEMAAR---FMPLNNSIAAGEALINEGHFGASEVTER-IQDIRAQWAHLEETTKLREQSLKEAVALHQFQTDANDMEAWIMETLRQLSSQELGHDEFSTQTLARKQREIDEEIQSHRPLINTLHEQAQALPQAYVSHPQVDGRLPAIEQSYKELESLSATRRQALDGALSLYQMFSEADACLLWVEEKEQWLDGMEIPTKLEDLEVVQQRFESLEPEMNNLGARVTHVNDVAEFLLDSDNCRKDQIHQTRDQLNNRWAEFEQLAGQKKQALESALNIQNYHLECNEIKSWMKEKTKVIESTQSLGNDLAGVMALQRKLTGMERDLEAIQGKLDDLKSEAGKLASEHPDQAEEIQGRLAEIQEVWEELNATMKRREESLGEASKLQGFLRDLNDFQSWLSRTQTAVASEDIPTSLPEAENLLTQHESIKNELDNYKEDYEKMRAVGEEVTQGQTDAQHMFLAQRLQALDTGWHELRRMWENRHSLLAQGFDFQGFMRDAKQAEAFLNSQEYVLHHTEMPTNLQAAEEAIRKHEDFLTTTEASEEKINSVVDSGRRLINDSNANSDKIQEKVDSIQERHNKNKEMAKELLTKLKDNRELQHFLQDGQELTLWINEKMLTAQDMSYDEARNLHSKWQKHQAFMAELASNKDWLDKIDKEGQALVAEKPELKPVVQQILEDLQHQWEEVEGTTRTKAQCLFDANRAELFTQSCSALGSWL-----NNIESQLHSDDYGKDLTSVNILLKKQQMLEHQMEVREKEVQSLQAQALALSQE--DAGLTEIDGQQRQVTDNFSNLQQPLRLRKQKLLASKEAHQFNRDLEDEILWVTERMPLATSTEHGKDLSTVQL-LIKKNQTLQKEIQGHQPRIDDILKRGETQSQVDGERQALLEERLAELRDLWDQLISETDNRNTRLLEARRAQQFYADAAEAEAWMGEQELHMMSEEKAKDEQSALVMVKKHQILEQTLEDYAQTIHQLANSSRLMVTNEHPESERITLRQAQVDKLYAGLKDLAEERRGRLQERLRLTQLKREVDDLEQWIAEREMVAGSHELGQDYEHVSMLRDKFREFARDTSTIGQERVDGVNALADDLIESGHPENASVAEWKDGLNEAWADLLELIDTRTQMLGASYELHRFHQDAMEVLGRVKEKREALPADLGRDLNTVKHLHRQHQTLENDIQALSWQVNQVQDDAARLQKAYAGEKADDIHRSEHAVSSAWEALQEACQSRRLLLQDTVEKFRFLNAVRDLMLWMDGVNLQIDAHDSPRDVSSAELVIGNHQDIKSEIDTRADSFTASIDMGNALINKSHYAADEIQEKLAQLQERRDEINKKWQDKMNYLQIVLEVLQFGRDASVAESWLAGQEPLVRAAELGTNVDEVESLLKRHEAFEKLATAWEERFVQLERLTTLEEQELQRRR----------------EEEERARRPPTPPQVEEVTQSKAETQAHDSEARTSLDQTTLNQDVSVNGVHSDNDTSQGSESESVNGPGRDSGLASSRLEASATLPGRGGADSDAECVEGMLCRKQEMESHNKKAATRSWHNVYCTLKKGGLHFFKDNKSVSSGI---TYHGEMPFSLEEAVCEVALDYKKRKHVFKLRNENGKEYLFQAKDEVRCAVKMVGSQSIHAKKQTNTKCQNLKFCFKAEMNSWIQSIRRFITTRSQDSPGAPRALSRAMTMPPI 2351          
BLAST of Spectrin beta chain vs. Planmine SMEST
Match: SMESG000081696.1 (SMESG000081696.1)

HSP 1 Score: 4523.77 bits (11732), Expect = 0.000e+0
Identity = 2315/2319 (99.83%), Postives = 2316/2319 (99.87%), Query Frame = 2
Query:   20 MENKENQFMQTKDVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPTLGRKQK 6976
            MENKENQFMQTKDVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPTLILGLIWTIILRFQIQDAAIDEKDGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALN+VK NEKQCKRLGNVINEAISAEKLINNYEELSEELLEWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVTEISSQIITTEEIIEEYGLVELNEKMKDQEDKDKQLDQKRKMLSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGS RVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAEKKREKLKDREKRLELTIREFNTPPPTPEPVRKVE IKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVYKERKYYEDDKKQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPTLGRKQK
Sbjct:    1 MENKENQFMQTKDVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPTLILGLIWTIILRFQIQDAAIDEKDGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNKVKRNEKQCKRLGNVINEAISAEKLINNYEELSEELLEWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVTEISSQIITTEEIIEEYGLVELNEKMKDQEDKDKQLDQKRKMLSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSSRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAEKKREKLKDREKRLELTIREFNTPPPTPEPVRKVEAIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVYKERKYYEDDKKQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPTLGRKQK 2319          
BLAST of Spectrin beta chain vs. Planmine SMEST
Match: SMESG000081696.1 (SMESG000081696.1)

HSP 1 Score: 4508.75 bits (11693), Expect = 0.000e+0
Identity = 2307/2311 (99.83%), Postives = 2308/2311 (99.87%), Query Frame = 2
Query:   44 MQTKDVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPTLGRKQK 6976
            MQTKDVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPTLILGLIWTIILRFQIQDAAIDEKDGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALN+VK NEKQCKRLGNVINEAISAEKLINNYEELSEELLEWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVTEISSQIITTEEIIEEYGLVELNEKMKDQEDKDKQLDQKRKMLSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGS RVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAEKKREKLKDREKRLELTIREFNTPPPTPEPVRKVE IKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVYKERKYYEDDKKQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPTLGRKQK
Sbjct:    1 MQTKDVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPTLILGLIWTIILRFQIQDAAIDEKDGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNKVKRNEKQCKRLGNVINEAISAEKLINNYEELSEELLEWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVTEISSQIITTEEIIEEYGLVELNEKMKDQEDKDKQLDQKRKMLSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSSRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAEKKREKLKDREKRLELTIREFNTPPPTPEPVRKVEAIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVYKERKYYEDDKKQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPTLGRKQK 2311          
BLAST of Spectrin beta chain vs. Planmine SMEST
Match: SMESG000035098.1 (SMESG000035098.1)

HSP 1 Score: 2014.19 bits (5217), Expect = 0.000e+0
Identity = 1139/2340 (48.68%), Postives = 1610/2340 (68.80%), Query Frame = 2
