Agrin, putative

Overview
NameAgrin, putative
Smed IDSMED30021589
Length (bp)4897
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Agrin, putative (SMED30021589) t-SNE clustered cells

Violin plots show distribution of expression levels for Agrin, putative (SMED30021589) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Agrin, putative (SMED30021589) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Agrin, putative (SMED30021589) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021589

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30021589SMESG000028865.1 SMESG000028859.1 dd_Smed_v4_3649_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021589SMESG000028865.1 SMESG000028859.1 dd_Smed_v4_3649_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30021589SMESG000028865.1 SMESG000028859.1 dd_Smed_v4_3649_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30021589SMESG000028865.1 SMESG000028859.1 OX_Smed_1.0.14314ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30021589SMESG000028865.1 SMESG000028859.1 dd_Smed_v6_3649_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021589SMESG000028865.1 SMESG000028859.1 dd_Smed_v4_3649_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30021589SMESG000028865.1 SMESG000028859.1 dd_Smed_v4_3649_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30021589SMESG000028865.1 SMESG000028859.1 dd_Smed_v4_3649_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30021589SMESG000028865.1 SMESG000028859.1 dd_Smed_v4_3649_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Agrin, putative vs. Ensembl Human
Match: AGRN (agrin [Source:HGNC Symbol;Acc:HGNC:329])

HSP 1 Score: 315.464 bits (807), Expect = 2.455e-86
Identity = 256/907 (28.22%), Postives = 391/907 (43.11%), Query Frame = 1
Query:  205 DLIIVGRVLNLANSEVI-------VSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDFIM-------YLKKTEQNNFF--------ELNYAKEFGNGLFEKRISVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNI----QVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCEN--NPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPED--CPLGKMCR-----------NGQCVCTDKCSKVKLR-VCGTDGNYYENECELKRKACIDNKTIRVA-------------PSVI---------GCISHNYIADEKN-----KRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF------TENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENS 2688
            ++++ G V  + N + +       V V R LKG DL+     +   N    +++      + C   + +G+  I        YL    +N            L   +E    + +K  + F    T       D C  + C FGA C+     P  A C C  + C +      VCGSD   Y + C ++R +C  Q+ I++     CG ++             C + +C   +TC  +       C CP     +    +CG+D   Y   C++ + +C     + +++ G CD C+    + +  C +         +   P+ L         Q PVCG D VTY+++C +      + + L  +  G+CQ +   D C    C + A C+       +CSCD + C   +R PVC  DG  YD+ C+  +  C +Q  +   +   C+   +PC GV+C   +       NG++ CEC  + C  +  PVCG+D VTY S C L  TAC   + + +   G C+   RC +    C    +C+++    +C CP+ C    L + VCG+DG TY SEC + +HAC T+ I+L +A+ G C+ C +  C+F ++C        QC+CP        PVCGSD  TY + C L+  +C +   I     GPC+            ED  C   ++CR           +G CVC   C  V    VCG+DG  Y  ECELK+  C   + + VA             P V          GC   N  A           +C CN  GS    CDP+T QC C+ G+ G  CDRC  G+WNF        +GCT CSC+  G+    C   TG C+CKP   G  C  CP G ++   GC+ ++
Sbjct:   44 NVVLTGTVEEILNVDPVQHTYSCKVRVWRYLKGKDLVARESLLDGGNK---VVISGFGDPLICDNQVSTGDTRIFFVNPAPPYLWPAHKNELMLNSSLMRITLRNLEEVEFCVEDKPGTHF----TPVPPTPPDACRGMLCGFGAVCEPNAEGPGRASCVCKKSPCPS--VVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSRGPCGSRDP------------CSNVTCSFGSTCARSADGLTASCLCPATCRGAPEGTVCGSDGADYPGECQLLRRACARQENVFKKFDGPCDPCQGALPDPSRSCRVNP-------RTRRPEMLLRPESCPARQAPVCGDDGVTYENDCVMGRSGAARGLLLQKVRSGQCQGR---DQCPE-PCRFNAVCLSRRGR-PRCSCDRVTCDGAYR-PVCAQDGRTYDSDCWRQQAECRQQRAIPSKHQGPCDQAPSPCLGVQCA--FGATCAVKNGQAACEC-LQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCD---RCGQ----CRFGALCEAE--TGRCVCPSEC--VALAQPVCGSDGHTYPSECMLHVHAC-THQISLHVASAGPCETCGDAVCAFGAVCSAG-----QCVCPRCEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQ-ELCRQRGGIWDEDSEDGPCVCDFSCQSVPGSPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTPYGCCQDNITAARGVGLAGCPSACQCNPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRALGPAGCEADA 895          

HSP 2 Score: 160.614 bits (405), Expect = 1.308e-38
Identity = 179/652 (27.45%), Postives = 255/652 (39.11%), Query Frame = 1
Query:  493 SVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATC-VTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDP------YQYCRI--------DNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEE------PRCKEQGKDCPSYQICKSDLVQAK----CECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRF------LEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPE-DCPLGKMC----RNGQCVCTD-KCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRV 2334
             + L    S Q Q  D C +  C+F A C    G P    C C    C    +   VC  DG  YDS C  ++ EC  Q++I            ++  G        C    C   ATC V N    C+C    C S    +CG+D +TY + CE++  +C   R I+    G CD C   +C F  +CE  E G    C CP+    C    Q PVCGSD  TY SEC L + +C  +ISL V   G C+T      C +  C +GA C     +  QC C    C++    PVCG+DG+ Y + C L + +C +Q ++    +  CE   C               + CR           +G   C+   +  P    PVCG+D VTY + C L +  C +++ L++   G C         P         P Y  C+ ++  A+      CP+  Q       C   G +Y   C      C   S    +  +  CD+C+    +F  I    R        +PQ     DC  +   +C         +C      C + R +     GP   +        C E  C  G  C     +  CVC    C +    +VCG+DG  Y NEC+LK  AC     I +
Sbjct:  378 GLLLQKVRSGQCQGRDQCPE-PCRFNAVCLSRRGRP---RCSCDRVTCDGAYR--PVCAQDGRTYDSDCWRQQAECRQQRAI-----------PSKHQGPCDQAPSPCLGVQCAFGATCAVKNGQAACEC-LQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCG--QCRFGALCEA-ETGR---CVCPS---ECVALAQ-PVCGSDGHTYPSECMLHVHACTHQISLHVASAGPCET------CGDAVCAFGAVC-----SAGQCVCPR--CEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDFSCQSVPG--SPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTP-YGCCQDNITAARGVGLAGCPSACQ-------CNPHG-SYGGTCDPATGQC---SCRPGVGGL-RCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQMTG-LCSCKPGVAGPKC----GQCPDGRAL-----GPAGCEADASAPATCAEMRCEFGARCVEESGSAHCVCPMLTCPEANATKVCGSDGVTYGNECQLKTIACRQGLQISI 963          

HSP 3 Score: 137.117 bits (344), Expect = 1.537e-31
Identity = 157/733 (21.42%), Postives = 275/733 (37.52%), Query Frame = 1
Query: 2593 GKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLS---------SLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV----SHIWKFKDNSFVIFPSESLQ-----LRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQS-PCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK-PV-EGFPWEYNTKFKGCISELYVDEISYNLVLDA 4722
            G C    L  G  CS CP G        +  ++ E  + A    F   SF  ++ +  A + L + +        G++ Y+ +  R  D+L + L +  V+ R D GSG   L S V +  G+ H + + R  R   L +DG     G +P     L+      +G               V  G  GC+           L I  G  T+   + +        +      P  + +      + P         + K    CQ + PC     C+   E    C+C  G +G  C+       S  +    N F       L      L +++ LE+ FL    +GLL +     D    F+S+ L    LE       G   + S E   +G W  V + +  +   L +   P+ + +  +P   LN+               +P++ GG     F+  +   ++   F GAIQ + +    +      +   ++T + G PC      PC         CVP     +C C            +   +  + +    + G++  +Y     + +K+   N+  +  +T +  G+ +L     + +  ++ +AI +G ++++ NLG +  VLR T    ++ N+W  V   R  R   L + +    A +  ++      L TDG +WLGG  + PV    P  Y T F GC+ ++ V     +L+ DA
Sbjct: 1342 GTCQDWALGGGFTCS-CPAG--------RGGAVCEKVLGAPVPAFEGRSFL-AFPTLRAYHTLRLALEFRALEPQGLLLYNGNA-RGKDFLALALLDGRVQLRFDTGSGPAVLTSAVPVEPGQWHRLELSRHWRRGTLSVDGETPVLGESPSGTDGLNLDTDLFVGGVPEDQAAVALERTFVGAGLRGCIRLLDVNNQRLELGIGPGAATRGSGVGECGDHPCLPNPCHGGAPCQNLEAGRFHCQCPPGRVGPTCADEK--SPCQPN-PCHGAAPCRVLPEGGAQCECPLGREGTFCQTASGQDGSGPFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYNGQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIRSREPVTLGAWTRVSLERNGRKGALRVGDGPRVLGESPVPHTVLNL--------------KEPLYVGGAP--DFSKLARAAAVSSGFDGAIQLVSLGGRQLLTPEHVLRQVDVTSFAGHPCTRASGHPCLN----GASCVPREAAYVCLCPGGFSGPHCEKGLVEKSAGDVDTL-AFDGRTFVEYLNAVTESEKALQSNHFELSLRTEATQGL-VLWSGKATERADYVALAIVDGHLQLSYNLGSQPVVLRST--VPVNTNRWLRVVAHREQREGSLQVGN---EAPVTGSSPLGATQLDTDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGRHPLHLLEDA 2033          

HSP 4 Score: 126.331 bits (316), Expect = 3.386e-28
Identity = 147/576 (25.52%), Postives = 211/576 (36.63%), Query Frame = 1
Query:  529 QNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTK---------IQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENN------PCSGVKCPD-PYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGICNEEPR------CKEQGK---DCPSYQ---ICKSDLVQAKC-ECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK 2136
            Q   PC  + C FGA C    G    A C C             VCGSDG+ Y S C ++   C L + IQV+    C R    + G        C+ ++              C CP++ C + +  +CG+D  TY + C +   +C     +     G C+ C    C F  +C   +      C CP     C      PVCGSD VTY S C L+  +C ++  +     G C+            +   C    C          +    C CD+  C++    PVCG+DG+ Y  +C L K  CE Q  ++V     C         P + + C   PY  C+  +N  +        CP   Q  C N   +Y   C+     C  +           +P +  + GI  +         C  QG    DC        CK  +   KC +CP      LG + C  D     +   MR   CE  +            +C  +  S + +C       P   CP         VCGSD  TY NEC LK  +C +   I+  S GPC+
Sbjct:  463 QAPSPCLGVQCAFGATCAVKNGQ---AACECLQA---CSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCGQCRFGA------LCEAETG------------RCVCPSE-CVALAQPVCGSDGHTYPSECMLHVHACTHQISLHVASAGPCETCGDAVCAFGAVCSAGQ------CVCPR----CEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDF-SCQSVPGSPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTPYGCCQ--DNITAARGVGLAGCPSACQ--C-NPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPD--GRALGPAGCEADASAPATCAEMR---CEFGA------------RCVEESGSAHCVC-------PMLTCPEANATK---VCGSDGVTYGNECQLKTIACRQGLQISIQSLGPCQ 970          

HSP 5 Score: 64.3142 bits (155), Expect = 2.193e-9
Identity = 84/431 (19.49%), Postives = 161/431 (37.35%), Query Frame = 1
Query: 3367 KPCLNGGLCQT-SSEEMYSCQCLPGYQGITCEEVV-SHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQ-------------------------NSDIILNNITQWQ----------GPPCGPLQSPCSKTDPEKGFC----VPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDD 4536
            +PC +GG CQ  +    ++C C  G  G  CE+V+ + +  F+  SF+ FP  +L+    L+L + F  L   GLL +  +G+ R   F+++ L    +++   T  G   L S      G+W+ + + +  +   L+++     + +       LN+++               +F GGV  +          +     G I+ + +N++ +                            +      N+   +          GP C   +SPC + +P  G      +PE     C C    E    + +   D   +  F   + G S  +   +         K  + + F      G+L+   +    K  F+ +A+R+  +E   +LG    V+R    + ++   W  V + RN R   L + D
Sbjct: 1336 QPCFHGGTCQDWALGGGFTCSCPAGRGGAVCEKVLGAPVPAFEGRSFLAFP--TLRAYHTLRLALEFRALEPQGLLLY--NGNARGKDFLALALLDGRVQLRFDTGSGPAVLTSAVPVEPGQWHRLELSRHWRRGTLSVDGETPVLGESPSGTDGLNLDT--------------DLFVGGVPEDQAAVALERTFVGAGLRGCIRLLDVNNQRLELGIGPGAATRGSGVGECGDHPCLPNPCHGGAPCQNLEAGRFHCQCPPGRVGPTCADEKSPC-QPNPCHGAAPCRVLPEGGAQ-CECPLGREGTFCQTASGQDG--SGPFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYNGQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIR--SREPVTLGAWTRVSLERNGRKGALRVGD 1742          
BLAST of Agrin, putative vs. Ensembl Human
Match: AGRN (agrin [Source:HGNC Symbol;Acc:HGNC:329])

HSP 1 Score: 311.612 bits (797), Expect = 3.382e-85
Identity = 233/774 (30.10%), Postives = 347/774 (44.83%), Query Frame = 1
Query:  538 DPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNI----QVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCEN--NPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPED--CPLGKMCR-----------NGQCVCTDKCSKVKLR-VCGTDGNYYENECELKRKACIDNKTIRVA-------------PSVI---------GCISHNYIADEKN-----KRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF------TENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENS 2688
            D C  + C FGA C+     P  A C C  + C +      VCGSD   Y + C ++R +C  Q+ I++     CG ++             C + +C   +TC  +       C CP     +    +CG+D   Y   C++ + +C     + +++ G CD C+    + +  C +         +   P+ L         Q PVCG D VTY+++C +      + + L  +  G+CQ +   D C    C + A C+       +CSCD + C   +R PVC  DG  YD+ C+  +  C +Q  +   +   C+   +PC GV+C   +       NG++ CEC  + C  +  PVCG+D VTY S C L  TAC   + + +   G C+   RC +    C    +C+++    +C CP+ C    L + VCG+DG TY SEC + +HAC T+ I+L +A+ G C+ C +  C+F ++C        QC+CP        PVCGSD  TY + C L+  +C +   I     GPC+            ED  C   ++CR           +G CVC   C  V    VCG+DG  Y  ECELK+  C   + + VA             P V          GC   N  A           +C CN  GS    CDP+T QC C+ G+ G  CDRC  G+WNF        +GCT CSC+  G+    C   TG C+CKP   G  C  CP G ++   GC+ ++
Sbjct:   65 DACRGMLCGFGAVCEPNAEGPGRASCVCKKSPCPS--VVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSRGPCGSRDP------------CSNVTCSFGSTCARSADGLTASCLCPATCRGAPEGTVCGSDGADYPGECQLLRRACARQENVFKKFDGPCDPCQGALPDPSRSCRVNP-------RTRRPEMLLRPESCPARQAPVCGDDGVTYENDCVMGRSGAARGLLLQKVRSGQCQGR---DQCPE-PCRFNAVCLSRRGR-PRCSCDRVTCDGAYR-PVCAQDGRTYDSDCWRQQAECRQQRAIPSKHQGPCDQAPSPCLGVQCA--FGATCAVKNGQAACEC-LQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCD---RCGQ----CRFGALCEAE--TGRCVCPSEC--VALAQPVCGSDGHTYPSECMLHVHAC-THQISLHVASAGPCETCGDAVCAFGAVCSAG-----QCVCPRCEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQ-ELCRQRGGIWDEDSEDGPCVCDFSCQSVPGSPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTPYGCCQDNITAARGVGLAGCPSACQCNPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRALGPAGCEADA 790          

HSP 2 Score: 159.844 bits (403), Expect = 1.889e-38
Identity = 179/652 (27.45%), Postives = 255/652 (39.11%), Query Frame = 1
Query:  493 SVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATC-VTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDP------YQYCRI--------DNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEE------PRCKEQGKDCPSYQICKSDLVQAK----CECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRF------LEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPE-DCPLGKMC----RNGQCVCTD-KCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRV 2334
             + L    S Q Q  D C +  C+F A C    G P    C C    C    +   VC  DG  YDS C  ++ EC  Q++I            ++  G        C    C   ATC V N    C+C    C S    +CG+D +TY + CE++  +C   R I+    G CD C   +C F  +CE  E G    C CP+    C    Q PVCGSD  TY SEC L + +C  +ISL V   G C+T      C +  C +GA C     +  QC C    C++    PVCG+DG+ Y + C L + +C +Q ++    +  CE   C               + CR           +G   C+   +  P    PVCG+D VTY + C L +  C +++ L++   G C         P         P Y  C+ ++  A+      CP+  Q       C   G +Y   C      C   S    +  +  CD+C+    +F  I    R        +PQ     DC  +   +C         +C      C + R +     GP   +        C E  C  G  C     +  CVC    C +    +VCG+DG  Y NEC+LK  AC     I +
Sbjct:  273 GLLLQKVRSGQCQGRDQCPE-PCRFNAVCLSRRGRP---RCSCDRVTCDGAYRP--VCAQDGRTYDSDCWRQQAECRQQRAI-----------PSKHQGPCDQAPSPCLGVQCAFGATCAVKNGQAACEC-LQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCG--QCRFGALCEA-ETGR---CVCPS---ECVALAQ-PVCGSDGHTYPSECMLHVHACTHQISLHVASAGPCET------CGDAVCAFGAVC-----SAGQCVCPR--CEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDFSCQSVPG--SPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTP-YGCCQDNITAARGVGLAGCPSACQ-------CNPHG-SYGGTCDPATGQC---SCRPGVGGL-RCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQMTG-LCSCKPGVAGPKC----GQCPDGRAL-----GPAGCEADASAPATCAEMRCEFGARCVEESGSAHCVCPMLTCPEANATKVCGSDGVTYGNECQLKTIACRQGLQISI 858          

HSP 3 Score: 137.117 bits (344), Expect = 1.526e-31
Identity = 157/733 (21.42%), Postives = 275/733 (37.52%), Query Frame = 1
Query: 2593 GKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLS---------SLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV----SHIWKFKDNSFVIFPSESLQ-----LRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQS-PCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK-PV-EGFPWEYNTKFKGCISELYVDEISYNLVLDA 4722
            G C    L  G  CS CP G        +  ++ E  + A    F   SF  ++ +  A + L + +        G++ Y+ +  R  D+L + L +  V+ R D GSG   L S V +  G+ H + + R  R   L +DG     G +P     L+      +G               V  G  GC+           L I  G  T+   + +        +      P  + +      + P         +   K  CQ + PC     C+   E    C+C  G +G  C+       S  +    N F       L      L +++ LE+ FL    +GLL +     D    F+S+ L    LE       G   + S E   +G W  V + +  +   L +   P+ + +  +P   LN+               +P++ GG     F+  +   ++   F GAIQ + +    +      +   ++T + G PC      PC         CVP     +C C            +   +  + +    + G++  +Y     + +K+   N+  +  +T +  G+ +L     + +  ++ +AI +G ++++ NLG +  VLR T    ++ N+W  V   R  R   L + +    A +  ++      L TDG +WLGG  + PV    P  Y T F GC+ ++ V     +L+ DA
Sbjct: 1237 GTCQDWALGGGFTCS-CPAG--------RGGAVCEKVLGAPVPAFEGRSFL-AFPTLRAYHTLRLALEFRALEPQGLLLYNGNA-RGKDFLALALLDGRVQLRFDTGSGPAVLTSAVPVEPGQWHRLELSRHWRRGTLSVDGETPVLGESPSGTDGLNLDTDLFVGGVPEDQAAVALERTFVGAGLRGCIRLLDVNNQRLELGIGPGAATRGSGVGECGDHPCLPNPCHGGAPCQNLEAGRFHCQCPPGRVGPTCAD--EKSPCQPN-PCHGAAPCRVLPEGGAQCECPLGREGTFCQTASGQDGSGPFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYNGQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIRSREPVTLGAWTRVSLERNGRKGALRVGDGPRVLGESPVPHTVLNL--------------KEPLYVGGAP--DFSKLARAAAVSSGFDGAIQLVSLGGRQLLTPEHVLRQVDVTSFAGHPCTRASGHPCLN----GASCVPREAAYVCLCPGGFSGPHCEKGLVEKSAGDVDTL-AFDGRTFVEYLNAVTESEKALQSNHFELSLRTEATQGL-VLWSGKATERADYVALAIVDGHLQLSYNLGSQPVVLRST--VPVNTNRWLRVVAHREQREGSLQVGN---EAPVTGSSPLGATQLDTDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGRHPLHLLEDA 1928          

HSP 4 Score: 125.946 bits (315), Expect = 4.457e-28
Identity = 147/576 (25.52%), Postives = 211/576 (36.63%), Query Frame = 1
Query:  529 QNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTK---------IQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENN------PCSGVKCPD-PYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGICNEEPR------CKEQGK---DCPSYQ---ICKSDLVQAKC-ECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK 2136
            Q   PC  + C FGA C    G    A C C             VCGSDG+ Y S C ++   C L + IQV+    C R    + G        C+ ++              C CP++ C + +  +CG+D  TY + C +   +C     +     G C+ C    C F  +C   +      C CP     C      PVCGSD VTY S C L+  +C ++  +     G C+            +   C    C          +    C CD+  C++    PVCG+DG+ Y  +C L K  CE Q  ++V     C         P + + C   PY  C+  +N  +        CP   Q  C N   +Y   C+     C  +           +P +  + GI  +         C  QG    DC        CK  +   KC +CP      LG + C  D     +   MR   CE  +            +C  +  S + +C       P   CP         VCGSD  TY NEC LK  +C +   I+  S GPC+
Sbjct:  358 QAPSPCLGVQCAFGATCAVKNGQ---AACECLQA---CSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCGQCRFGA------LCEAETG------------RCVCPSE-CVALAQPVCGSDGHTYPSECMLHVHACTHQISLHVASAGPCETCGDAVCAFGAVCSAGQ------CVCPR----CEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDF-SCQSVPGSPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTPYGCCQ--DNITAARGVGLAGCPSACQ--C-NPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPD--GRALGPAGCEADASAPATCAEMR---CEFGA------------RCVEESGSAHCVC-------PMLTCPEANATK---VCGSDGVTYGNECQLKTIACRQGLQISIQSLGPCQ 865          

HSP 5 Score: 64.3142 bits (155), Expect = 2.427e-9
Identity = 85/431 (19.72%), Postives = 161/431 (37.35%), Query Frame = 1
Query: 3367 KPCLNGGLCQT-SSEEMYSCQCLPGYQGITCEEVV-SHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQ-------------------------NSDIILNNITQWQ----------GPPCGPLQSPCSKTDPEKGFC----VPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDD 4536
            +PC +GG CQ  +    ++C C  G  G  CE+V+ + +  F+  SF+ FP  +L+    L+L + F  L   GLL +  +G+ R   F+++ L    +++   T  G   L S      G+W+ + + +  +   L+++     + +   P G   +N             +  +F GGV  +          +     G I+ + +N++ +                            +      N+   +          GP C   +SPC + +P  G      +PE     C C    E    + +   D   +  F   + G S  +   +         K  + + F      G+L+   +    K  F+ +A+R+  +E   +LG    V+R    + ++   W  V + RN R   L + D
Sbjct: 1231 QPCFHGGTCQDWALGGGFTCSCPAGRGGAVCEKVLGAPVPAFEGRSFLAFP--TLRAYHTLRLALEFRALEPQGLLLY--NGNARGKDFLALALLDGRVQLRFDTGSGPAVLTSAVPVEPGQWHRLELSRHWRRGTLSVDGETPVLGES--PSGTDGLN------------LDTDLFVGGVPEDQAAVALERTFVGAGLRGCIRLLDVNNQRLELGIGPGAATRGSGVGECGDHPCLPNPCHGGAPCQNLEAGRFHCQCPPGRVGPTCADEKSPC-QPNPCHGAAPCRVLPEGGAQ-CECPLGREGTFCQTASGQDG--SGPFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYNGQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIR--SREPVTLGAWTRVSLERNGRKGALRVGD 1637          
BLAST of Agrin, putative vs. Ensembl Human
Match: AGRN (agrin [Source:HGNC Symbol;Acc:HGNC:329])

HSP 1 Score: 311.227 bits (796), Expect = 4.687e-85
Identity = 233/774 (30.10%), Postives = 347/774 (44.83%), Query Frame = 1
Query:  538 DPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNI----QVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCEN--NPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPED--CPLGKMCR-----------NGQCVCTDKCSKVKLR-VCGTDGNYYENECELKRKACIDNKTIRVA-------------PSVI---------GCISHNYIADEKN-----KRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF------TENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENS 2688
            D C  + C FGA C+     P  A C C  + C +      VCGSD   Y + C ++R +C  Q+ I++     CG ++             C + +C   +TC  +       C CP     +    +CG+D   Y   C++ + +C     + +++ G CD C+    + +  C +         +   P+ L         Q PVCG D VTY+++C +      + + L  +  G+CQ +   D C    C + A C+       +CSCD + C   +R PVC  DG  YD+ C+  +  C +Q  +   +   C+   +PC GV+C   +       NG++ CEC  + C  +  PVCG+D VTY S C L  TAC   + + +   G C+   RC +    C    +C+++    +C CP+ C    L + VCG+DG TY SEC + +HAC T+ I+L +A+ G C+ C +  C+F ++C        QC+CP        PVCGSD  TY + C L+  +C +   I     GPC+            ED  C   ++CR           +G CVC   C  V    VCG+DG  Y  ECELK+  C   + + VA             P V          GC   N  A           +C CN  GS    CDP+T QC C+ G+ G  CDRC  G+WNF        +GCT CSC+  G+    C   TG C+CKP   G  C  CP G ++   GC+ ++
Sbjct:   32 DACRGMLCGFGAVCEPNAEGPGRASCVCKKSPCPS--VVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSRGPCGSRDP------------CSNVTCSFGSTCARSADGLTASCLCPATCRGAPEGTVCGSDGADYPGECQLLRRACARQENVFKKFDGPCDPCQGALPDPSRSCRVNP-------RTRRPEMLLRPESCPARQAPVCGDDGVTYENDCVMGRSGAARGLLLQKVRSGQCQGR---DQCPE-PCRFNAVCLSRRGR-PRCSCDRVTCDGAYR-PVCAQDGRTYDSDCWRQQAECRQQRAIPSKHQGPCDQAPSPCLGVQCA--FGATCAVKNGQAACEC-LQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCD---RCGQ----CRFGALCEAET--GRCVCPSEC--VALAQPVCGSDGHTYPSECMLHVHAC-THQISLHVASAGPCETCGDAVCAFGAVCSAG-----QCVCPRCEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQ-ELCRQRGGIWDEDSEDGPCVCDFSCQSVPGSPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTPYGCCQDNITAARGVGLAGCPSACQCNPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRALGPAGCEADA 757          