Query:   26 NKENQFMQTKDVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDG--KRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGRIDDTSRKLQT---ADFD------RAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMK---NDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLASNAL-SDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXX-XXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTP-----EPVRKVET-IKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKI-NEIGGVDTSLA-KYSTLPNIKSDFEMPVTEASSEKKKFPTLGRKQ 6973
            N    +   +D  E  ++ + LYERSRIKAL+E+RE VQKKTFTKW+NSHL K  E   VDDL++DL+DGK L+KLLEIL+ EK+P  T+GK+RIHC+ NV K+INFL DQHV  EN+GAHDIVDG+P L LGL+WTIILRFQ+QD  +DE D    R++K++LLLWCQMKTAGYNNVNIRNFT+SW+DGLAFNA++HKH PE+++Y+ L KA P++NL  AF  AE E  +P+LLDA DI V+QP+EKSIMTYV +L    NR+K+   QCKR+G V+N+AI +E  I  Y+ L+ +LLEWI   I  ++      SL GV++QL  F+ YR++EKPPKF D+G LEM  F I S++RA+N+K Y+P EGK+IS INRAW+ LEK+EH  EL L EELIRQ+KL+QLG+ F+RK  MR+ WL EN  LV Q  FG+DL  + AA KKHEA+E DIFA+EER+NA+  +A++L  ENY+ I  +      +++MW+ LL+ L+ RR++L+  + +Q + QE  YL+DW+ EI  RL+S D GKHLLGV++LL+KH +L +DIR LE R +    + +     DFD      R A +   V+ + +QL ++YQ L+ L+  R + L   K MW++  ++ +DKEWIKE  QL  SPD GHDL SVERL+RK + +  +V +R+  +   L        ND   + +  I  +I ++  +   L      RR +L +S +F+QLL D +DADA ++++ R+ +N DVG KL+LTE  +K +++ M ++    + + +L  R     +    + DA +   R+    N ++ L++L+  R+  LL+    + LF   ++++TWII KEKLL+TLVPS+EL+EL VI+HRFDCFE +M+ ++ KVS+ N++S+DL++++HP  E I +KQ+ LN++WN LAD+ E+KK++++ +  YNQF++E+QET +WI +K KL++ TD+L +DLEGIMQLQRRLG LQRD++AIEAKV +L+KEAD ++  KP     ++ E   +NELW ELK ML++RD +LN S+ELQ+F +DLD F +WL++ Q  VA++DIP +LQEAE+    H ++K+EI  + PE+ RL+ FGR+V+  +DD QY+  N+RL+ +E  W  LEKM  D++  L++S  AQTF +D+ QID +L++ E+ + KS+LP + EA +   ++ +   N+  +N+ KID+++  G +L+  N   +DKI+ KC++I  R  AI+ K   R+  L   L L EF  ++  +EEW+ EKMIIASD SYRD +++S RY RFK FE E+ AN++ +++VI+ G +L+ ++P F    + K+ EL  QW+EL NTA +KSK++ +ANRE IF+ET KSM  W+T+ISSQIITTEE    E GLVE+NE+MKDQE KDK+L+ KRKML+D+E HA KLKEQYP+R +E E +QQEV+VKLT++EAPL  RR  LL++KRV+QFLRD+EDEK+WI EK+  +       ++L    Q IRRLKT N E+DNH  RI  +  +GE MI    P S+KF IA+ EL +LWD L     +     E+N   Q+YL +A E E WM E+E  LM  +KAKDE GA N M+KH+ +  +I NY   +  L ++   +++   P S LVAQKQ +VDKMYA L ++C E++ ++E+ ++ +HL + I  LE WIAER  +A S+E+GS+ EHC LLR+RF+EFA +TN +G  R+  A+E+CD LI  GH ES EIA+WKDRINE+WADLLELIETRIQLLKAA+D  KF+SD  +LLD I EK  +IP+ VG+DAKSVAT QRKH AF  E+ RL   I +A+  A+ LLP+Y G+KE+ I DR+ EL   W  LQ   E R   L+DA+DL++F +MVREL+NWM EI  Q+++ DK +DV GV+L+++NHRSLKAEID+R+EN SIC++LGRTL+NR+HP+ ND+R+K  EV+    N+++ W ER ++L +ILEVYQFAR+AAVAE+WL+AQ   L+  D G+ L+ETL LL+KH+  ER +  Q +RFE LKKLT+ E   K  + E +R+K  +R+K++   I+EF  PPPTP     EP+   ET I+ +S   +   +  S +      DSA+ P        + ++P        +E   GTL+RKHEWE++ KKA  R W+ELYVV+ +  +S YK++K+ ++    + Y HE P+ L GA   PAT+Y KR NVFR+++ NG EYLF+A  ++EMN+W+ K+ N   G D+  A + STLP ++        E    KKKF TLGRK+
Sbjct:   17 NGNGVYFSDEDEFEGGDSVSKLYERSRIKALAEEREIVQKKTFTKWMNSHLAKVGE--FVDDLYLDLRDGKKLIKLLEILACEKLPKPTRGKMRIHCLVNVDKAINFLLDQHVHLENVGAHDIVDGSPRLTLGLVWTIILRFQMQDIVLDEYDATDARSAKDALLLWCQMKTAGYNNVNIRNFTTSWRDGLAFNAIIHKHCPELIEYMKLAKAAPLQNLRNAFNIAEDELMIPKLLDAEDINVEQPDEKSIMTYVVTLYHYFNRMKTENVQCKRIGKVLNQAIESEDRITEYDNLASDLLEWINHTIQLLDERLFANSLSGVQQQLAAFNTYRISEKPPKFNDKGNLEMLLFTIHSEMRANNQKPYIPEEGKMISDINRAWEKLEKAEHERELCLREELIRQEKLDQLGSRFDRKTTMREAWLSENQRLVTQDNFGNDLAAVEAATKKHEAIETDIFAYEERVNAVMTVAEELAEENYHDIERINLRKDNVIKMWQDLLELLKMRRNRLELSKQMQNVFQEIIYLLDWIDEIGNRLKSEDCGKHLLGVDDLLQKHGLLEADIRVLEIRKNQVLEQAEVFIDCDFDENLQGYRPA-EPSEVENRCQQLKDSYQALLELASYRHNALQESKKMWQFFWEMEDDKEWIKEKSQLMSSPDLGHDLSSVERLLRKHKALEEEVRIRQQALETGLQKGEELIENDNWGKDR--IKDKIQKMKTIWAQLVDLTAERRQRLEESLEFYQLLTDCDDADAWMIDQLRIVKNEDVGTKLALTEALIKNNQDLMDELATFRQSLDQL--RTQGTTISEYPETDASKIFNRLDTLDNRYDQLIELSKLRQQKLLDAMSMYKLFDVADSVKTWIIEKEKLLITLVPSDELEELEVIRHRFDCFESEMRANAEKVSKVNELSKDLVSDEHPNTENIIQKQDDLNINWNDLADMVEKKKQDIETSYKYNQFLIEAQETANWIIEKEKLIQSTDELGNDLEGIMQLQRRLGGLQRDLKAIEAKVDHLDKEADDIEEKKPEVGNIVEPERAKINELWTELKSMLKERDDKLNDSSELQRFLQDLDHFQMWLRRSQTAVASEDIPNNLQEAEKLLDQHNQLKQEIAVYHPEFERLIHFGRKVTEGQDDAQYMFLNQRLSGIEESWEGLEKMCDDREAVLNQSLQAQTFFKDAQQIDIVLSKLENAVLKSDLPTSVEAVEEAIKQHDNINNNAIANEVKIDSLLESGRNLVVDNNFNADKIQRKCDEIAERRSAIRRKSSERSELLAAQLELQEFYQEIDDVEEWIGEKMIIASDDSYRDLQNVSARYGRFKAFEEEIGANKDKIEKVIKAGQELMQQRPQFAEITQIKIDELAQQWNELNNTAQDKSKKIADANRETIFNETAKSMNEWITDISSQIITTEEDSETEIGLVEINEQMKDQEKKDKELENKRKMLADMETHAVKLKEQYPDREEEIEQMQQEVRVKLTQVEAPLAGRRENLLKRKRVRQFLRDIEDEKQWIEEKINLVQNNGKIGDSLLAVQQFIRRLKTLNNEVDNHHPRIQAVCEDGEIMISEGHPQSEKFKIAMKELWELWDQLQMKLLERFAVLEDNLVAQQYLFDASEAEAWMGEQELYLMSPEKAKDEQGANNLMKKHQHIEKMIENYADEIRNLGERSQEMMHSCHPQSDLVAQKQSKVDKMYAGLRDLCSERQFRLEENVKLFHLLKEIVDLETWIAERIVLASSHEMGSDYEHCCLLRDRFAEFAKETNAIGGGRICAANELCDSLINQGHAESAEIAQWKDRINESWADLLELIETRIQLLKAAWDLHKFLSDCQDLLDRITEKKLVIPDEVGRDAKSVATYQRKHQAFEQEVHRLGQQIESAVETANHLLPLYAGQKERMICDRRDELLHAWRELQMASEFRKVHLLDAADLHRFLSMVRELINWMFEIRQQMDSKDKPKDVAGVDLLVNNHRSLKAEIDAREENFSICLSLGRTLLNRRHPRENDIREKCIEVVTLRVNLIDQWAERYDYLHLILEVYQFARDAAVAESWLMAQCTYLSCQDLGENLDETLALLKKHIAFERAVMTQEERFEALKKLTTLELRAKDSSPESQRQKDIERQKKIAEMIKEFQ-PPPTPKLQKSEPILDSETAIESVSSQQVASSRKLSTEHD---RDSADHPT-------TSKHP-------GSESHEGTLSRKHEWESTGKKASGRSWHELYVVLNDGVLSAYKDQKHGKEKPS-ELYHHESPLQLSGARIGPATDYTKRVNVFRLKLVNGGEYLFQAKSESEMNEWITKLNNSASGADSDTATRSSTLP-LQQHGTSESGEGHHGKKKFFTLGRKK 2329          