HSP 2 Score: 159.458 bits (402), Expect = 2.826e-38
Identity = 179/652 (27.45%), Postives = 255/652 (39.11%), Query Frame = 1
Query:  493 SVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATC-VTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDP------YQYCRI--------DNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEE------PRCKEQGKDCPSYQICKSDLVQAK----CECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRF------LEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPE-DCPLGKMC----RNGQCVCTD-KCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRV 2334
             + L    S Q Q  D C +  C+F A C    G P    C C    C    +   VC  DG  YDS C  ++ EC  Q++I            ++  G        C    C   ATC V N    C+C    C S    +CG+D +TY + CE++  +C   R I+    G CD C   +C F  +CE  E G    C CP+    C    Q PVCGSD  TY SEC L + +C  +ISL V   G C+T      C +  C +GA C     +  QC C    C++    PVCG+DG+ Y + C L + +C +Q ++    +  CE   C               + CR           +G   C+   +  P    PVCG+D VTY + C L +  C +++ L++   G C         P         P Y  C+ ++  A+      CP+  Q       C   G +Y   C      C   S    +  +  CD+C+    +F  I    R        +PQ     DC  +   +C         +C      C + R +     GP   +        C E  C  G  C     +  CVC    C +    +VCG+DG  Y NEC+LK  AC     I +
Sbjct:  240 GLLLQKVRSGQCQGRDQCPE-PCRFNAVCLSRRGRP---RCSCDRVTCDGAYR--PVCAQDGRTYDSDCWRQQAECRQQRAI-----------PSKHQGPCDQAPSPCLGVQCAFGATCAVKNGQAACEC-LQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCG--QCRFGALCEA-ETGR---CVCPS---ECVALAQ-PVCGSDGHTYPSECMLHVHACTHQISLHVASAGPCET------CGDAVCAFGAVC-----SAGQCVCPR--CEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDFSCQSVPG--SPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTP-YGCCQDNITAARGVGLAGCPSACQ-------CNPHG-SYGGTCDPATGQC---SCRPGVGGL-RCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQMTG-LCSCKPGVAGPKC----GQCPDGRAL-----GPAGCEADASAPATCAEMRCEFGARCVEESGSAHCVCPMLTCPEANATKVCGSDGVTYGNECQLKTIACRQGLQISI 825          

HSP 3 Score: 127.487 bits (319), Expect = 1.601e-28
Identity = 168/755 (22.25%), Postives = 282/755 (37.35%), Query Frame = 1
Query: 2593 GKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLS---------SLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV----SHIWKFKDNSFVIFPSESLQ-----LRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPI----KKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQS-PCSKTDPEKGFCVPEMNETICTC----SPKH--ENLCIRNSMQHDNPA-NTNFFRKYLGKSASKYAA----VKQKRD-------KSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK-PV-EGFPWEYNTKFKGCISELYVDEISYNLVLDA 4722
            G C    L  G  CS CP G        +  ++ E  + A    F   SF  ++ +  A + L + +        G++ Y+ +  R  D+L + L +  V+ R D GSG   L S V +  G+ H + + R  R   L +DG     G +P     L+      +G               V  G  GC+           L I  G  T+   + +        +      P  + +      + P         + K    CQ + PC     C+   E    C+C  G +G  C+       S  +    N F       L      L +++ LE+ FL    +GLL +     D    F+S+ L    LE       G   + S E   +G W  V + +  +   L +   P+ +    K R +P   LN+               +P++ GG     F+  +   ++   F GAIQ + +    +      +   ++T + G PC      PC         CVP     +C C    S  H  + L  +++   D  A +   F +YL        A    V +  D       K+   N+  +  +T +  G+ +L     + +  ++ +AI +G ++++ NLG +  VLR T    ++ N+W  V   R  R   L + +    A +  ++      L TDG +WLGG  + PV    P  Y T F GC+ ++ V     +L+ DA
Sbjct: 1204 GTCQDWALGGGFTCS-CPAG--------RGGAVCEKVLGAPVPAFEGRSFL-AFPTLRAYHTLRLALEFRALEPQGLLLYNGNA-RGKDFLALALLDGRVQLRFDTGSGPAVLTSAVPVEPGQWHRLELSRHWRRGTLSVDGETPVLGESPSGTDGLNLDTDLFVGGVPEDQAAVALERTFVGAGLRGCIRLLDVNNQRLELGIGPGAATRGSGVGECGDHPCLPNPCHGGAPCQNLEAGRFHCQCPPGRVGPTCADEK--SPCQPN-PCHGAAPCRVLPEGGAQCECPLGREGTFCQTASGQDGSGPFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYNGQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIRSREPVTLGAWTRVSLERNGRKGALRVGDGPRVLGESPKSRKVPHTVLNL--------------KEPLYVGGAP--DFSKLARAAAVSSGFDGAIQLVSLGGRQLLTPEHVLRQVDVTSFAGHPCTRASGHPCLN----GASCVPREAAYVCLCPGGFSGPHCEKGLVEKSAGDVDTLAFDGRTFVEYLNAVTESELANEIPVPETLDSGALHSEKALQSNHFELSLRTEATQGL-VLWSGKATERADYVALAIVDGHLQLSYNLGSQPVVLRST--VPVNTNRWLRVVAHREQREGSLQVGN---EAPVTGSSPLGATQLDTDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGRHPLHLLEDA 1918          

HSP 4 Score: 125.176 bits (313), Expect = 6.557e-28
Identity = 147/576 (25.52%), Postives = 211/576 (36.63%), Query Frame = 1
Query:  529 QNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTK---------IQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENN------PCSGVKCPD-PYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGICNEEPR------CKEQGK---DCPSYQ---ICKSDLVQAKC-ECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK 2136
            Q   PC  + C FGA C    G    A C C             VCGSDG+ Y S C ++   C L + IQV+    C R    + G        C+ ++              C CP++ C + +  +CG+D  TY + C +   +C     +     G C+ C    C F  +C   +      C CP     C      PVCGSD VTY S C L+  +C ++  +     G C+            +   C    C          +    C CD+  C++    PVCG+DG+ Y  +C L K  CE Q  ++V     C         P + + C   PY  C+  +N  +        CP   Q  C N   +Y   C+     C  +           +P +  + GI  +         C  QG    DC        CK  +   KC +CP      LG + C  D     +   MR   CE  +            +C  +  S + +C       P   CP         VCGSD  TY NEC LK  +C +   I+  S GPC+
Sbjct:  325 QAPSPCLGVQCAFGATCAVKNGQ---AACECLQA---CSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCGQCRFGA------LCEAETG------------RCVCPSE-CVALAQPVCGSDGHTYPSECMLHVHACTHQISLHVASAGPCETCGDAVCAFGAVCSAGQ------CVCPR----CEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDF-SCQSVPGSPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTPYGCCQ--DNITAARGVGLAGCPSACQ--C-NPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPD--GRALGPAGCEADASAPATCAEMR---CEFGA------------RCVEESGSAHCVC-------PMLTCPEANATK---VCGSDGVTYGNECQLKTIACRQGLQISIQSLGPCQ 832          

HSP 5 Score: 64.3142 bits (155), Expect = 2.155e-9
Identity = 84/431 (19.49%), Postives = 161/431 (37.35%), Query Frame = 1
Query: 3367 KPCLNGGLCQT-SSEEMYSCQCLPGYQGITCEEVV-SHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQ-------------------------NSDIILNNITQWQ----------GPPCGPLQSPCSKTDPEKGFC----VPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDD 4536
            +PC +GG CQ  +    ++C C  G  G  CE+V+ + +  F+  SF+ FP  +L+    L+L + F  L   GLL +  +G+ R   F+++ L    +++   T  G   L S      G+W+ + + +  +   L+++     + +       LN+++               +F GGV  +          +     G I+ + +N++ +                            +      N+   +          GP C   +SPC + +P  G      +PE     C C    E    + +   D   +  F   + G S  +   +         K  + + F      G+L+   +    K  F+ +A+R+  +E   +LG    V+R    + ++   W  V + RN R   L + D
Sbjct: 1198 QPCFHGGTCQDWALGGGFTCSCPAGRGGAVCEKVLGAPVPAFEGRSFLAFP--TLRAYHTLRLALEFRALEPQGLLLY--NGNARGKDFLALALLDGRVQLRFDTGSGPAVLTSAVPVEPGQWHRLELSRHWRRGTLSVDGETPVLGESPSGTDGLNLDT--------------DLFVGGVPEDQAAVALERTFVGAGLRGCIRLLDVNNQRLELGIGPGAATRGSGVGECGDHPCLPNPCHGGAPCQNLEAGRFHCQCPPGRVGPTCADEKSPC-QPNPCHGAAPCRVLPEGGAQ-CECPLGREGTFCQTASGQDG--SGPFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYNGQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIR--SREPVTLGAWTRVSLERNGRKGALRVGD 1604          
BLAST of Agrin, putative vs. Ensembl Human
Match: AGRN (agrin [Source:HGNC Symbol;Acc:HGNC:329])

HSP 1 Score: 311.227 bits (796), Expect = 4.863e-85
Identity = 233/774 (30.10%), Postives = 347/774 (44.83%), Query Frame = 1
Query:  538 DPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNI----QVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCEN--NPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPED--CPLGKMCR-----------NGQCVCTDKCSKVKLR-VCGTDGNYYENECELKRKACIDNKTIRVA-------------PSVI---------GCISHNYIADEKN-----KRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF------TENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENS 2688
            D C  + C FGA C+     P  A C C  + C +      VCGSD   Y + C ++R +C  Q+ I++     CG ++             C + +C   +TC  +       C CP     +    +CG+D   Y   C++ + +C     + +++ G CD C+    + +  C +         +   P+ L         Q PVCG D VTY+++C +      + + L  +  G+CQ +   D C    C + A C+       +CSCD + C   +R PVC  DG  YD+ C+  +  C +Q  +   +   C+   +PC GV+C   +       NG++ CEC  + C  +  PVCG+D VTY S C L  TAC   + + +   G C+   RC +    C    +C+++    +C CP+ C    L + VCG+DG TY SEC + +HAC T+ I+L +A+ G C+ C +  C+F ++C        QC+CP        PVCGSD  TY + C L+  +C +   I     GPC+            ED  C   ++CR           +G CVC   C  V    VCG+DG  Y  ECELK+  C   + + VA             P V          GC   N  A           +C CN  GS    CDP+T QC C+ G+ G  CDRC  G+WNF        +GCT CSC+  G+    C   TG C+CKP   G  C  CP G ++   GC+ ++
Sbjct:   65 DACRGMLCGFGAVCEPNAEGPGRASCVCKKSPCPS--VVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSRGPCGSRDP------------CSNVTCSFGSTCARSADGLTASCLCPATCRGAPEGTVCGSDGADYPGECQLLRRACARQENVFKKFDGPCDPCQGALPDPSRSCRVNP-------RTRRPEMLLRPESCPARQAPVCGDDGVTYENDCVMGRSGAARGLLLQKVRSGQCQGR---DQCPE-PCRFNAVCLSRRGR-PRCSCDRVTCDGAYR-PVCAQDGRTYDSDCWRQQAECRQQRAIPSKHQGPCDQAPSPCLGVQCA--FGATCAVKNGQAACEC-LQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCD---RCGQ----CRFGALCEAE--TGRCVCPSEC--VALAQPVCGSDGHTYPSECMLHVHAC-THQISLHVASAGPCETCGDAVCAFGAVCSAG-----QCVCPRCEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQ-ELCRQRGGIWDEDSEDGPCVCDFSCQSVPGSPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTPYGCCQDNITAARGVGLAGCPSACQCNPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRALGPAGCEADA 790          

HSP 2 Score: 159.458 bits (402), Expect = 2.736e-38
Identity = 179/652 (27.45%), Postives = 255/652 (39.11%), Query Frame = 1
Query:  493 SVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATC-VTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDP------YQYCRI--------DNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEE------PRCKEQGKDCPSYQICKSDLVQAK----CECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRF------LEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPE-DCPLGKMC----RNGQCVCTD-KCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRV 2334
             + L    S Q Q  D C +  C+F A C    G P    C C    C    +   VC  DG  YDS C  ++ EC  Q++I            ++  G        C    C   ATC V N    C+C    C S    +CG+D +TY + CE++  +C   R I+    G CD C   +C F  +CE  E G    C CP+    C    Q PVCGSD  TY SEC L + +C  +ISL V   G C+T      C +  C +GA C     +  QC C    C++    PVCG+DG+ Y + C L + +C +Q ++    +  CE   C               + CR           +G   C+   +  P    PVCG+D VTY + C L +  C +++ L++   G C         P         P Y  C+ ++  A+      CP+  Q       C   G +Y   C      C   S    +  +  CD+C+    +F  I    R        +PQ     DC  +   +C         +C      C + R +     GP   +        C E  C  G  C     +  CVC    C +    +VCG+DG  Y NEC+LK  AC     I +
Sbjct:  273 GLLLQKVRSGQCQGRDQCPE-PCRFNAVCLSRRGRP---RCSCDRVTCDGAYR--PVCAQDGRTYDSDCWRQQAECRQQRAI-----------PSKHQGPCDQAPSPCLGVQCAFGATCAVKNGQAACEC-LQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCG--QCRFGALCEA-ETGR---CVCPS---ECVALAQ-PVCGSDGHTYPSECMLHVHACTHQISLHVASAGPCET------CGDAVCAFGAVC-----SAGQCVCPR--CEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDFSCQSVPG--SPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTP-YGCCQDNITAARGVGLAGCPSACQ-------CNPHG-SYGGTCDPATGQC---SCRPGVGGL-RCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQMTG-LCSCKPGVAGPKC----GQCPDGRAL-----GPAGCEADASAPATCAEMRCEFGARCVEESGSAHCVCPMLTCPEANATKVCGSDGVTYGNECQLKTIACRQGLQISI 858          

HSP 3 Score: 126.716 bits (317), Expect = 2.338e-28
Identity = 168/755 (22.25%), Postives = 282/755 (37.35%), Query Frame = 1
Query: 2593 GKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLS---------SLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV----SHIWKFKDNSFVIFPSESLQ-----LRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPI----KKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQS-PCSKTDPEKGFCVPEMNETICTC----SPKH--ENLCIRNSMQHDNPA-NTNFFRKYLGKSASKYAA----VKQKRD-------KSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK-PV-EGFPWEYNTKFKGCISELYVDEISYNLVLDA 4722
            G C    L  G  CS CP G        +  ++ E  + A    F   SF  ++ +  A + L + +        G++ Y+ +  R  D+L + L +  V+ R D GSG   L S V +  G+ H + + R  R   L +DG     G +P     L+      +G               V  G  GC+           L I  G  T+   + +        +      P  + +      + P         +   K  CQ + PC     C+   E    C+C  G +G  C+       S  +    N F       L      L +++ LE+ FL    +GLL +     D    F+S+ L    LE       G   + S E   +G W  V + +  +   L +   P+ +    K R +P   LN+               +P++ GG     F+  +   ++   F GAIQ + +    +      +   ++T + G PC      PC         CVP     +C C    S  H  + L  +++   D  A +   F +YL        A    V +  D       K+   N+  +  +T +  G+ +L     + +  ++ +AI +G ++++ NLG +  VLR T    ++ N+W  V   R  R   L + +    A +  ++      L TDG +WLGG  + PV    P  Y T F GC+ ++ V     +L+ DA
Sbjct: 1237 GTCQDWALGGGFTCS-CPAG--------RGGAVCEKVLGAPVPAFEGRSFL-AFPTLRAYHTLRLALEFRALEPQGLLLYNGNA-RGKDFLALALLDGRVQLRFDTGSGPAVLTSAVPVEPGQWHRLELSRHWRRGTLSVDGETPVLGESPSGTDGLNLDTDLFVGGVPEDQAAVALERTFVGAGLRGCIRLLDVNNQRLELGIGPGAATRGSGVGECGDHPCLPNPCHGGAPCQNLEAGRFHCQCPPGRVGPTCAD--EKSPCQPN-PCHGAAPCRVLPEGGAQCECPLGREGTFCQTASGQDGSGPFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYNGQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIRSREPVTLGAWTRVSLERNGRKGALRVGDGPRVLGESPKSRKVPHTVLNL--------------KEPLYVGGAP--DFSKLARAAAVSSGFDGAIQLVSLGGRQLLTPEHVLRQVDVTSFAGHPCTRASGHPCLN----GASCVPREAAYVCLCPGGFSGPHCEKGLVEKSAGDVDTLAFDGRTFVEYLNAVTESELANEIPVPETLDSGALHSEKALQSNHFELSLRTEATQGL-VLWSGKATERADYVALAIVDGHLQLSYNLGSQPVVLRST--VPVNTNRWLRVVAHREQREGSLQVGN---EAPVTGSSPLGATQLDTDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGRHPLHLLEDA 1951          

HSP 4 Score: 125.561 bits (314), Expect = 5.577e-28
Identity = 147/576 (25.52%), Postives = 211/576 (36.63%), Query Frame = 1
Query:  529 QNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTK---------IQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENN------PCSGVKCPD-PYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGICNEEPR------CKEQGK---DCPSYQ---ICKSDLVQAKC-ECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK 2136
            Q   PC  + C FGA C    G    A C C             VCGSDG+ Y S C ++   C L + IQV+    C R    + G        C+ ++              C CP++ C + +  +CG+D  TY + C +   +C     +     G C+ C    C F  +C   +      C CP     C      PVCGSD VTY S C L+  +C ++  +     G C+            +   C    C          +    C CD+  C++    PVCG+DG+ Y  +C L K  CE Q  ++V     C         P + + C   PY  C+  +N  +        CP   Q  C N   +Y   C+     C  +           +P +  + GI  +         C  QG    DC        CK  +   KC +CP      LG + C  D     +   MR   CE  +            +C  +  S + +C       P   CP         VCGSD  TY NEC LK  +C +   I+  S GPC+
Sbjct:  358 QAPSPCLGVQCAFGATCAVKNGQ---AACECLQA---CSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCGQCRFGA------LCEAETG------------RCVCPSE-CVALAQPVCGSDGHTYPSECMLHVHACTHQISLHVASAGPCETCGDAVCAFGAVCSAGQ------CVCPR----CEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDF-SCQSVPGSPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTPYGCCQ--DNITAARGVGLAGCPSACQ--C-NPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPD--GRALGPAGCEADASAPATCAEMR---CEFGA------------RCVEESGSAHCVC-------PMLTCPEANATK---VCGSDGVTYGNECQLKTIACRQGLQISIQSLGPCQ 865          

HSP 5 Score: 64.3142 bits (155), Expect = 2.667e-9
Identity = 84/431 (19.49%), Postives = 161/431 (37.35%), Query Frame = 1
Query: 3367 KPCLNGGLCQT-SSEEMYSCQCLPGYQGITCEEVV-SHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQ-------------------------NSDIILNNITQWQ----------GPPCGPLQSPCSKTDPEKGFC----VPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDD 4536
            +PC +GG CQ  +    ++C C  G  G  CE+V+ + +  F+  SF+ FP  +L+    L+L + F  L   GLL +  +G+ R   F+++ L    +++   T  G   L S      G+W+ + + +  +   L+++     + +       LN+++               +F GGV  +          +     G I+ + +N++ +                            +      N+   +          GP C   +SPC + +P  G      +PE     C C    E    + +   D   +  F   + G S  +   +         K  + + F      G+L+   +    K  F+ +A+R+  +E   +LG    V+R    + ++   W  V + RN R   L + D
Sbjct: 1231 QPCFHGGTCQDWALGGGFTCSCPAGRGGAVCEKVLGAPVPAFEGRSFLAFP--TLRAYHTLRLALEFRALEPQGLLLY--NGNARGKDFLALALLDGRVQLRFDTGSGPAVLTSAVPVEPGQWHRLELSRHWRRGTLSVDGETPVLGESPSGTDGLNLDT--------------DLFVGGVPEDQAAVALERTFVGAGLRGCIRLLDVNNQRLELGIGPGAATRGSGVGECGDHPCLPNPCHGGAPCQNLEAGRFHCQCPPGRVGPTCADEKSPC-QPNPCHGAAPCRVLPEGGAQ-CECPLGREGTFCQTASGQDG--SGPFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYNGQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIR--SREPVTLGAWTRVSLERNGRKGALRVGD 1637          
BLAST of Agrin, putative vs. Ensembl Human
Match: EGFLAM (EGF like, fibronectin type III and laminin G domains [Source:HGNC Symbol;Acc:HGNC:26810])

HSP 1 Score: 135.191 bits (339), Expect = 2.454e-31
Identity = 144/661 (21.79%), Postives = 272/661 (41.15%), Query Frame = 1
Query: 2764 NAENYLSINISLVPYSSDGIIFYHSDTDRS-SDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVS-HIWKFKDN----SFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXV-IAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISELYVD-EISYNLVLDA 4722
            N+     I +     + DG++ Y  + +    D++++ +  R +++R + G+G   + S  ++ +G  H++++ R   +  L ++      G +    + +       +G A  P    L        GF GC+ SL +                                    +D+   P  +  S  +  +          C++GG C     + Y C C  G++G  CE+  +  I +F+++    +   +P E       ++ EITF P + +G+L +  D   ++  F+S+ L   H+E       G   L S +   +G W+ + + + AK   L ++   Q I + +   GF  +              N  IF GGV  N  +   N   LKP F G+IQKI++ND  I  ++ D       +    PC  +++PC+      G C P      C C    E L  + ++            +++G+S   Y      +  S +++N+ ++FKT + DG+L+          S  + + +R+G +  + NLG  +GV  I  N + +D +WH V+ +R+ ++  + +DD   R           L  +G +++GG K+       +Y     GCIS   +  +   +LV DA
Sbjct:  170 NSYQAFQITLEFRAEAEDGLLLYCGENEHGRGDFMSLAIIRRSLQFRFNCGTGVAIIVSETKIKLGGWHTVMLYRDGLNGLLQLNNGTPVTGQSQGQYSKITFRTPLYLGGA--PSAYWLVRATGTNRGFQGCVQSLAVNG--------------------------------RRIDMRPWPLGKALSGADVGECSSGICDEASCIHGGTCTAIKADSYICLCPLGFKGRHCEDAFTLTIPQFRESLRSYAATPWPLEPQHYLSFMEFEITFRPDSGDGVLLYSYDTGSKD--FLSINLAGGHVEFRFDCGSGTGVLRSEDPLTLGNWHELRVSRTAKNGILQVDK--QKIVEGMAEGGFTQIKC------------NTDIFIGGVP-NYDDVKKNSGVLKP-FSGSIQKIILNDRTIHVKH-DFTSGVNVENAAHPC--VRAPCA----HGGSCRPRKEGYDCDCPLGFEGLHCQKAI-----IEAIEIPQFIGRSYLTYDNPDILKRVSGSRSNVFMRFKTTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLG--SGVASIMVNGSFNDGRWHRVKAVRDGQSGKITVDDYGARTGK-SPGMMRQLNINGALYVGGMKEIALHTNRQYMRGLVGCISHFTLSTDYHISLVEDA 763          

HSP 2 Score: 87.8113 bits (216), Expect = 1.124e-16
Identity = 98/400 (24.50%), Postives = 161/400 (40.25%), Query Frame = 1
Query: 2605 CKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLK-----DSFAKSYWSGNAENYLSI---NISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV---SHIWKFKDNSFVIFPSESLQLR---QRLKLEITFLPLANNGLLSFISDGHDR-NPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAK 3759
            C  +    Y  +CP+G+      C+         DA  L   +      S+A + W    ++YLS     I+  P S DG++ Y  DT  S D+L+I L   +VE+R D GSG   L+S   LT+G  H + V R  ++  L +D      GM     T +       IG    P  + +     V   F G +  +           ++N +T  +             DF + V+V            EN     +     PC +GG C+   +E Y C C  G++G+ C++ +     I +F   S++ + +  +  R    R  + + F   A +GLL +  D   R N  FIS+ L    L  +     GV  ++   S   G+W+ V  ++  +
Sbjct:  346 CTAIKADSYICLCPLGFK--GRHCE---------DAFTLTIPQFRESLRSYAATPWPLEPQHYLSFMEFEITFRPDSGDGVLLYSYDTG-SKDFLSINLAGGHVEFRFDCGSGTGVLRSEDPLTLGNWHELRVSRTAKNGILQVDKQKIVEGMAEGGFTQIKCNTDIFIGGV--PNYDDVKKNSGVLKPFSGSIQKI-----------ILNDRTIHVKH-----------DFTSGVNV------------ENAA---HPCVRAPCAHGGSCR-PRKEGYDCDCPLGFEGLHCQKAIIEAIEIPQFIGRSYLTYDNPDILKRVSGSRSNVFMRFKTTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGSFNDGRWHRVKAVRDGQ 693          
BLAST of Agrin, putative vs. Ensembl Celegans
Match: agr-1 (AGRin (Synaptic protein) homolog; AGRin (Synaptic protein) homolog family member [Source:UniProtKB/TrEMBL;Acc:G5EG68])

HSP 1 Score: 255.373 bits (651), Expect = 2.065e-68
Identity = 196/676 (28.99%), Postives = 308/676 (45.56%), Query Frame = 1
Query:  796 KSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTIC-----------------KCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCE--NNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLV------QAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETN-SIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVR----RPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSK---VKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYW--NFTENG---CTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVD 2709
            ++ +  C+   CP  + C       C+C   +C   +  +CG+D ++Y++ C +   SC     +  +   R  +     C+    CE +  G G  C                 +CPN  +    +   PVC S  V YQS CHL+  +C+ K ++TV + G+C      D C   +C  G  C    +   +C C      N+    VCG DG  Y N+CFL   +C++Q ++ V     C+   +PC  ++C   +  C +  +  + CECP   C  +++PVC  +  T+++ C + + +C TK  + + + G C            C ++  CK   V      + KC CP+C      + VCG+DGKTY +EC ++  AC    +I +K  +     K K +KC FYS C +    + +C CP DC        + VCG+D  TY +EC +K  +C +++ +    EG C        +E     C  G+ CR+G CVC+  C     +  R+CG +G  Y + C L+  +C     I   P      SH + +      SC CN +GS  H CD  T QC C+ G+ G  CD C+  +W  +    G   C  C C+ FGS    C   TGKC CK  A+G  C +CP G  ++  GC   ++Y+   D
Sbjct:  147 RTKQAICEQSLCPFGSKCGLKT-GVCEC-KARCRVVTDVVCGSDHVSYSSFCHLSVRSC-----VLAKNGVRLRVATKGPCKKRNPCEDLRCGPGEDCVVNQINGILLAKCVCPTQCPNYGDSVESS---PVCSSHGVDYQSSCHLRHHACESKTNITVKFFGRC------DPCHGHKCPNGQTCQLGVDRRPECKCSEQCTMNSAH--VCGTDGKTYLNECFLKLAACKEQKDILVWKRGNCDEAGSPCEKMEC-GFWGSCVVKPDRTAECECPNR-CEDVMRPVCATNGETFDNECEMKKKSCETKSMIKVKHQGTCGIGV--------CATFDSCKKPQVCVVVDGKPKCVCPSCTDEF--KEVCGSDGKTYSNECRLQNAACMAQKNIFVKYNSACEACKLKKEKCDFYSACVVGENEKAECKCPDDCPSYEMEEGKEVCGTDGVTYSSECHMKKSACHQSKFVMTAFEGKC--------DECLHVQCRYGEECRSGVCVCSYNCPANPPLSARICGENGVLYPSLCHLQLASCQKGAPISEMPP-----SHCHSSKTSFPDSCQCNRVGSFGHTCD-ETGQCKCRPGVAGIKCDHCLPSFWGIHLIAQGALSCRPCGCSAFGSSRSDCEQTTGKCECKNGALGDKCDLCPNGSMMTAGGCVSPAVYKTPRD 778          