BLAST of Spectrin beta chain vs. Planmine SMEST
Match: SMESG000066485.1 (SMESG000066485.1)

HSP 1 Score: 1647.48 bits (4265), Expect = 0.000e+0
Identity = 956/2340 (40.85%), Postives = 1491/2340 (63.72%), Query Frame = 2
Query:   35 NQFMQTKDVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDEKDG--KRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIR----NLEGRIDD------TSRKLQTADFDRAAIDQDYVDMKEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRL--FENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKNSVASNKPKIDAVVNFGESLLA-SNALSDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXXXXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFI--TKFKIAPETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFP-SSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMREDKA-KDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTAXXXXXXXXXXXXXXXXTIREFNTPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVV--IENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQN-GAEYLFEAHDQAEMNQWVEKINEIGGVD-----TSLAKYSTLPNIKSDFEMPVTEASSEKKKFPTLGRKQ 6973
            N  + T D  + +++++ LYER RIKAL+ +RE VQKKTFTKW+NSHL K K+   +DDL+ DL+DGK LL LLEILSGE++P  TKGK+RIHC+ENV KS+NFL +Q V  EN+GAHDIVDGN  L LGLIWTIILRFQIQD  ++E D   KR +K++LLLWCQMKTAGY N N+RNF++ W+DGLAFNA++H+HRP++++Y  L+++NP ENL  A   AE + G+P+LLD  D+ V+ P+EKSIMTYV +     +++K++    KR+G ++++++  E+++ +Y++L+  LLEWI   I+ + +     SL GV++QL  F+ YR+TEKPPKFQ++G LEM  F IQS++RA+N+  Y+P EGKLIS IN AW+ L+K+EH  EL L +ELIRQ+KLEQL   F+RKA MR+ WL EN  L+ Q  FG DL  + AA KKHEA++ DI A+EER+N++  +  +L++E Y+ +  V      ++ +W+KLLD L  R+ +LD C  +Q + Q+  +L+D + ++  RL++ D G+HL+GVE+L+ KH +L  DIR     +EG + D      +   L + DF  A  D + V ++   L   Y  L+ LS  R+D L+  KVMWE++  + ++++W+KE IQL  +PD GHDL SV RLI K + I  DV    + + + + +   +   D +P  +++    + E+  L + L +   NRR++L QS  +   LAD  + +  I+E+ +L   + + + ++  +T+ +  +HE+    +E+ E  I  L  +   L     +    +E    +K+ +  L +L N +++ L +    F +    +T++TWI  KEKLL++L+P++EL+EL V +HRFD FE +M I + +V   N ++  L +  HP++  +  K+  LN  WN LADL E ++++LQ + ++NQ++LE ++T  WI++K +L+E TD+L DDL GIMQLQRR+G +QRD+ AI AK+++L++E D L   +P DE  I  E   + + W EL  ML DRD RL+ S+ELQ+F +DLD   +WL K+Q  VA++D+PKDL +AE+    H ++KEEI  ++ E++RLL +GR+++  K D QY+  ++RLN LE  W  L +MW+++   L +S   Q F+RD++Q + +L Q+E+FLSK ++P + E ++   R+ E F  ++ +N     AV+ FG +L+   +  SDKI  + + I  R ++ + + +     L+D +L  E S D+  L +W+ EKMIIA+D S+R+ K+I+ RYNR + F+ E++AN++ + + I+   ++++E+P     I P++  L  QW EL  T   K +++ EANRE IF+E T  +M+W+  I   II TEE +E   L ++N K+K  E+ D +++ KRK + D++ HA KLKE+ PE+    E     ++ + T+++ P+ +++  L+Q+KR+QQFLR+++D+K W+ +KL     T F     T+Q  L+R R L T   E++NH  ++  L  EG  +I    P   +KF   L EL  LW+ L  + +  QQ  +E+   Q +L +A E E W+ E+E  L+ E++  +D+  A+N ++KH+     I +YG  ++KL  +   ++  D P +  +A  Q  VDK+YA L ++CLEKK ++ ++ +  HLYR I  LE WI ER+ VA S+++G + EHC LLRERF EF  +T+ +G  RVK A+++C  LI+  H +S EIA+W DRIN++WA+L EL++TRIQLL+ A++F+K++S   ++LD I EKI  IP  V KD++SVA  QRKH  F ++ + LE  +   +  A+ LLP Y G+KE  I +R+ ++   W  L    E R + L DA+DL +F++MVREL+ WM  + +QIN   + +DV GVEL+I++HRS+KAEI +R+E+ SIC+ LGRTL++R     ++VR     ++ + +++ + W ER ++L++ILEVYQFAR+A+VAEAW++AQE  L     G+TL+ETL+LL+KH++ E+ +  Q +RF+ L+KLT+ E   K +T E    K K +++R+E  I+ F  PPP+PE V +                  S + +++ +D      + ++   SKE  ++ ++  T     G L RKHEWE   +KA NR W+E  VV  IE +K+ V  + + + ++K Q TY  +  +DL   +++PA++Y KRP VFR++I + GAEYLF+A D+ +M +WV  INE    D     T+  K STLP   SD  +P T+A+  KKKF TL RK+
Sbjct:   18 NGNITTDDEWDTEDSTSKLYERFRIKALAGERENVQKKTFTKWINSHLNKLKQS--IDDLYNDLKDGKMLLLLLEILSGEQLPYPTKGKMRIHCLENVDKSLNFLIEQRVHLENMGAHDIVDGNARLTLGLIWTIILRFQIQDIVVEEDDTSEKRQAKDALLLWCQMKTAGYPNTNVRNFSTCWRDGLAFNAIIHRHRPDLLEYSALSRSNPNENLEQAIRIAEEKLGIPRLLDPEDVSVENPDEKSIMTYVVTFYHFFSKMKADSVHSKRVGKILSQSMETEEMMVHYDKLTSNLLEWINQTIELLNDRTFANSLSGVQQQLAAFNTYRVTEKPPKFQEKGNLEMLLFSIQSQMRANNQVPYLPIEGKLISDINNAWNKLDKAEHARELALRDELIRQEKLEQLALRFDRKAGMREAWLTENQRLITQDNFGQDLSAVEAAGKKHEAIKTDILAYEERVNSVTLVTSELENECYHDVERVLCRRDNVIRLWEKLLDMLAVRKLRLDACYKVQKLFQDIKHLLDIINDLKARLKTEDIGRHLMGVEDLIHKHSLLEIDIRMVGTKIEGIMSDAQPFINSEFGLDSGDFQPA--DPNEVILRTVNLKEEYDNLLELSRNRKDNLSASKVMWEFLWGVADEEQWMKEKIQLMLNPDLGHDLSSVHRLISKHKVIEEDVRNHSNYLQNVIQA-GQQLILDKNPGAEKVADN-LKELELLWNELIELTENRRSKLEQSLAYFHCLADCGEVEIWIIEQVKLVKIDETSINEESIITDIH--KHEQLSKSIEDYESNINSLDEQVKKLSEGDLELVTIEEKVSNIKSQYAILFELTNQKQNKLTDTLSLFRVLRKADTVKTWIDEKEKLLMSLIPTDELEELEVFRHRFDGFEKEMNIQADQVEFVNTLAEKLSDMDHPQIADVVNKRFELNKLWNSLADLVEARREQLQTSYEFNQYLLECKQTGEWIREKSRLVESTDELGDDLAGIMQLQRRMGGMQRDMDAIRAKLEHLDEEMDTLIAKRPNDEELIREERMILEDFWAELGDMLADRDDRLSESSELQRFLQDLDHIHIWLSKMQTTVASEDLPKDLADAEKSLVQHEQLKEEIDSYQDEFIRLLDYGRRITEDKTDAQYMFLSQRLNALEEGWQELCQMWENRQGLLSQSLSLQVFLRDAIQSEVLLAQEENFLSKEDIPISIENSQNLLRKHEGFLTTLQANHDHTIAVIEFGRNLVERGHFCSDKINLRVKSILERRESNKRRSNEAYEKLKDQVLYQELSQDIDDLSKWIQEKMIIATDESFREEKNIARRYNRHRAFDEEIQANKDRLCQAIDYAMQIVEERPQLADMIYPQIDSLNQQWEELEQTTFLKGEKMIEANREAIFEEGTMDVMTWLETIGESIIVTEEEVET--LTDVNVKLKKVEEADNEMEIKRKQIQDLKMHAAKLKEEQPEKAFGIEQKHLILEHRFTQLQMPIKNKKIQLIQRKRIQQFLRNLDDQKAWVDDKLLLAESTNFGNNLLTVQQLLRRHRYLAT---EVNNHKPQLEYLKEEGAVLIEEVSPMQREKFVAGLQELESLWNRLEHSIDLRQQRLKESEATQTFLFDAEEAESWLWEQELFLLSEERGIRDQEAAINVIKKHDARQKTIEDYGEEITKLGTRSRLLIEKDHPQADRIALAQSHVDKVYAGLRDLCLEKKQRLSEIQKLNHLYREIVDLENWIYERTLVASSHDLGVDFEHCCLLRERFDEFFHETHLLGKDRVKAANDLCASLISQCHADSAEIAQWHDRINDSWAELQELMQTRIQLLRTAWEFYKYLSSCQDVLDRICEKIASIPTDVSKDSQSVAIQQRKHATFLSDAQALEGQVQWVVDEANHLLPSYAGQKEWHICERRDDVLATWNQLNMQAERRRHQLEDAADLQRFFSMVRELLQWMDLVALQINEKTRPKDVSGVELLINDHRSIKAEIAAREESMSICVNLGRTLLHRGRVGVDEVRAALINLITRKYSLEDMWEERWDYLQLILEVYQFARDASVAEAWILAQEPYLANKTLGETLDETLSLLKKHINFEKTVMSQEERFQALEKLTTMEIRAKEITKESILLKDKHKQERIENAIKIFQ-PPPSPELVHE------------------SPKVSISEEDEEGKSHQHKISVISKEAAEMCQSSETKTDIRGILIRKHEWEYKNRKALNRSWHEFLVVLSIEKNKLLV-YKDEKHYNEKPQDTYHKDSGLDLNDLVAAPASDYLKRPFVFRIKITSTGAEYLFQAKDEEDMLRWVNSINENSQKDLKSETTAPGKSSTLPACTSDPHVPSTQATGFKKKFFTLTRKK 2324          
BLAST of Spectrin beta chain vs. Planmine SMEST
Match: SMESG000039799.1 (SMESG000039799.1)

HSP 1 Score: 1254.2 bits (3244), Expect = 0.000e+0
Identity = 818/2398 (34.11%), Postives = 1375/2398 (57.34%), Query Frame = 2
Query:   56 DVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVNSHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCIENVTKSINFLNDQHVCFENLGAHDIVDGNPXXXXXXXXXXXXRFQIQDAAIDE--KDGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKHRPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKSIMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYXXXXXXXXXWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMNFFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELIRQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHEALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLDDLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVENLLEKHKILLSDIRNLEGR----IDDTSRKLQTADFD-RAAIDQDYVDM---KEKQLVNNYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGHDLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIHREIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRLFENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLE----LDSQQQNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWIIAKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLINEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQETQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLNKEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQKFFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEPEYVRLLQFGRQVSHSKDDP-QYLLFNERLNVLENEWNALEKMWKDKDVSLHESKDAQTFIRDSLQIDGILTQQESFLSK--SELPNNYEATKAT-------EREFEAFKNSVASNKPKIDAVVNFGESLLASNAL-SDKIRNKCEQIHSRCDAIQDKIDRRNSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFKDFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLNTATEKSKQLEEANREIIFDETTKSMMSWVXXXXXXXXXXXXX-XXXYGLVELNXXXXXXXXXXXXXXXXXXXXSDIEQHAEKLKEQYPERGDEFELIQQEVKVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKIAPETLQVCLQRIR---RLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKFNIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREFDLMRED-KAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNC-DLPGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEWIAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCDKLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSDSSELLDLIHEKIRLIPEV--VGKDAKSVATAQRKHNAFATEIERLEPLISNALGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDLYKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSRDENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFLEMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLERNLAVQADRFETLKKLTSFEETQKSLTA-------------XXXXXXXXXXXXXXXXTIREFNTPPPTPEP-------VRKVETI-KQLSED-----------------IIVPLQSRSVQSAVAIDDSAEAPPKQEVKEKSKENPKLIETKSTTEPKTGT--------------LTRKHEWENSTKKAGNRKWYELYVVIENSKMSVXXXXXXXXXXXXQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMRIQNGAEYLFEAHDQAEMNQWVEKIN-------EIGGVDTSLAKYSTLPNIKSDFEMPVTEASSEKKKFPTLGRKQ 6973
            D ++  N ++ ++ERSRIKAL+++RE VQKKTFTKW+NS L+       ++DL+VDL+DGK LL LLE+LS E +P  T+G++RIHC+ENV K + FL +Q V  EN+GAHDIVDGNP L LGLIWTIILRFQ+QD   DE      +++K++LLLWCQMKTAGY +VNIRNFT+SW+ GL F AL+HKHRP+++D+ +  + + + NL+ AF+ AE   G+P LLD  D+ V  P+E+S++TYV S     N +K++    KRL  ++N+ +  E++I  Y+ L  +LLEWI+  I  +   + + S+PG+++Q+  F+ YR  EKP KF ++  LE+  F I+S       K+Y PPE   +S IN AWD L  +E+  E  L +EL+RQ+KL  L   FN+KA +R+ W+ +N  L+ ++  G++L T++AA+KKHEA+E DI+A+EE +  L  I+D+L+ E Y  I  + +    ++++WKKLL  L  RR+ LD    +  ++ E   +   +  IT + +  ++GKHL+ VE LL  H+++ SDIR++  R    I + +R +Q  D D R+ I+     M   K    + ++ EL+   ++R++ L    ++W++I D + +++WIKE++ +  +PD G+DL SV+RL+RK +    +++ ++  + +KL  +  KT  D SP  QE I  + ++I  L + L  +  +R+ +L +  D++Q ++D +DA+  I E +RLF+   +GDK+S TE  ++++++ M  VE     I ++  +   L     +D Q      +  +R++  ++DL+D+A+  +  LL+    + L ++ +++ +WI  K+K L   +PS++++EL V+KHRF+ FE ++   + KV   N +S +L+   +P  +II   Q+ LN  WN++AD+ + K+ EL     Y+ F ++ Q+T  WI++K+KL+E  D+L +DLE +MQ QRR+  +QRD+ AIEAK+ +L  + D++          I+ ++  V++ WE L+ +++DRD+ L + N++ +F + LD F  WL ++Q ++A+Q+IP+   EAE+    +   ++E+   E +    ++ G+    S+ D  Q++    R+  +  +W  L  + ++K+  L +   +  F  D+ QI+ IL  QE +L K    L NN+  +K+          E E F + + S++  +  V+  G++L+  N L  D+++NKC+ +  R          R + L++ +LL E   D+  L++ + EK+ + ++ S  + K   +   + K  E E+ A R  ++E+ ++G +   + PHF+ EI   +  L + W+EL     EK + L   NRE +F+E+T+SMM W+  I  QI+  +E      G+  +  ++K  +  + +L+ K+K+L +++ H+E LK+Q P++  ++E ++ +VKV +  +  PL  + +I  QK   +QFL+D +DE +W+ EK++ I       ET+   LQ  +   R K+   EI N + ++  L  E + MI  +          +++L K  ++L    E  Q        VQE+L +  E   W+SE+E DLM     +KD+      +RK + L   I NY   + +         +C  LP  +    K   V+  +  L  +C EKK +I   + +   Y   Q +E WI ER+++A S++ G +L+ C LLR+RF+ F+ +TN++GS +V +A++  D+LI   H  +  I+ WKDRINE WADLLELI+TRIQLLK+A+D  ++  DS  LL+ I EK   +  V  +GKD KSV   QRK   F  ++ +L+  I+NA+ +++ LLP+Y  +KE  +  ++ EL   + SL+K  E+R  + ++ +D + F +MVREL++W+ E+ IQ+    K RDV G+EL+++NHRSLK E+DS++EN SIC+ LGRTL+  KH ++ +++ K KE+  K   + + W    + L +++EVYQ+AR+AA AEAW+I+QE  LN ++ G TL+ETL LL+K +  ++    Q ++FE LK+LT+ E   K L               +    ++ +  + +   ++ F   P    P       +R+  +I   L +D                 ++ P    S  S V     ++ P    +  K   N  +     +  PK  T              L RKH+WEN  +KA NR W+ LYV++  S+M+   + + +  +K +Q YKHE P+ L   +++PA +Y KRP VFR+R +NGAEYLF+     +M +WV+ IN       ++   +T+ +   + PN+ S            K+ F ++  K+
Sbjct:   28 DEVQYANVTSKVFERSRIKALADERENVQKKTFTKWINSTLIHV--TMKIEDLYVDLRDGKFLLALLELLSNEIVPKPTRGRMRIHCLENVDKCLGFLFNQKVHLENVGAHDIVDGNPRLTLGLIWTIILRFQVQDIQFDEDYSPVAKSAKDALLLWCQMKTAGYPSVNIRNFTNSWRTGLGFVALIHKHRPDLIDFSSCNRNDNINNLHLAFDIAENALGIPSLLDPEDVNVPLPDERSVITYVASYYHYFNSLKASSVLNKRLNKLLNQVLEDEQMIQLYQSLVSKLLEWIRNTIRLLNMRQFSNSIPGIQQQMNTFNLYRTGEKPSKFVEKVDLEVLLFTIKSNQFVSRLKVYNPPEEFSLSTINSAWDELNTAEYGRETALRKELMRQEKLRNLAQKFNKKAALRESWITDNMELLQKQSLGNNLPTVLAALKKHEAIETDIYAYEENLIGLTKISDNLEEEIYNDIISIINTKNKVLDLWKKLLQTLHERREHLDNYLQVYTLINEFCEVQAIITGITAKQRIDNYGKHLMEVEELLRSHELIESDIRSINQRLEKLISEANRYVQFCDQDFRSNINSGNKAMIKEKRNSTIKDFHELLDSLDKRKEILKHSHLVWQFIVDASLEEQWIKELVDIMNNPDLGYDLSSVDRLLRKHKVFELELSSKRISLENKL--MEGKTLVDISPVGQEFIAAKNNDIQNLWEALVDSTESRKIKLLEMLDYYQYVSDCDDAECWIDEFKRLFDLKFLGDKMSFTEILIRKNQQNMEIVENYRDNIEQIRNQAQSLLGYSIVDHQT---VAKKLDRIEKKYQDLLDIAHKMQEKLLDALTVYRLLNDSDSVRSWITEKQKFLCNFIPSDDIEELEVLKHRFEVFESELTKRAEKVYHVNNLSENLVVNGNPNHQIIVNNQDNLNNSWNKMADIVDSKRDELLSKYHYSNFFMDCQQTIEWIREKIKLIESMDELGEDLESVMQRQRRINHMQRDICAIEAKIDHLVAQGDEILRHNLRSAKDIEHQLDLVHQEWEILQQLIRDRDSTLANKNDIHRFIQKLDDFHNWLGQMQTEMASQNIPESQSEAEKLINKYNSQRDEMAAMEQQLEEWMKIGKDFLKSEQDKDQFVRLQNRIESINQDWKILNDLSEEKEKRLEKYLKSLMFFEDARQIEKILNAQEKYLMKDIQSLINNFNTSKSNLLSLNEIVNENEIFIDKMLSDEKLLAIVLKQGKTLILENNLYKDRMQNKCQNLDERWKKNTLAAQNRKNKLKEQVLLHELLQDIDDLDDSLLEKIQVLNEISMLNNKSTDSCLAQCKALEDEINAYRPIIEELNKRGKQTSADFPHFKKEIIDHLDNLNSTWAELSKALEEKLQNLAHFNREKLFEESTQSMMKWLKNIEGQIVADDEPDGSRSGITSITNQLKKLDSHNMELENKKKLLENLKDHSELLKQQNPDKASKYEQLETQVKVTMDGLSVPLESKLSIANQKIIAEQFLQDCDDEIDWMNEKIDLIRNRSKQMETICTLLQFQQLQMRHKSMKNEIRNRSVKVDSLIQEAQRMIDENHLKRALVVDTINQLKKTRENLNEEMEKFQNMLSNQLAVQEFLLDVSEVSSWISEKELDLMGLIINSKDDQLIRRVIRKEQNLEMEIKNYYPKIEEFKK------SCVSLPEEYKGIVKD--VEDNFNSLKIICAEKKTEISLFVIYCDTYELYQNIEAWIVERTKIARSDDSGKDLDQCTLLRDRFAIFSSETNKIGSSKVNEANKRFDELIQGKHPFAHSISVWKDRINEIWADLLELIDTRIQLLKSAWDLHRWYCDSQFLLECIQEKKSSMEVVNDLGKDPKSVCLLQRKLKNFEKDLLKLDSDINNAITVSNTLLPLYCKDKEATLIKKRQELIDAFRSLRKILEDRKLNNLELADFHNFLSMVRELLHWIEEVTIQMEMRHKPRDVSGIELLLANHRSLKIEMDSKEENFSICLNLGRTLLRTKHIRSPEIKSKCKEITDKRDILFQKWFNVLDHLSLMVEVYQWARDAASAEAWVISQESYLNNENLGMTLDETLALLKKFILFQKANMNQEEKFEQLKRLTTMEIRSKKLNTDRQFINEALINIEQTAEHEVHEIIQPITENVQTFEHKPIIHRPFEQHQQNIRRFNSIDSSLDQDSEIKDTGYFQKVNSRQSMMRPFPQSSALSPVPQMKQSKRPQPSNM-SKPVHNLSVSTDMLSASPKPATTRTIPPEEVLMKGPLYRKHQWENRNQKASNRTWHSLYVLLSQSRMTF-FKDERHFKEKPKQFYKHEMPLVLCEVVAAPAQDYLKRPCVFRVRFRNGAEYLFQGSSVVDMTRWVDAINSASRPMRQVNPSNTNPSTTQSHPNLSSSLPPQAQHHKGLKRFFSSIRLKK 2408          
The following BLAST results are available for this feature:
BLAST of Spectrin beta chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPTBN10.000e+037.22spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTBN10.000e+037.02spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTBN10.000e+037.67spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTBN20.000e+034.27spectrin beta, non-erythrocytic 2 [Source:HGNC Sym... [more]
SPTBN20.000e+034.27spectrin beta, non-erythrocytic 2 [Source:HGNC Sym... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-700.000e+037.55Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
unc-700.000e+037.34Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
unc-700.000e+037.25Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
unc-700.000e+037.02Spectrin beta chain [Source:UniProtKB/TrEMBL;Acc:... [more]
sma-11.742e-11935.26SMAll [Source:UniProtKB/TrEMBL;Acc:G5EFW3][more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
beta-Spec0.000e+038.08gene:FBgn0250788 transcript:FBtr0334404[more]
beta-Spec0.000e+039.55gene:FBgn0250788 transcript:FBtr0334405[more]
kst1.294e-12138.13gene:FBgn0004167 transcript:FBtr0303857[more]
kst1.294e-12138.13gene:FBgn0004167 transcript:FBtr0073070[more]
kst1.650e-12138.13gene:FBgn0004167 transcript:FBtr0073071[more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sptbn10.000e+036.11spectrin, beta, non-erythrocytic 1 [Source:ZFIN;Ac... [more]
sptbn20.000e+035.05spectrin, beta, non-erythrocytic 2 [Source:ZFIN;Ac... [more]
sptbn20.000e+034.52spectrin, beta, non-erythrocytic 2 [Source:ZFIN;Ac... [more]
sptbn10.000e+036.92spectrin, beta, non-erythrocytic 1 [Source:ZFIN;Ac... [more]
sptb0.000e+034.47spectrin, beta, erythrocytic [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPTBN10.000e+037.17spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTBN10.000e+037.71spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTBN10.000e+036.82spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTBN10.000e+037.62spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
SPTBN10.000e+037.23spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sptbn10.000e+037.37spectrin beta, non-erythrocytic 1 [Source:MGI Symb... [more]
Sptbn10.000e+037.37spectrin beta, non-erythrocytic 1 [Source:MGI Symb... [more]
Sptbn10.000e+038.40spectrin beta, non-erythrocytic 1 [Source:MGI Symb... [more]
Sptbn10.000e+038.14spectrin beta, non-erythrocytic 1 [Source:MGI Symb... [more]
Sptbn20.000e+033.91spectrin beta, non-erythrocytic 2 [Source:MGI Symb... [more]
back to top
BLAST of Spectrin beta chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01082|SPTB2_HUMAN0.000e+037.22Spectrin beta chain, non-erythrocytic 1 OS=Homo sa... [more]
sp|Q62261|SPTB2_MOUSE0.000e+037.37Spectrin beta chain, non-erythrocytic 1 OS=Mus mus... [more]
sp|Q9QWN8|SPTN2_RAT0.000e+034.41Spectrin beta chain, non-erythrocytic 2 OS=Rattus ... [more]
sp|O15020|SPTN2_HUMAN0.000e+034.27Spectrin beta chain, non-erythrocytic 2 OS=Homo sa... [more]
sp|P11277|SPTB1_HUMAN0.000e+036.49Spectrin beta chain, erythrocytic OS=Homo sapiens ... [more]
back to top
BLAST of Spectrin beta chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PMM50.000e+045.47Uncharacterized protein (Fragment) OS=Schistocepha... [more]
A0A0R3UHC10.000e+045.38Spectrin beta chain OS=Mesocestoides corti OX=5346... [more]
A0A5K3ET410.000e+045.49Spectrin beta chain OS=Mesocestoides corti OX=5346... [more]
A0A075A6I10.000e+045.26Spectrin beta chain OS=Opisthorchis viverrini OX=6... [more]
A0A419PFY30.000e+045.28Spectrin beta chain OS=Clonorchis sinensis OX=7992... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000030945.10.000e+036.38spectrin beta chain, non-erythrocytic 1-like [Sour... [more]
ENSAMXT00000009444.20.000e+036.14spectrin beta chain, non-erythrocytic 1-like [Sour... [more]
SPTBN10.000e+037.46spectrin beta, non-erythrocytic 1 [Source:HGNC Sym... [more]
sptbn20.000e+034.92spectrin beta chain, non-erythrocytic 1-like [Sour... [more]
sptbn20.000e+034.91spectrin beta chain, non-erythrocytic 1-like [Sour... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008111.10.000e+035.96pep scaffold:Pmarinus_7.0:GL478136:8967:48859:1 ge... [more]
ENSPMAT00000001834.16.227e-2938.37pep scaffold:Pmarinus_7.0:GL482425:158920:175005:1... [more]
ENSPMAT00000004049.13.275e-1541.38pep scaffold:Pmarinus_7.0:GL476488:489896:554954:1... [more]
ENSPMAT00000000684.16.824e-10341.27pep scaffold:Pmarinus_7.0:GL483163:49540:93186:-1 ... [more]
ENSPMAT00000009295.12.292e-9639.66pep scaffold:Pmarinus_7.0:GL479988:2885:20778:1 ge... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Spectrin beta chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO424313.489e-1236.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495767.237e-13436.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
ALPHA-ACTININ1.605e-10041.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291011.024e-9346.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495753.548e-8822.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Spectrin beta chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sptbn10.000e+035.52spectrin beta chain, non-erythrocytic 1-like [Sour... [more]
SPTBN10.000e+037.37spectrin beta chain, non-erythrocytic 1 [Source:NC... [more]
sptbn20.000e+035.47spectrin beta chain, non-erythrocytic 1 [Source:NC... [more]
sptbn20.000e+034.82spectrin beta chain, non-erythrocytic 1 [Source:NC... [more]
sptbn20.000e+034.65spectrin beta chain, non-erythrocytic 1 [Source:NC... [more]
back to top
BLAST of Spectrin beta chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081696.10.000e+099.83SMESG000081696.1[more]
SMESG000081696.10.000e+099.83SMESG000081696.1[more]
SMESG000035098.10.000e+048.68SMESG000035098.1[more]
SMESG000066485.10.000e+040.85SMESG000066485.1[more]
SMESG000039799.10.000e+034.11SMESG000039799.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021590 ID=SMED30021590|Name=Spectrin beta chain|organism=Schmidtea mediterranea sexual|type=transcript|length=7230bp
TATATAAATCTTATATGAAATGGAGAATAAAGAAAACCAGTTTATGCAGA
CGAAAGATGTTTTAGAAAATGATAACAACAGTGCTTTGTTATATGAGCGA
TCAAGAATTAAAGCTTTGTCTGAACAAAGAGAGGCTGTCCAGAAAAAGAC
ATTTACAAAATGGGTTAATTCACATTTAATGAAGAGTAAAGAACCGTATC
ATGTCGATGATTTATTTGTTGATTTACAAGATGGAAAAGCATTATTAAAG
CTTCTTGAAATTTTATCCGGTGAAAAAATGCCTCCGATAACCAAAGGAAA
GCTTCGAATACATTGCATAGAAAACGTTACGAAATCAATTAATTTTCTAA
ATGATCAACACGTTTGTTTTGAAAATCTCGGTGCACACGATATAGTCGAT
GGAAATCCTACTTTAATTCTTGGATTAATATGGACAATCATCTTAAGATT
CCAGATTCAAGATGCAGCAATTGATGAAAAAGATGGCAAGAGAACATCGA