HSP 2 Score: 219.935 bits (559), Expect = 2.101e-57
Identity = 225/815 (27.61%), Postives = 345/815 (42.33%), Query Frame = 1
Query:  193 IESSDLIIVG-------RVLNLANSEVIVSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDFIMYLKKTEQNNFFELNYAK-EFGNGLFEKRISVFLNGATSKQVQNDDP-CSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKS---IQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP-----YPYC----KCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQIC-KSDLVQAKCECP-TCPQSGL--GESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVY---VRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPC---KLQFIKPDEERCPEDCPLGKMC-RNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTA 2541
             E+SD+II G       RV +L    + V   RI KG + + E K I         ++  I     C   + + +  I  L  T Q   F L+         +F+   ++    A  K+ +     C +  C FG++C        T VC C   +C+       VCGSD + Y S C +  + C L K+   ++V+    C ++              C+   C P   CV N         C    +CPN      SS +C +  + Y + C ++  +C++   I  ++ GRCD C   KC     C++  D     CKC    E CT N    VCG+D  TY +EC LK+ +CK++  + V  +G C        C  ++C +   C+   +  A+C C    C++  R PVC  +G  +DN+C + K SCE +  + V +   C    C+        Q C +  +GK  C CP   C    + VCG+D  TY + C L   AC+ +K +++ YN  C     CK + + C  Y  C   +  +A+C+CP  CP   +  G+ VCGTDG TY SECHM+  AC  +   +  A  G CD+C + +C +   C+        C+C  +C     +   +CG +   Y + C L++ SC +   I+ +    C   K  F  PD  +C      G  C   GQC C    + +K   C                           PS  G   H       + R C C++ GS   +C+ +T +C CK G  G  CD C +G    T  GC +
Sbjct:   38 FENSDVIIAGVITGISYRVDSLYIENITVIPRRIYKGREYVEENKNI---------VIGNILETEPCAHRLLASDVRIFSL--TNQQGVFLLDAPMIRVSLPIFDALFTISNKQAHRKRRRTKQAICEQSLCPFGSKC-----GLKTGVCEC-KARCRVVTD--VVCGSDHVSYSSFCHLSVRSCVLAKNGVRLRVATKGPCKKRNP------------CEDLRCGPGEDCVVNQINGILLAKCVCPTQCPNYGDSVESSPVCSSHGVDYQSSCHLRHHACESKTNITVKFFGRCDPCHGHKCPNGQTCQLGVDRRPE-CKC---SEQCTMN-SAHVCGTDGKTYLNECFLKLAACKEQKDILVWKRGNCDE--AGSPCEKMECGFWGSCVVKPDRTAECECPN-RCEDVMR-PVCATNGETFDNECEMKKKSCETKSMIKVKHQGTCGIGVCATFDSCKKPQVCVV-VDGKPKCVCPS--CTDEFKEVCGSDGKTYSNECRLQNAACMAQKNIFVKYNSACEA---CKLKKEKCDFYSACVVGENEKAECKCPDDCPSYEMEEGKEVCGTDGVTYSSECHMKKSACHQSKFVM-TAFEGKCDECLHVQCRYGEECRSG-----VCVCSYNCPANPPLSARICGENGVLYPSLCHLQLASCQKGAPISEMPPSHCHSSKTSF--PDSCQCNRVGSFGHTCDETGQCKCRPGVAGIKCDHC--------------------------LPSFWGI--HLIAQGALSCRPCGCSAFGSSRSDCEQTTGKCECKNGALGDKCDLCPNGSM-MTAGGCVS 769          

HSP 3 Score: 133.65 bits (335), Expect = 5.780e-31
Identity = 146/547 (26.69%), Postives = 225/547 (41.13%), Query Frame = 1
Query:  541 PCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVK--CEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDP-----VCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPC-PKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGES--VCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDC------VYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPC 2133
            PC K+ C F   C   P    TA C C N +C+   +   VC ++G  +D+ C MK++ C  +  I+V     CG       G+  + +   + Q C      V +  P C CP+  C     ++CG+D  TY+N C ++  +C A + I  +Y   C+ CK  K  C+F   C + E+     CKCP+            VCG+D VTY SECH+K  +C +   +   ++GKC      D C ++QC YG +C         C C Y    N   +P     +CG +G++Y + C L   SC+K   +  +  + C +   S    PD  Q  R+ + G +  E  +  C P +    C +   ++  I +L     L+ +P                     C ++   +SD  Q   +C  C    LG+   +C          C             +  A   T   C + +C   + C  +    P CICP  C      +     VCGSD  TY N C LK+ +C     +  VS G C
Sbjct:  377 PCEKMECGFWGSCVVKPDR--TAECECPN-RCEDVMR--PVCATNGETFDNECEMKKKSCETKSMIKVKHQGTCGI------GVCATFDSCKKPQVC-----VVVDGKPKCVCPS--CTDEFKEVCGSDGKTYSNECRLQNAACMAQKNIFVKYNSACEACKLKKEKCDFYSACVVGENEKAE-CKCPDDCPSYEMEEGKEVCGTDGVTYSSECHMKKSACHQSKFVMTAFEGKC------DECLHVQCRYGEEC-----RSGVCVCSY----NCPANPPLSARICGENGVLYPSLCHLQLASCQKGAPISEMPPSHCHS---SKTSFPDSCQCNRVGSFGHTCDETGQCKCRPGVAGIKCDHCLPSFWGI-HLIAQGALSCRPC-------------------GCSAFGSSRSDCEQTTGKC-ECKNGALGDKCDLCPNGSMMTAGGC-------------VSPAVYKTPRDCHSLRCFHGAKCVPSPSSFPDCICPQSCNMNHLGIVANMTVCGSDGTTYSNLCELKMFACKHQIDVVPVSMGIC 852          

HSP 4 Score: 58.151 bits (139), Expect = 6.317e-8
Identity = 37/121 (30.58%), Postives = 60/121 (49.59%), Query Frame = 1
Query: 4378 VIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGA--KKPVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNI 4734
            ++ I  G + V +NLG    +  I+ N  ++DN WH+V   R  R   L +D +     +    D N L ++G ++LGGA  KK         + KF GC+  L +     NL++D+ K+I
Sbjct: 1346 LVFIEEGKLYVGVNLGADVHLKPISTNVTVADNHWHSVSFRRKERKCELWVDSKKILHVVASPGDVN-LDSNGLVYLGGANPKKHKLLKSLNLSNKFVGCVKNLKIFGAEVNLLVDSLKSI 1465          
BLAST of Agrin, putative vs. Ensembl Celegans
Match: lam-2 (Laminin-like protein lam-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18823])

HSP 1 Score: 81.2629 bits (199), Expect = 6.864e-15
Identity = 39/95 (41.05%), Postives = 54/95 (56.84%), Query Frame = 1
Query: 2392 RSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGC 2676
            + C C+ +GS  + CD +T QC CK G+TGQ CDRC D ++ F+ NGC  C C   GSE+  C++ +G+C CK    G+ C  C         GC
Sbjct:  944 QECNCDPLGSEGNTCDVNTGQCQCKPGVTGQRCDRCADYHFGFSANGCQPCDCEYIGSENQQCDVNSGQCLCKENVEGRRCDQCAENRYGITQGC 1038          

HSP 2 Score: 64.3142 bits (155), Expect = 7.768e-10
Identity = 28/57 (49.12%), Postives = 42/57 (73.68%), Query Frame = 1
Query: 2395 SCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGS 2565
            +C CN IGSL+ +CD +  +C CK G+TG++CD+C+DG+++F+ NGC  C C   GS
Sbjct:  402 ACGCNEIGSLSTQCD-NEGKCQCKPGVTGRFCDQCLDGFYDFSTNGCKNCGCETSGS 457          

HSP 3 Score: 64.3142 bits (155), Expect = 8.890e-10
Identity = 32/85 (37.65%), Postives = 46/85 (54.12%), Query Frame = 1
Query: 2431 ECDPSTTQCICKTGITGQYCDRCIDGYWNFTEN-GCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCP-IGYSISNHGCK 2679
            EC+    QC C   + G  CD+C  G++N T   GC  C+C+  GSE   C++ TG+C CKP   G+ C  C    +  S +GC+
Sbjct:  908 ECNQQDGQCDCLPNVIGIQCDQCAHGFYNITSGLGCQECNCDPLGSEGNTCDVNTGQCQCKPGVTGQRCDRCADYHFGFSANGCQ 992          

HSP 4 Score: 59.3066 bits (142), Expect = 2.589e-8
Identity = 33/75 (44.00%), Postives = 42/75 (56.00%), Query Frame = 1
Query: 2461 CKTGITGQYCDRCIDGYWNFT-ENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIG-YSISNHGCK 2679
            C+    G +C++CI  +W    EN C AC CN  GS S  C+ E GKC CKP   G++C  C  G Y  S +GCK
Sbjct:  375 CQGNTQGVHCEQCIANHWRRPGENYCVACGCNEIGSLSTQCDNE-GKCQCKPGVTGRFCDQCLDGFYDFSTNGCK 448          
BLAST of Agrin, putative vs. Ensembl Celegans
Match: lam-3 (LAMinin related. See also lmb; Laminin alpha chain [Source:UniProtKB/TrEMBL;Acc:G5ECE3])

HSP 1 Score: 75.8702 bits (185), Expect = 2.806e-13
Identity = 42/99 (42.42%), Postives = 56/99 (56.57%), Query Frame = 1
Query: 2395 SCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGS-ESIVCNIETGKCNCKPLAMGKYCSVCPIGYS--ISNHGCKE 2682
            +C CN  GS+  +CD  + QC CK G+ G+ CD+C   Y+NFT+ GC  C CN +GS E   C+  TGKC C+    G  C  C  GY    S  GC++
Sbjct:  987 ACDCNDTGSIGSDCDQVSGQCNCKQGVFGKQCDQCRPSYFNFTDAGCQFCHCNIYGSIEDGKCDQTTGKCECRENVEGTMCEKCADGYFNITSGDGCED 1085          

HSP 2 Score: 57.7658 bits (138), Expect = 9.719e-8
Identity = 27/75 (36.00%), Postives = 39/75 (52.00%), Query Frame = 1
Query: 2434 CDPSTTQCICKTGITGQYCDRCIDGYWNFTE-NGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGY 2655
            CDP    C+C     G+ C+ C    W++   NGC  C C+  GS+  +CN  TG+C CK   +G  C +C  G+
Sbjct: 1144 CDPIDGSCVCPPNTVGEMCENCTTNAWDYHPLNGCKLCDCSDIGSDGGMCNTFTGQCKCKAAYVGLKCDLCTHGF 1218          

HSP 3 Score: 55.0694 bits (131), Expect = 6.776e-7
Identity = 29/75 (38.67%), Postives = 42/75 (56.00%), Query Frame = 1
Query: 2461 CKTGITGQYCDRCIDGYWNFTEN---GCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGC 2676
            CK G TGQYC+ C+ GY+   ++    C+ C C+  GS    CN  +G+C CKP   G+ CS+C   ++  N  C
Sbjct: 1617 CKPGYTGQYCETCVAGYYGDPQHIGGTCSPCDCHPDGSLHGACNPLSGQCECKPGVTGRTCSMCQERHAFINRVC 1691          

HSP 4 Score: 54.299 bits (129), Expect = 9.326e-7
Identity = 32/83 (38.55%), Postives = 43/83 (51.81%), Query Frame = 1
Query: 2398 CLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACS-CNRFGSESIVCNIETGKCNCKPLAMGKYCSVC 2643
            C C+  GS +  C+  T QC+CK G+TG  CD C+  ++  T  GCT C  C   G    VC+   G C C P  +G+ C  C
Sbjct: 1086 CGCDPTGSEDVSCNLVTGQCVCKPGVTGLKCDSCLPNFYGLTSEGCTECEPCPAPGQ---VCDPIDGSCVCPPNTVGEMCENC 1165          
BLAST of Agrin, putative vs. Ensembl Celegans
Match: F29G6.1 (pep chromosome:WBcel235:X:11502267:11509432:1 gene:WBGene00009257.1 transcript:F29G6.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F29G6.1)

HSP 1 Score: 74.7146 bits (182), Expect = 5.510e-13
Identity = 120/507 (23.67%), Postives = 190/507 (37.48%), Query Frame = 1
Query:  889 KCDSSSSQICGTDEITYTNICEMKKVSCK-ANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNI-QCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPY--QYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACL----TKKPLWIIYNGICNEEP-----------------RCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGES--VCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSC------AENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKAC 2310
            +CD+S   +CGT+ +T+TN C ++K  C+ AN  IE  Y G C       C+ N               CP+           PVC S   T+Q+ CH  ++ C  + +      G   T  + ++C+ + +C+              C  +Y         PVC ++G    N+C L K+ C              ENN  +G K    Y  + CRI+N   S           +  PVC  + VT+ ++C + + AC+     KK + + Y G C  +P                  C+ +   C + ++ K+  +    EC   P+     S  VC ++G+T+ + C  +   C   +I+ K  NI    +C    C+  S                 C    +PVC S  RT+++ C      C       +N  +T   +G C               CP G         CTD+ S     +C    N Y N C    KAC
Sbjct:  790 ECDNSYDPLCGTNGVTFTNACSLQKEICESANSTIEVAYTGMC-------CDTN---------------CPSDFS--------PVCDSKGSTHQNICHFGVKRCIAERTF-----GDVLTIDKFEVCNEVKECNNA------------CPKEY--------SPVCASNGQNIVNECELDKIRC------------LVENNVTTGDKLVKDYDGECCRIENCDIS-----------VFSPVCDTEGVTHANMCLMDQNACIQMKKNKKTIQVSYQGQCCNQPCDEDKTPVCDGTITHPNICRFRIAQCEAERVNKTLSIAYSGECCLLPKGECESSGAVCDSEGQTHMNHCVYQQRRCMAQTISQKTLNIVHTGEC----CALAS-----------------CPKTGQPVCDSRGRTHDSLCHFHNSKCIFDKIHTQNTTLTLDYQGKC---------------CPAG---------CTDELSV----ICDQHENIYRNSCYFNLKAC 1169          

HSP 2 Score: 68.5514 bits (166), Expect = 4.702e-11
Identity = 138/560 (24.64%), Postives = 205/560 (36.61%), Query Frame = 1
Query:  892 CDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDIC---------------KFV---------KCEFNGICEMMEDGLGT------ICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCK-KKIS---LTVMYKGKCQTKIQS-DICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEK-QMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKP----LWIIYNGICNEEPRC-----KEQGKDCPS-----YQICKSDLVQAKCECPTCPQSGL-----GE-------------SVCGTDGKTYKSECHMRMHAC---ETNSIALKIANIGT-----CDKCKNKKC----SFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGK---MCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNK 2322
            C      IC +D  TY N+C+ +K  C  +  +E  + G+C  C                FV          CE+  +  + E G G       I  C  P E C      PVC     T+ +EC L IE+CK KK+    L V+ +G C+  + + D  SN          K  NT   CS   ++C N++ DP+CG +G+ + N C L K  CE     + V  +  C                   D N           CP    PVC +   T+++IC+     C+ ++     L I    +CNE   C     KE    C S        C+ D ++   E        L     GE              VC T+G T+ + C M  +AC   + N   ++++  G      CD+ K   C    +  +IC   RF   QC    +   V + +       Y  EC L  K   E+      SEG   +      + RC       K   +   G+C     C K    VC + G  +++ C      CI +K
Sbjct:  609 CTDDKHPICASDFSTYENLCQFRKQKC-LDSELEVLFKGKCSECLDSPCALPAENSPDESFVCLEDQSTKSLCEYQMLSCIFERGYGVNLTVQYIGVCCPPVESCDTEKPDPVCTDSGATFLTECELNIENCKLKKLDQPKLVVVSQGICEKDMLTDDFSSNRNFQKPNIEFKRENTF-NCS---MECDNSY-DPLCGTNGVTFTNACSLQKEICESANSTIEVAYTGMC------------------CDTN-----------CPSDFSPVCDSKGSTHQNICHFGVKRCIAERTFGDVLTIDKFEVCNEVKECNNACPKEYSPVCASNGQNIVNECELDKIRCLVENNVTTGDKLVKDYDGECCRIENCDISVFSPVCDTEGVTHANMCLMDQNACIQMKKNKKTIQVSYQGQCCNQPCDEDKTPVCDGTITHPNIC---RFRIAQC----EAERVNKTL----SIAYSGECCLLPKGECESSGAVCDSEGQTHMNHCVYQQRRCMAQTISQKTLNIVHTGECCALASCPKTGQPVCDSRGRTHDSLCHFHNSKCIFDK 1122          

HSP 3 Score: 57.3806 bits (137), Expect = 1.018e-7
Identity = 108/443 (24.38%), Postives = 169/443 (38.15%), Query Frame = 1
Query: 1096 PNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQ-----TKIQSDICSNI------QCHYGA-KCIK--------TSNTVAQCS---CDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVI----NSNFC------ENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQC-----ICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKAC 2310
            P PD  C   I+ PVCG+D+VTY + C L+    +    L   Y G C       K+ + IC N        CH+   +CI         T   + +CS   C++ +C NT  DPVC  +G +Y N C      CE Q+E   I    +  FC      +    +GV+    Y     D     T E         V P    D  T  S     ++   ++   +I  N +  +    K +    P   + ++DL +A C    C +S   + VC T  +T+K+ C  +  AC+ N I   + +I     C+ +K +  + C  +    P C       PT C +++   C + +   E    + +KSC E              QF   DE                  +C   CS+    VC    N ++N C  ++  C
Sbjct:   34 PPPDCDCPSVIR-PVCGTDNVTYNNLCFLRCVQ-RTNEDLLFFYNGTCCDKKECEKVGTPICDNFGETHINDCHFAQFQCIMKKSMGLSLTKLHMGRCSSKDCNH-NCTNTEFDPVCDTNGSVYRNLCVFQMRRCELQLESQRIQLAEDRKFCLRSRETQRFKLAGVESYTSYA----DEPYLETTE------ASTVAP----DLTTTASTTIPMKSEKPSRNETFI--NKVIAKTSASKHRENHSP---LTRNDLNRA-CSIKECDKS--WDPVCDTRNRTHKNVCQFKFFACKINKIDGSVIDIAHSGACRARKSTCIT-CPKDEKKIPICDNRNMTHPTLCSFIQYN-CEARNNEDEERVLVHIKSCHER-----------SPQFTLKDE------------------ICPRTCSRDVKPVCDEANNTHQNLCHFQQYNC 420          

HSP 4 Score: 56.6102 bits (135), Expect = 1.952e-7
Identity = 84/368 (22.83%), Postives = 130/368 (35.33%), Query Frame = 1
Query: 1363 RDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCE---NNPCS--GVKCPDPYQYCRIDNNGKSTCEC-------------------------PKEPC-PKIVQPVCGNDKVTYESICNLTRTACLTKK----PLWIIYNGICNEEPRCKEQGKDC----PSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVI 2349
            + P+C +D   Y+N C   K  C    E+ V+    C    ++PC+      PD    C  D + KS CE                          P E C  +   PVC +   T+ + C L    C  KK     L ++  GIC ++    +   +     P+ +  + +      EC         + +CGT+G T+ + C ++   CE+ +  +++A  G C                         C T+C     PVC S   T++N C   VK C   R    V      L   K       E C   K C N        C K    VC ++G    NECEL +  C+    +     ++
Sbjct:  613 KHPICASDFSTYENLCQFRKQKCLDS-ELEVLFKGKCSECLDSPCALPAENSPDESFVCLEDQSTKSLCEYQMLSCIFERGYGVNLTVQYIGVCCPPVESCDTEKPDPVCTDSGATFLTECELNIENCKLKKLDQPKLVVVSQGICEKDMLTDDFSSNRNFQKPNIEFKRENTFNCSMEC-----DNSYDPLCGTNGVTFTNACSLQKEICESANSTIEVAYTGMC-------------------------CDTNCPSDFSPVCDSKGSTHQNICHFGVKRCIAERTFGDV------LTIDKF------EVCNEVKECNNA-------CPKEYSPVCASNGQNIVNECELDKIRCLVENNVTTGDKLV 930          
BLAST of Agrin, putative vs. Ensembl Celegans
Match: epi-1 (Laminin-like protein epi-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21313])

HSP 1 Score: 74.7146 bits (182), Expect = 6.294e-13
Identity = 38/88 (43.18%), Postives = 47/88 (53.41%), Query Frame = 1
Query: 2392 RSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGY 2655
            + C CN  G++   C P   QC CK G  G +C+ C DGY N T  GC  C C+  GSE   C+  TG+C CKP   G  C  C +GY
Sbjct:  470 KPCECNVNGTIGDVCLPEDGQCPCKAGFGGTFCETCADGYTNVTA-GCVECVCDATGSEHGNCSASTGQCECKPAYAGLSCDKCQVGY 556          

HSP 2 Score: 72.7886 bits (177), Expect = 2.628e-12
Identity = 36/97 (37.11%), Postives = 52/97 (53.61%), Query Frame = 1
Query: 2392 RSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVC-PIGYSISNHGCK 2679
            + C C +  + N +C+    QC C+ G TG  C+ C  GYWN+ E+GC  C C    S   VC++ TG+C+C+  A G  C  C P    I  +GC+
Sbjct: 2035 QGCHCGT-AAFNTQCNVENGQCTCRPGATGMRCEHCEHGYWNYGEHGCDKCDCEADLSMGTVCDVRTGQCHCQEGATGSRCDQCLPSYLRIPTYGCR 2130          

HSP 3 Score: 67.781 bits (164), Expect = 9.837e-11
Identity = 50/200 (25.00%), Postives = 91/200 (45.50%), Query Frame = 1
Query: 2392 RSCLCNSIGSLN--HECDPSTTQCICKTGITGQYCDRCIDGYW---NFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDA----------VELGFLKDSFAKSYWSGNA-----ENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVE-YRVDLGSGAIF 2928
            RSC CN  G+++  + CD  T QC+CK    G+ CD+C DG++   ++ + GC +C C+  G+    C+I +G+C C+P   G  C        I NH     +++ N+ +A          V      + FA   W G A     ++ + I++ +   +   ++F + +        T+ +  R+   + V+    A F
Sbjct:  754 RSCDCNVNGTISGLNTCDLKTGQCMCKKNADGRRCDQCADGFYRLNSYNQMGCESCHCDIGGALRAECDITSGQCKCRPRVTGLRCD-----QPIENHYFP--TLWHNQYEAEDAHTEDQKPVRFAVDPEQFADFSWRGYAVFSPIQDKILIDVDITKATVYRLLFRYRNPTSVPVTATVTINPRFTHTHDVEQTGKATF 946          

HSP 4 Score: 65.4698 bits (158), Expect = 4.141e-10
Identity = 33/89 (37.08%), Postives = 47/89 (52.81%), Query Frame = 1
Query: 2392 RSCLCNSIGSL--NHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIG 2652
            + C C+  GS   N  CDP + QC+C+  + G+ CDRC+ G++ F    C  CSCNR G+   +C+    +C CK    G  C  C  G
Sbjct: 1504 QKCGCHPQGSEGGNLVCDPESGQCLCRESMGGRQCDRCLAGFYGFPH--CYGCSCNRAGTTEEICDATNAQCKCKENVYGGRCEACKAG 1590          

HSP 5 Score: 59.6918 bits (143), Expect = 2.721e-8
Identity = 30/86 (34.88%), Postives = 45/86 (52.33%), Query Frame = 1
Query: 2398 CLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGY 2655
            C C+ +G+    CD +T QC+CK G  G  CDRC   ++ +    C AC+C+  G  S  C+  +G+C C     G+ C  C  G+
Sbjct:  564 CNCDPMGTEGGVCDQTTGQCLCKEGFAGDKCDRCDIAFYGYPN--CKACACDGAGITSPECDATSGQCPCNGNFTGRTCDKCAAGF 647          

HSP 6 Score: 58.5362 bits (140), Expect = 6.147e-8
Identity = 34/83 (40.96%), Postives = 46/83 (55.42%), Query Frame = 1
Query: 2395 SCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVC 2643
            SC C + GS + +C+    QC CK G+ G+ C+RC  GY+NF E  C  C CN  G +   C+  TG+C C P   G+ C  C
Sbjct: 1414 SCDCVAQGSESFQCEQYGGQCKCKPGVIGRRCERCAPGYYNFPE--CIKCQCNA-GQQ---CDERTGQCFCPPHVEGQTCDRC 1490          

HSP 7 Score: 56.6102 bits (135), Expect = 2.062e-7
Identity = 32/89 (35.96%), Postives = 47/89 (52.81%), Query Frame = 1
Query: 2398 CLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTEN-GCTACSCNRFGSE--SIVCNIETGKCNCKPLAMGKYCSVCPIGY 2655
            C CN+      +CD  T QC C   + GQ CDRC+   + +    GC  C C+  GSE  ++VC+ E+G+C C+    G+ C  C  G+
Sbjct: 1461 CQCNA----GQQCDERTGQCFCPPHVEGQTCDRCVSNAFGYDPLIGCQKCGCHPQGSEGGNLVCDPESGQCLCRESMGGRQCDRCLAGF 1545          

HSP 8 Score: 53.9138 bits (128), Expect = 1.549e-6
Identity = 28/84 (33.33%), Postives = 45/84 (53.57%), Query Frame = 1
Query: 2392 RSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVC 2643
            ++C C+  G  + ECD ++ QC C    TG+ CD+C  G++N+ +  C  C C   G++   C+   G+C CK    G+ C  C
Sbjct:  608 KACACDGAGITSPECDATSGQCPCNGNFTGRTCDKCAAGFYNYPD--CRGCECLLSGAKGQTCD-SNGQCYCKGNFEGERCDRC 688          