AAGAATCTTTGTTACTTTGGTGTCAAATGAAAACCGCTGGTTATAACAAT
GTTAATATCCGCAATTTCACAAGTAGTTGGAAAGATGGATTGGCTTTCAA
TGCATTGCTTCACAAGCATCGTCCAGAAGTTGTTGATTACGTAACTTTGA
CAAAAGCGAATCCAGTTGAAAACCTTAATTTCGCTTTCGAAACCGCAGAA
CGAGAGTTTGGAGTACCTCAACTCCTGGATGCCAGAGACATCATAGTCGA
CCAACCCGAAGAGAAATCCATTATGACATATGTCGGCAGTTTGTGCTTGG
CTTTAAATAGAGTAAAGAGCAATGAAAAGCAATGCAAGAGACTGGGAAAC
GTAATAAATGAAGCTATTAGTGCAGAAAAATTAATCAATAATTACGAAGA
ACTTTCTGAAGAGCTTCTTGAATGGATTAAGTTGAAAATCGACTGGATGG
AAAACGAAAAGTTAAATGAATCCCTTCCGGGGGTAAGAGAACAATTAGGA
GACTTTTCTAACTATCGTTTGACTGAAAAGCCACCGAAATTTCAAGATCG
TGGCTTATTGGAAATGAATTTTTTTGAAATCCAAAGTAAACTACGAGCAG
ACAATCGAAAATTATATGTTCCACCGGAAGGGAAATTAATATCAGCGATA
AATCGAGCCTGGGACAATTTAGAGAAATCCGAGCATCGGATGGAATTACG
ATTATATGAGGAATTGATTCGACAACAAAAACTAGAACAGTTAGGCAACC
ACTTCAATCGCAAAGCTCAAATGAGAAAAGACTGGCTAATCGAAAATGAC
ATTCTCGTCCACCAGAAAATTTTCGGTGACGATTTAGTTACGATTGTTGC
AGCAATAAAGAAGCACGAAGCTCTCGAAGGGGACATTTTTGCTCACGAAG
AACGAATAAATGCTCTCGGTTACATTGCCGATGATTTGAAATCGGAAAAT
TACTACAAAATCACCGAAGTCGAAGATTGTTATTTCATGATTGTTGAAAT
GTGGAAAAAATTGTTGGATGATTTACAAACGAGGCGCGATAAGCTAGATC
GCTGTCGAGATATACAAATGATTTTGCAAGAAACCGATTACCTAATGGAT
TGGATGAGGGAAATCACCATCAGATTGCAATCAAGAGATTTCGGAAAACA
TTTATTAGGTGTGGAAAATCTTTTGGAAAAGCACAAAATACTTCTTAGTG
ATATCAGAAATTTGGAGGGTCGAATCGATGACACGAGTAGAAAGCTTCAA
ACCGCAGATTTTGATCGGGCTGCGATTGATCAGGATTATGTCGATATGAA
GGAGAAGCAATTGGTAAATAATTATCAGGAATTGATTCTTCTTTCCGAAC
AACGAGAAGATGAATTGAACTGTTACAAAGTTATGTGGGAGTATATCGAG
GATATCAATAATGACAAAGAGTGGATAAAGGAAATCATACAATTATTCCA
AAGTCCCGATTCCGGGCATGATCTGAGATCCGTTGAGCGTTTGATTAGGA
AATTCGAACAGATTTTATCAGACGTAACTGTAAGAAAAGATTTAATTGTG
GATAAACTGGATTCTATAGTGCATAAAACCAGCAATGATCCCAGTCCACA
GAGACAGGAAATAATACACAGGGAAATCGATGAAATAAATGAACTCCTTG
ACAATTTGGATCAAGCTATGAGAAATCGTCGCAATCAGTTGAATCAATCT
CATGATTTCCACCAGTTATTGGCAGATATTGAAGATGCAGATGCTATGAT
ATTGGAAGAAAGACGGCTGTTTGAAAATTCAGACGTTGGAGATAAATTAT
CACTGACGGAATACTATTTGAAACAACACGAAGAACAAATGTTGCAAGTT
GAGGAATTGGAGAAATTAATAACTGAACTGTTTGGACGAAAAAATGATCT
AGAATTGGATTCTCAACAACAAAACGATGCCGATGAAGCCTGTGAAAGAA
TGAAAAACGATTTCGAAGATTTAGTCGATTTGGCAAACACTCGAAAGCAC
TTACTTTTGAATAACAAAGACAAATTCCATTTATTTAGCAATTTTGAAAC
GATCGAAACATGGATCATAGCTAAAGAAAAACTCCTTGTGACTCTTGTTC
CGTCGGAAGAACTGGATGAATTAAATGTCATAAAGCATCGATTTGATTGT
TTTGAAGATGACATGAAAATCCATTCGGGAAAAGTCAGTGAAGCCAATCA
AATTTCCCGGGATTTAATCAATGAACAACATCCGGAACTGGAAATTATTT
CCGAGAAACAGAATATTCTCAATCTGGACTGGAATCAACTGGCGGATTTA
GCTGAGCAAAAGAAAAAAGAACTCCAATTGGCTGTGGATTATAATCAATT
TATACTGGAGTCTCAGGAAACCCAGTCCTGGATACAAGATAAAATGAAAC
TCCTCGAATGGACGGATGATTTGAAAGACGATCTTGAGGGAATTATGCAA
TTGCAAAGGAGGTTGGGATCTCTTCAAAGAGACGTTCAAGCAATTGAAGC
GAAAGTTAAATATCTAAATAAAGAGGCTGATAAGCTGAAAGTAGCGAAAC
CAGCGGACGAGGCTACTATTGACAGTGAAATTACAGCTGTTAATGAGTTG
TGGGAGGAATTGAAAATTATGCTGCAAGATCGAGATGCTCGACTCAATAG
TTCAAATGAATTACAGAAATTCTTTAAAGATTTGGATTCGTTTGATGTTT
GGCTGAAAAAAGTTCAAATTCAGGTAGCTACTCAAGATATTCCAAAAGAT
TTACAGGAAGCTGAAAGGTACTGCACCAATCACCTGGAAGTGAAGGAAGA
AATATTGTGCTGGGAGCCAGAATATGTAAGGTTATTGCAATTCGGACGTC
AGGTTTCTCACTCGAAAGACGATCCACAATATTTATTATTCAACGAGCGC
CTTAACGTGCTAGAAAATGAATGGAATGCCCTAGAAAAGATGTGGAAAGA
CAAAGATGTTTCATTGCACGAATCCAAAGACGCTCAAACGTTTATTCGAG
ATTCTCTTCAAATCGATGGCATTCTCACTCAGCAAGAAAGTTTCCTATCA
AAATCTGAGTTGCCAAACAACTATGAAGCTACTAAAGCCACGGAAAGGGA
ATTTGAAGCGTTTAAAAATTCTGTCGCTAGCAATAAACCGAAAATCGACG
CTGTCGTGAATTTCGGCGAATCTCTACTCGCATCAAATGCTCTTTCGGAT
AAAATCCGAAACAAATGCGAGCAAATACATTCCAGATGCGATGCAATTCA
AGATAAAATCGACAGAAGAAATAGCGCATTGCAAGACCATTTATTGTTGC
TGGAGTTTTCGGACGACGTGCTGGCTCTTGAAGAATGGATGTCGGAAAAA
ATGATCATTGCTTCCGACACTAGTTACAGAGATACGAAAGACATATCAAC
TCGTTATAATCGCTTTAAAGATTTTGAAAGAGAATTGGAAGCAAATCGAG
AAAGTGTTGATGAAGTAATAGAGAAAGGAAACAAGTTAATCGATGAAAAA
CCTCATTTTGAAAGTGAGATCGAACCCAAAGTAGTGGAATTAGAAAATCA
ATGGAGTGAACTGTTGAATACAGCGACAGAAAAGAGTAAACAATTGGAAG
AAGCCAACAGAGAAATCATTTTCGATGAGACAACAAAATCTATGATGTCT
TGGGTGACAGAAATTAGCTCTCAAATAATCACAACCGAGGAAATCATTGA
GGAATATGGTCTCGTTGAATTAAATGAAAAAATGAAAGATCAAGAAGATA
AAGACAAGCAATTGGATCAAAAACGGAAAATGTTATCGGATATTGAACAG
CATGCAGAGAAATTAAAAGAACAATATCCCGAACGTGGCGATGAGTTCGA
ATTGATACAACAAGAGGTCAAAGTGAAGCTCACCGAAATCGAAGCTCCAT
TGACAGATCGTAGAAATATTTTATTACAAAAGAAACGCGTCCAGCAATTC
TTACGTGACGTTGAAGATGAAAAAGAATGGATTAGAGAAAAGTTAGAATT
CATTACTAAATTCAAAATTGCTCCAGAGACTTTGCAAGTTTGTCTACAGC
GAATTCGGCGATTAAAGACCAATAACACAGAAATCGATAATCATGCTGGT
AGAATAACAGATTTGAATAATGAAGGTGAAGAAATGATTAGAAATGATTT
TCCATCTAGTGATAAATTCAACATTGCTCTCGATGAACTCAATAAACTTT
GGGATGATTTAATTACAGCATGTGAAGATTGCCAGCAGTTTTTCGAAGAA
AATCGAGAAGTTCAAGAGTATTTATCGGAAGCAATCGAGTGCGAATACTG
GATGAGTGAAAGAGAATTCGATTTAATGCGAGAAGATAAAGCCAAGGATG
AAGGCGGGGCTTTGAATGCTATGAGGAAGCACGAAGAGTTGATAAGTGTA
ATCAATAACTATGGTTCGATCGTTTCGAAGTTGGCGGATAAATATCATCA
TATTTTGAATTGCGACTTACCTGGTTCTCATCTTGTTGCACAGAAACAGG
AACGGGTCGATAAAATGTATGCCGATCTGTTGGAAATGTGTTTGGAGAAG
AAATTGAAAATCGAAGATCTAATACAGTTCTATCATCTCTATCGATCGAT
TCAAGGACTTGAGGAATGGATTGCTGAACGCAGCCAGGTCGCTTGCAGCA
ATGAGATCGGATCGGAATTGGAACATTGTATTTTATTGCGGGAAAGATTT
AGTGAATTTGCCATTCAAACCAATGAGGTAGGAAGTTTGCGAGTGAAAGA
TGCCGATGAAATGTGCGACAAGTTGATTGCACTGGGCCATCAGGAATCTC
CGGAAATCGCTCGATGGAAGGATAGAATCAATGAAGCATGGGCAGACCTT
CTTGAATTGATTGAAACTCGAATCCAATTATTAAAGGCTGCTTATGACTT
CTTTAAGTTTATGAGTGACAGCTCGGAATTACTGGATTTGATCCATGAAA
AAATCCGACTTATTCCCGAAGTCGTCGGAAAGGACGCAAAATCAGTGGCA
ACAGCGCAACGTAAGCACAACGCGTTTGCCACAGAAATCGAAAGGTTAGA
ACCATTAATCAGCAATGCCCTCGGGATTGCCGATAAATTGCTCCCGATGT
ATGGCGGAGAGAAAGAACAGGAAATTACTGATCGTAAAATCGAATTGCAA
AAACTTTGGTTTTCTTTACAAAAAGATTACGAGAATCGTCACAACTCGCT
CATGGACGCATCGGATCTGTATAAATTCTACGCCATGGTCAGGGAACTGG
TGAACTGGATGGGTGAAATAGAAATTCAAATAAATGCCGACGATAAAGCC
AGGGATGTTTGCGGTGTGGAATTGATCATCAGCAATCATAGAAGCCTGAA
AGCAGAAATTGATTCCCGAGATGAAAACCGTTCCATATGTATCACATTGG
GGAGAACGCTAATAAATAGAAAGCATCCGAAAGCCAATGATGTCAGGAAA
AAAGCGAAAGAAGTTTTGATAAAACATTTCAACATTTTGGAAAACTGGCG
AGAAAGACAAGAATTTCTGGAAATGATTCTTGAAGTTTATCAGTTTGCCC
GTGAAGCAGCTGTAGCAGAAGCTTGGTTGATTGCTCAAGAATTACAATTA
AACACCGACGATTTCGGTGATACTCTCAATGAAACATTGAATTTATTACA
AAAGCATTTGGATCTTGAAAGAAATTTAGCCGTCCAAGCCGATCGATTTG
AAACACTAAAAAAATTGACTTCATTCGAAGAAACCCAAAAATCTTTAACA
GCAGAAAAGAAAAGAGAAAAATTAAAAGATCGTGAAAAAAGGCTGGAATT
AACAATTAGAGAATTCAACACTCCTCCTCCAACTCCGGAACCGGTTAGAA
AGGTTGAAACAATAAAACAACTATCAGAAGATATAATAGTACCGTTACAA
AGTCGATCTGTACAATCTGCTGTCGCAATAGATGATTCTGCTGAAGCACC
ACCAAAACAGGAAGTAAAAGAAAAATCCAAAGAAAATCCAAAACTTATCG
AAACAAAATCCACAACAGAACCGAAAACCGGAACGTTGACACGAAAACAC
GAATGGGAAAACTCGACAAAGAAAGCCGGCAATAGAAAATGGTACGAACT
CTATGTGGTTATCGAAAATTCGAAAATGTCGGTTTATAAGGAGAGGAAAT
ATTATGAAGACGACAAAAAACAACAGACTTATAAACACGAGAAACCCATC
GATCTTATCGGAGCTATTTCTTCGCCAGCCACGAATTACAAGAAGCGTCC
AAATGTGTTTAGAATGAGAATTCAAAACGGTGCTGAATATCTGTTTGAAG
CTCACGATCAAGCTGAAATGAATCAATGGGTGGAAAAAATCAACGAAATC
GGAGGAGTCGACACCTCATTGGCGAAATATTCAACTTTACCCAATATTAA
AAGCGATTTTGAAATGCCTGTAACCGAGGCTTCCAGTGAAAAGAAAAAAT
TTCCAACCCTTGGAAGAAAACAAAAATAGATTTCGACTTTTGGTTTTCGA
TGAGTGAAAAAGTTCTTTAGGATATTTTTAAATAACTTTTTATAACTTGA
TTTTTTACTTTGATTATGTGCTACCATAATATTTTATTTTTTGGTAAATC
TGCTGATTATTATTATTATTAATGGTATTTAATATTTACAATTTTCAATG
AAATGATTTTCGATTTAGTAGAATGCAATTCTCATTTCGTTCTGTATGTG
TGTGTGTGTGTTGTATATATTTATTATTAC
back to top

protein sequence of SMED30021590-orf-1

>SMED30021590-orf-1 ID=SMED30021590-orf-1|Name=SMED30021590-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2320bp
MENKENQFMQTKDVLENDNNSALLYERSRIKALSEQREAVQKKTFTKWVN
SHLMKSKEPYHVDDLFVDLQDGKALLKLLEILSGEKMPPITKGKLRIHCI
ENVTKSINFLNDQHVCFENLGAHDIVDGNPTLILGLIWTIILRFQIQDAA
IDEKDGKRTSKESLLLWCQMKTAGYNNVNIRNFTSSWKDGLAFNALLHKH
RPEVVDYVTLTKANPVENLNFAFETAEREFGVPQLLDARDIIVDQPEEKS
IMTYVGSLCLALNRVKSNEKQCKRLGNVINEAISAEKLINNYEELSEELL
EWIKLKIDWMENEKLNESLPGVREQLGDFSNYRLTEKPPKFQDRGLLEMN
FFEIQSKLRADNRKLYVPPEGKLISAINRAWDNLEKSEHRMELRLYEELI
RQQKLEQLGNHFNRKAQMRKDWLIENDILVHQKIFGDDLVTIVAAIKKHE
ALEGDIFAHEERINALGYIADDLKSENYYKITEVEDCYFMIVEMWKKLLD
DLQTRRDKLDRCRDIQMILQETDYLMDWMREITIRLQSRDFGKHLLGVEN
LLEKHKILLSDIRNLEGRIDDTSRKLQTADFDRAAIDQDYVDMKEKQLVN
NYQELILLSEQREDELNCYKVMWEYIEDINNDKEWIKEIIQLFQSPDSGH
DLRSVERLIRKFEQILSDVTVRKDLIVDKLDSIVHKTSNDPSPQRQEIIH
REIDEINELLDNLDQAMRNRRNQLNQSHDFHQLLADIEDADAMILEERRL
FENSDVGDKLSLTEYYLKQHEEQMLQVEELEKLITELFGRKNDLELDSQQ
QNDADEACERMKNDFEDLVDLANTRKHLLLNNKDKFHLFSNFETIETWII
AKEKLLVTLVPSEELDELNVIKHRFDCFEDDMKIHSGKVSEANQISRDLI
NEQHPELEIISEKQNILNLDWNQLADLAEQKKKELQLAVDYNQFILESQE
TQSWIQDKMKLLEWTDDLKDDLEGIMQLQRRLGSLQRDVQAIEAKVKYLN
KEADKLKVAKPADEATIDSEITAVNELWEELKIMLQDRDARLNSSNELQK
FFKDLDSFDVWLKKVQIQVATQDIPKDLQEAERYCTNHLEVKEEILCWEP
EYVRLLQFGRQVSHSKDDPQYLLFNERLNVLENEWNALEKMWKDKDVSLH
ESKDAQTFIRDSLQIDGILTQQESFLSKSELPNNYEATKATEREFEAFKN
SVASNKPKIDAVVNFGESLLASNALSDKIRNKCEQIHSRCDAIQDKIDRR
NSALQDHLLLLEFSDDVLALEEWMSEKMIIASDTSYRDTKDISTRYNRFK
DFERELEANRESVDEVIEKGNKLIDEKPHFESEIEPKVVELENQWSELLN
TATEKSKQLEEANREIIFDETTKSMMSWVTEISSQIITTEEIIEEYGLVE
LNEKMKDQEDKDKQLDQKRKMLSDIEQHAEKLKEQYPERGDEFELIQQEV
KVKLTEIEAPLTDRRNILLQKKRVQQFLRDVEDEKEWIREKLEFITKFKI
APETLQVCLQRIRRLKTNNTEIDNHAGRITDLNNEGEEMIRNDFPSSDKF
NIALDELNKLWDDLITACEDCQQFFEENREVQEYLSEAIECEYWMSEREF
DLMREDKAKDEGGALNAMRKHEELISVINNYGSIVSKLADKYHHILNCDL
PGSHLVAQKQERVDKMYADLLEMCLEKKLKIEDLIQFYHLYRSIQGLEEW
IAERSQVACSNEIGSELEHCILLRERFSEFAIQTNEVGSLRVKDADEMCD
KLIALGHQESPEIARWKDRINEAWADLLELIETRIQLLKAAYDFFKFMSD
SSELLDLIHEKIRLIPEVVGKDAKSVATAQRKHNAFATEIERLEPLISNA
LGIADKLLPMYGGEKEQEITDRKIELQKLWFSLQKDYENRHNSLMDASDL
YKFYAMVRELVNWMGEIEIQINADDKARDVCGVELIISNHRSLKAEIDSR
DENRSICITLGRTLINRKHPKANDVRKKAKEVLIKHFNILENWRERQEFL
EMILEVYQFAREAAVAEAWLIAQELQLNTDDFGDTLNETLNLLQKHLDLE
RNLAVQADRFETLKKLTSFEETQKSLTAEKKREKLKDREKRLELTIREFN
TPPPTPEPVRKVETIKQLSEDIIVPLQSRSVQSAVAIDDSAEAPPKQEVK
EKSKENPKLIETKSTTEPKTGTLTRKHEWENSTKKAGNRKWYELYVVIEN
SKMSVYKERKYYEDDKKQQTYKHEKPIDLIGAISSPATNYKKRPNVFRMR
IQNGAEYLFEAHDQAEMNQWVEKINEIGGVDTSLAKYSTLPNIKSDFEMP
VTEASSEKKKFPTLGRKQK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0008091spectrin
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000110pharynx progenitor cell
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR001605PH_dom-spectrin-type
IPR018159Spectrin/alpha-actinin
IPR001715CH-domain
IPR001849PH_domain
IPR002017Spectrin_repeat
IPR011993PH-like_dom_sf
IPR001589Actinin_actin-bd_CS
Vocabulary: molecular function
TermDefinition
GO:0005543phospholipid binding
GO:0005515protein binding
GO:0003779actin binding
GO:0005200structural constituent of cytoskeleton
Vocabulary: biological process
TermDefinition
GO:0007010cytoskeleton organization
GO:0051693actin filament capping