HSP 9 Score: 52.7582 bits (125), Expect = 3.272e-6
Identity = 24/77 (31.17%), Postives = 44/77 (57.14%), Query Frame = 1
Query: 2785 INISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVID 3015
                + P S +GIIF    T++ +D++ ++L++  V +  D GSG + +KS   +  GR H+I V R  + + L++D
Sbjct: 3336 FTFKIRPTSDNGIIFIA--TNKRTDHIAVMLEHGRVVFTYDTGSGQVIIKSDKSIIDGRWHTIKVSRRGKSAHLIVD 3410          

HSP 10 Score: 52.373 bits (124), Expect = 3.649e-6
Identity = 27/72 (37.50%), Postives = 43/72 (59.72%), Query Frame = 1
Query: 2455 CICKTGITGQYCDRCIDGYWNFT---ENGCTACSCNRFGSESIV--CNIETGKCNCKPLAMGKYCSVCPIGY 2655
            C C+  +TG+ CD+C   +W+     E+GC +C CN  G+ S +  C+++TG+C CK  A G+ C  C  G+
Sbjct:  724 CSCRKHVTGRICDQCKPTFWDLQYHHEDGCRSCDCNVNGTISGLNTCDLKTGQCMCKKNADGRRCDQCADGF 795          

HSP 11 Score: 51.6026 bits (122), Expect = 7.208e-6
Identity = 30/83 (36.14%), Postives = 40/83 (48.19%), Query Frame = 1
Query: 2434 CDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKE 2682
            C   T +C C     G+ CD+C  GY++  +  C  C CN  G+   VC  E G+C CK    G +C  C  GY+    GC E
Sbjct:  438 CAEETGKCECLPRFVGEDCDQCASGYYDAPK--CKPCECNVNGTIGDVCLPEDGQCPCKAGFGGTFCETCADGYTNVTAGCVE 518          
BLAST of Agrin, putative vs. Ensembl Fly
Match: SP2353 (gene:FBgn0034070 transcript:FBtr0087209)

HSP 1 Score: 102.834 bits (255), Expect = 2.124e-21
Identity = 131/544 (24.08%), Postives = 220/544 (40.44%), Query Frame = 1
Query: 2575 VCNIETGK---CNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDR-SSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVID-GTDSQYGMNPPF--LTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHK----PCLNGGLCQTSSEEMYSCQCLPGYQGITCE-EVVSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQ----GPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHE 4158
             CN++ G    C  +  A    C +CP G +   +GC+E+      + A    F K S+        A  ++ + I   P S DGII    + D  + D++ ++L   +VE+  D GSG   ++SR  + +   +S+++ R   D+ LV++ GT  Q   N  F  +T  +  F+  IG  TG     L+    + +GF GC+           + ++ N+      E        P  D  N  D+ +                  C T K    PC +GG C   S++   C C  G+ G  CE  +   +  F  +SF+ +          L+L++T  P   +GL+ +   G +    FI++ LN   +E       G   + S  S  +G+W+ + I + A+   L ++   + +   +   GF +++             +Q +F GGV+             KP F G IQ+I IN  ++      +  +NI          PCGPL             CVP+M    C CS  +E
Sbjct:  361 TCNLDCGSDGICALEATAASSRC-LCPFGKT--GNGCQED------IRAHVPRFAKRSWLAFPALHGAYKHVQLRIEFRPESFDGIILLSGERDDLTGDFMALLLNKGFVEFWFDCGSGVGSVRSRETILLNEWNSVIIYRHRWDAWLVLNHGTKVQGRSNGLFSRITFREPVFLGGIGNITG-----LAKRLPLAEGFAGCI-----------RRFVANEHDYKFTEH-------PLGDVINGFDIQD------------------CSTDKCVRYPCQHGGKC-LPSDQGAICLCPIGFVGDLCEIRMDLQVPAFNGSSFLRYAPLGDSALIWLELKVTLKPEQADGLILY--SGPEHRGDFIALYLNDGFVEFAFDLGSGPALVRSEHSLSLGQWHTIKISRTARLAVLKVDKHQEVLT--ISSNGFWHLS------------LDQNLFVGGVNHVDRLPLDLK--YKPFFVGCIQRIDINGHSLGIVAEALGGSNIGNCPHACVARPCGPLAE-----------CVPQMESYECRCSIHNE 824          

HSP 2 Score: 100.138 bits (248), Expect = 1.172e-20
Identity = 120/470 (25.53%), Postives = 210/470 (44.68%), Query Frame = 1
Query: 3373 CLNGGLCQTSSEEMYS-CQCLPGYQGITCEE-VVSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDI--ILN--NITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKH-ENLC-IRNSMQHDNPA-NTNFFRKY--LGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWE--YNTKFKGCISELYVDEISYNLVLDA--RKNIG 4737
            C + G+C   +    S C C  G  G  C+E + +H+ +F   S++ FP+     +  ++L I F P + +G++    +  D    F+++ LNK  +E       GV  + S E+ L+ +WN V+I +     +L LNH  + ++ R         N L SR    FR   +P+F GG+        +  + L   F G I++ + N+ + +F    +  ++N  +I       C  ++ PC       G C+P     IC C      +LC IR  +Q   PA N + F +Y  LG SA  +  +K             +  K    DG+  +L      +  F+ + + +G +E A +LG    ++R     ++S  +WHT+++ R  R  VL +D        + +N +  L+ D  +++GG    V+  P +  Y   F GCI  + ++  S  +V +A    NIG
Sbjct:  366 CGSDGICALEATAASSRCLCPFGKTGNGCQEDIRAHVPRFAKRSWLAFPALHGAYKH-VQLRIEFRPESFDGIILLSGERDDLTGDFMALLLNKGFVEFWFDCGSGVGSVRSRETILLNEWNSVIIYRHRWDAWLVLNHGTK-VQGR--------SNGLFSR--ITFR---EPVFLGGI--GNITGLAKRLPLAEGFAGCIRRFVANEHDYKFTEHPLGDVINGFDIQDCSTDKC--VRYPCQ----HGGKCLPSDQGAICLCPIGFVGDLCEIRMDLQ--VPAFNGSSFLRYAPLGDSALIWLELK-------------VTLKPEQADGL--ILYSGPEHRGDFIALYLNDGFVEFAFDLGSGPALVR--SEHSLSLGQWHTIKISRTARLAVLKVDKHQ-EVLTISSNGFWHLSLDQNLFVGGVNH-VDRLPLDLKYKPFFVGCIQRIDINGHSLGIVAEALGGSNIG 791          
BLAST of Agrin, putative vs. Ensembl Fly
Match: SP2353 (gene:FBgn0034070 transcript:FBtr0340019)

HSP 1 Score: 102.834 bits (255), Expect = 2.124e-21
Identity = 131/544 (24.08%), Postives = 220/544 (40.44%), Query Frame = 1
Query: 2575 VCNIETGK---CNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDR-SSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVID-GTDSQYGMNPPF--LTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHK----PCLNGGLCQTSSEEMYSCQCLPGYQGITCE-EVVSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQ----GPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHE 4158
             CN++ G    C  +  A    C +CP G +   +GC+E+      + A    F K S+        A  ++ + I   P S DGII    + D  + D++ ++L   +VE+  D GSG   ++SR  + +   +S+++ R   D+ LV++ GT  Q   N  F  +T  +  F+  IG  TG     L+    + +GF GC+           + ++ N+      E        P  D  N  D+ +                  C T K    PC +GG C   S++   C C  G+ G  CE  +   +  F  +SF+ +          L+L++T  P   +GL+ +   G +    FI++ LN   +E       G   + S  S  +G+W+ + I + A+   L ++   + +   +   GF +++             +Q +F GGV+             KP F G IQ+I IN  ++      +  +NI          PCGPL             CVP+M    C CS  +E
Sbjct:  361 TCNLDCGSDGICALEATAASSRC-LCPFGKT--GNGCQED------IRAHVPRFAKRSWLAFPALHGAYKHVQLRIEFRPESFDGIILLSGERDDLTGDFMALLLNKGFVEFWFDCGSGVGSVRSRETILLNEWNSVIIYRHRWDAWLVLNHGTKVQGRSNGLFSRITFREPVFLGGIGNITG-----LAKRLPLAEGFAGCI-----------RRFVANEHDYKFTEH-------PLGDVINGFDIQD------------------CSTDKCVRYPCQHGGKC-LPSDQGAICLCPIGFVGDLCEIRMDLQVPAFNGSSFLRYAPLGDSALIWLELKVTLKPEQADGLILY--SGPEHRGDFIALYLNDGFVEFAFDLGSGPALVRSEHSLSLGQWHTIKISRTARLAVLKVDKHQEVLT--ISSNGFWHLS------------LDQNLFVGGVNHVDRLPLDLK--YKPFFVGCIQRIDINGHSLGIVAEALGGSNIGNCPHACVARPCGPLAE-----------CVPQMESYECRCSIHNE 824          

HSP 2 Score: 100.138 bits (248), Expect = 1.172e-20
Identity = 120/470 (25.53%), Postives = 210/470 (44.68%), Query Frame = 1
Query: 3373 CLNGGLCQTSSEEMYS-CQCLPGYQGITCEE-VVSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDI--ILN--NITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKH-ENLC-IRNSMQHDNPA-NTNFFRKY--LGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWE--YNTKFKGCISELYVDEISYNLVLDA--RKNIG 4737
            C + G+C   +    S C C  G  G  C+E + +H+ +F   S++ FP+     +  ++L I F P + +G++    +  D    F+++ LNK  +E       GV  + S E+ L+ +WN V+I +     +L LNH  + ++ R         N L SR    FR   +P+F GG+        +  + L   F G I++ + N+ + +F    +  ++N  +I       C  ++ PC       G C+P     IC C      +LC IR  +Q   PA N + F +Y  LG SA  +  +K             +  K    DG+  +L      +  F+ + + +G +E A +LG    ++R     ++S  +WHT+++ R  R  VL +D        + +N +  L+ D  +++GG    V+  P +  Y   F GCI  + ++  S  +V +A    NIG
Sbjct:  366 CGSDGICALEATAASSRCLCPFGKTGNGCQEDIRAHVPRFAKRSWLAFPALHGAYKH-VQLRIEFRPESFDGIILLSGERDDLTGDFMALLLNKGFVEFWFDCGSGVGSVRSRETILLNEWNSVIIYRHRWDAWLVLNHGTK-VQGR--------SNGLFSR--ITFR---EPVFLGGI--GNITGLAKRLPLAEGFAGCIRRFVANEHDYKFTEHPLGDVINGFDIQDCSTDKC--VRYPCQ----HGGKCLPSDQGAICLCPIGFVGDLCEIRMDLQ--VPAFNGSSFLRYAPLGDSALIWLELK-------------VTLKPEQADGL--ILYSGPEHRGDFIALYLNDGFVEFAFDLGSGPALVR--SEHSLSLGQWHTIKISRTARLAVLKVDKHQ-EVLTISSNGFWHLSLDQNLFVGGVNH-VDRLPLDLKYKPFFVGCIQRIDINGHSLGIVAEALGGSNIG 791          
BLAST of Agrin, putative vs. Ensembl Fly
Match: CG32354 (gene:FBgn0052354 transcript:FBtr0076662)

HSP 1 Score: 99.7525 bits (247), Expect = 8.237e-21
Identity = 121/521 (23.22%), Postives = 196/521 (37.62%), Query Frame = 1
Query:  823 QSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSC-KANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRD-PVCGNDGIIYDNKCFLMKMSCE----KQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNK--KCSFYSICQ-MNRFLEPQCICPTDCVYVRR---PVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLR---VCGTDGNYYENECELKRKACIDNKTIRVAP 2340
            +SCPP  T    P                 +CG+D + Y NICE++K +C ++   + +     C+  K   C+    C   +D                     PVCG+D  TY + C L+++SC+  ++   +                   H G  C  TS     C    +DC +  +D PVC +DG +Y++ C +   +C     K    H  ++  C                              +E C ++ +P CG+D   Y S C +  + C   K ++ +    C  + R       CP+             ECP        + VCG+DG  Y S C ++M  C     +++  ++   DKCKN+  +C     C+  N             ++  +    +CG+D +TY NEC L   +C   R +     GPC      P ++                  C D C++  L    VCG+DGN + + CE KR+ C     +RV P
Sbjct:  166 RSCPPSITVGAEP-----------------VCGSDGLIYANICELRKKTCSRSGVSLIKDVRDGCERSKGSDCKHR--CSTEKD---------------------PVCGTDGRTYLNRCMLRVQSCRVGLAAVKLS------------------HVGP-CSNTSAVRESCP---VDCNSAPKDGPVCSSDGNVYNSTCEMKLKTCGQGVVKTSRKHCQSTRMC------------------------------RESCWRVARPTCGSDGRLYASPCKMRSSNC--GKHVFEVPLSYCMSQER-HGASDACPT-------------ECPKSDTDSSSQYVCGSDGNIYSSLCELKMLNCGPQRKSIQKVSM---DKCKNRLTRCKQLPPCKDFNSLF--------GSIFSSKRNDKLCGTDAKTYNNECELAHATCL--RGVNLAHIGPC-TDLNSPTKD------------------CGDACTRADLEQQPVCGSDGNTFASMCEFKRRTC----DLRVVP 542          

HSP 2 Score: 88.1965 bits (217), Expect = 3.612e-17
Identity = 134/569 (23.55%), Postives = 207/569 (36.38%), Query Frame = 1
Query:  661 VCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKAN-RFIEQQYVGRCDICKFVKCEFNGICEMM-EDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPK-----IVQPVCGNDKVTYESICNLTRTAC-LTKKPLWIIYNGIC-NEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAP 2340
            VCGSDG+ Y + C ++++ C        S + +   K+  +DG  +S    C+H                      +C +    +CGTD  TY N C ++  SC+     ++  +VG C     V+      C    +DG                    PVC SD   Y S C +K+++C + +  T                S   C     C ++   VA+              P CG+DG +Y + C +   +C K    HV                  P  YC       ++  CP E CPK       Q VCG+D   Y S+C L    C   +K +  +    C N   RCK Q   C  +      +  +K            + +CGTD KTY +EC +    C      + +A+IG C    +        C             T     ++PVCGSD  T+ + C  K ++C  +  +  VS   C L         C  DC                 ++    VCG+D N Y++EC ++++ C   K + V P
Sbjct:  179 VCGSDGLIYANICELRKKTC--------SRSGVSLIKDV-RDGCERSKGSDCKH----------------------RCSTEKDPVCGTDGRTYLNRCMLRVQSCRVGLAAVKLSHVGPCSNTSAVRESCPVDCNSAPKDG--------------------PVCSSDGNVYNSTCEMKLKTCGQGVVKT----------------SRKHCQSTRMCRESCWRVAR--------------PTCGSDGRLYASPCKMRSSNCGK----HVFEV---------------PLSYCMSQERHGASDACPTE-CPKSDTDSSSQYVCGSDGNIYSSLCELKMLNCGPQRKSIQKVSMDKCKNRLTRCK-QLPPCKDFNSLFGSIFSSK----------RNDKLCGTDAKTYNNECELAHATCLR---GVNLAHIGPCTDLNSPTKDCGDAC-------------TRADLEQQPVCGSDGNTFASMCEFKRRTC--DLRVVPVSLKNCAL------TADCESDCD----------------AQPPSFVCGSDNNLYKSECHMRKENC--GKHVFVVP 593          
BLAST of Agrin, putative vs. Ensembl Fly
Match: wb (gene:FBgn0261563 transcript:FBtr0302731)

HSP 1 Score: 86.6557 bits (213), Expect = 2.071e-16
Identity = 64/192 (33.33%), Postives = 94/192 (48.96%), Query Frame = 1
Query: 2158 EERCPE-DC-PLGKMCRN------GQCVCTDKCSKVKLRVCGTDGNYYENE--------CELKRKACIDNKTIRVAPSVIGCISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTEN-GCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIG-YSISNHGCK 2679
            E RCP  +C PLG + ++      GQC C +     K   C  DG +  N           L++ +  D+    + P      S + +A E+    C C+S+GSL+ +CD  T QC C   +TG+ CD+C  G+WN T   GC  C C+  GS    CN  TG+C+CK    G++C+ C  G +  S  GC+
Sbjct: 1059 ELRCPSCNCDPLGSLVQDRCDPHTGQCHCKEGVMGAKCHEC-QDGYFGMNAVAYRMDDLAALRQNSDSDDDEWELVPDTEDPNSESTVACEE----CHCSSVGSLSSDCDKRTGQCACLANVTGRRCDKCRPGHWNLTAGEGCRDCRCDPHGSRGHECNPWTGQCDCKIGVGGQHCNECTEGFFGFSTEGCQ 1245          

HSP 2 Score: 73.1738 bits (178), Expect = 2.228e-12
Identity = 37/87 (42.53%), Postives = 48/87 (55.17%), Query Frame = 1
Query: 2392 RSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIG 2652
            R C C+  GS  HEC+P T QC CK G+ GQ+C+ C +G++ F+  GC  CS  R  SE  VC+   G+C C     G  C  C  G
Sbjct: 1197 RDCRCDPHGSRGHECNPWTGQCDCKIGVGGQHCNECTEGFFGFSTEGCQRCSACR--SEGQVCDPHNGRCICPKFTRGLGCGQCVPG 1281          

HSP 3 Score: 62.7734 bits (151), Expect = 4.126e-9
Identity = 31/76 (40.79%), Postives = 44/76 (57.89%), Query Frame = 1
Query: 2434 CDPSTTQCI-CKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYS 2658
            C+ +T +CI C+    G +C+RC  GYW     GC  C C+  GSES +C+   G+C CKP   G+ C  C +GY+
Sbjct:  981 CNVTTGECITCRGNTEGWHCERCKLGYWGDPAVGCDPCHCHTEGSESGLCDSTDGQCLCKPRYAGQKCDECDVGYA 1056          

HSP 4 Score: 58.151 bits (139), Expect = 8.155e-8
Identity = 34/89 (38.20%), Postives = 46/89 (51.69%), Query Frame = 1
Query: 2392 RSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGS-----ESIVCNIETGKCNCKPLAMGKYCSVC 2643
            R C C+ IGS+  +C     QC C+ G +G+ CD C  GY+ + E  C  C C+  GS      SI C+   G+C CK L +G  C  C
Sbjct: 1292 RECECDHIGSIGQQCSTGDGQCQCREGYSGRKCDTCAIGYFGYPE--CRRCGCDAEGSFTQADGSIACD-SNGQCPCKSLVVGLKCDTC 1377          
BLAST of Agrin, putative vs. Ensembl Fly
Match: wb (gene:FBgn0261563 transcript:FBtr0305063)

HSP 1 Score: 86.6557 bits (213), Expect = 2.199e-16
Identity = 64/192 (33.33%), Postives = 94/192 (48.96%), Query Frame = 1
Query: 2158 EERCPE-DC-PLGKMCRN------GQCVCTDKCSKVKLRVCGTDGNYYENE--------CELKRKACIDNKTIRVAPSVIGCISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTEN-GCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIG-YSISNHGCK 2679
            E RCP  +C PLG + ++      GQC C +     K   C  DG +  N           L++ +  D+    + P      S + +A E+    C C+S+GSL+ +CD  T QC C   +TG+ CD+C  G+WN T   GC  C C+  GS    CN  TG+C+CK    G++C+ C  G +  S  GC+
Sbjct: 1059 ELRCPSCNCDPLGSLVQDRCDPHTGQCHCKEGVMGAKCHEC-QDGYFGMNAVAYRMDDLAALRQNSDSDDDEWELVPDTEDPNSESTVACEE----CHCSSVGSLSSDCDKRTGQCACLANVTGRRCDKCRPGHWNLTAGEGCRDCRCDPHGSRGHECNPWTGQCDCKIGVGGQHCNECTEGFFGFSTEGCQ 1245          

HSP 2 Score: 73.1738 bits (178), Expect = 2.314e-12
Identity = 37/87 (42.53%), Postives = 48/87 (55.17%), Query Frame = 1
Query: 2392 RSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIG 2652
            R C C+  GS  HEC+P T QC CK G+ GQ+C+ C +G++ F+  GC  CS  R  SE  VC+   G+C C     G  C  C  G
Sbjct: 1197 RDCRCDPHGSRGHECNPWTGQCDCKIGVGGQHCNECTEGFFGFSTEGCQRCSACR--SEGQVCDPHNGRCICPKFTRGLGCGQCVPG 1281          

HSP 3 Score: 62.3882 bits (150), Expect = 4.332e-9
Identity = 31/76 (40.79%), Postives = 44/76 (57.89%), Query Frame = 1
Query: 2434 CDPSTTQCI-CKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYS 2658
            C+ +T +CI C+    G +C+RC  GYW     GC  C C+  GSES +C+   G+C CKP   G+ C  C +GY+
Sbjct:  981 CNVTTGECITCRGNTEGWHCERCKLGYWGDPAVGCDPCHCHTEGSESGLCDSTDGQCLCKPRYAGQKCDECDVGYA 1056          

HSP 4 Score: 58.151 bits (139), Expect = 8.569e-8
Identity = 34/89 (38.20%), Postives = 46/89 (51.69%), Query Frame = 1
Query: 2392 RSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGS-----ESIVCNIETGKCNCKPLAMGKYCSVC 2643
            R C C+ IGS+  +C     QC C+ G +G+ CD C  GY+ + E  C  C C+  GS      SI C+   G+C CK L +G  C  C
Sbjct: 1292 RECECDHIGSIGQQCSTGDGQCQCREGYSGRKCDTCAIGYFGYPE--CRRCGCDAEGSFTQADGSIACD-SNGQCPCKSLVVGLKCDTC 1377          
BLAST of Agrin, putative vs. Ensembl Zebrafish
Match: agrn (agrin [Source:ZFIN;Acc:ZDB-GENE-030131-1033])

HSP 1 Score: 282.337 bits (721), Expect = 3.761e-76
Identity = 236/768 (30.73%), Postives = 334/768 (43.49%), Query Frame = 1
Query:  538 DPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPN----PDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENN---PCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNG----------QCVCTDKCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRVA-----PSVIG----------CISHNYIADEKNKRS------------CLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF----TEN--GCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGC 2676
            D C    C FGA C++   +P    C C    C +      VCGSD   Y + C +++ +C  Q+ I+V     C  K+             C   +C   +TC+ +       C CP    +     +CG+D + Y + CE+   +C   + I   + GRCD C       +  C +       I   P     PDE+       P+C SD  TY+S C ++  + K  + L  +  G C+ K     C N  C + A C+   N   +CSCD + C  T++ P+CG DG  Y N C      C  Q ++ V     C+ N   PC    C   +    +  N ++ CEC  + CP+   PVCG+D  TY S C +    C  +K + + + G C +     E   +C    IC  D    +C CP  C ++   + VCG+DG TY +EC + + AC T  + LK+   G C  C +  CS+ S C  N+     C C        +PVCGSD  TY N+C L++ SC + R I     G C             E C   +  R G          +CVC   C  V    VCG+DGN Y ++CELK+  C     + V      P+++           C    Y   E NK +            C CN  GS    CDPST QC CK G+ G  CDRC  G+WNF    TEN  GCT C+C+  GS    C   +G C+CKP   G  C+VCP G  +  +GC
Sbjct:  167 DGCRGKLCGFGAVCERDQADPSKGECVCKKIVCTS--VVAPVCGSDSSTYSNECELEKAQCNTQRRIKVMRKGPCALKDP------------CSEVTCSFGSTCIQSSDGLSAKCMCPLSCENVPKHVVCGSDGLDYQSECELNMKACATQKNIRVHHQGRCDPCSDTLNSLSTACRVNPKTYQQITFAPAESCPPDEM-------PICASDGHTYESMCQMERTALKNNLELKKVSLGSCKEK---GGCPN-GCKFNAICL-LDNGEFRCSCDPIQCDGTYK-PLCGKDGKTYPNDCERKLQECRTQKDIPVKQQGPCDLNLESPCLKKTC--EFGAVCVVKNSEAVCEC-SDACPQDQDPVCGSDGHTYSSSCQMKAMGCALQKQIQMQHKGPCAD-----ESCTNCSFGAIC--DAQTGRCVCPKGCLET--RQPVCGSDGTTYDNECKLNVQAC-TKQLDLKVVAHGECKTCGSTVCSWGSQCVNNK-----CECQQCTGQPVKPVCGSDGNTYNNDCELRLASCQKQRKIEVAKPGVCDEDCGSGGSGSGSETCEQDRCRRYGGTWDDDMEDERCVCELNCQIVLHSPVCGSDGNTYSSDCELKKTRCEKQIDLSVQSQGPCPTIVSPPPELVASQHCSQTVYGCCEDNKTAALGVGLAGCPSMCQCNHYGSYGGTCDPSTGQCSCKPGVGGLKCDRCEPGFWNFRGIVTENMSGCTPCNCDGVGSVRDDCEQMSGLCSCKPGVKGMKCNVCPDGSKMGVNGC 889          

HSP 2 Score: 153.68 bits (387), Expect = 8.869e-37
Identity = 161/691 (23.30%), Postives = 290/691 (41.97%), Query Frame = 1
Query: 2725 FLKDSFAKSYWS-GNAENYLSINISLVPYSSD--GIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNV-----KPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKP-----CLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV----SHIWKFKDNSFVIFP---SESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEK-GFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK--PVEGFPWEYNTKFKGCISELYVDEISYNLVLDA 4722
            F+     KSY +    + Y ++ I++   +S+  GI+ Y+    +  D+L++ L   YVE R + GSG   + S+V +  GR H ++V R  R++ L +D   S  G +PP    L+      IG     +   +     V+ G VGC+  L +       +Y + +    ++  S +      P  P+     +   +++ +                  H P     C     CQ   E  Y C+C  G +G  CE+V     + I  F  +SF+      + +  LRQ+  + I  L   + G++ +     D    FIS++LN   LE       G   + S E   + +WN V + +A++   +++N             G   V      + T   +K + +F GG     F   +   ++K  F GAIQKI +    I   ++ +   +++ +          PCSK   E  G C P++N   C C         ++++   +  +T     + G +  +Y     K +K+   N   +  +T +  G+ IL       +  ++ +AI +G +++  +LG K  VLR T    ++ N W  ++  R  R+  L + +    A +  ++      L TDG +WLGG ++       P  Y+T F GC+ ++ VD +  +LV DA
Sbjct: 1359 FIPSFGGKSYMAFQTMKAYHTVRIAMEFRASEMTGILLYNGQKSKK-DFLSLTLVEGYVELRFNTGSGTASVISKVLVKPGRWHQLVVVRNRRNAMLSVDNEPSVEGQSPPGTDGLNLDTDLFIGGVLDDMSADVKERTSVSAGLVGCIRMLDVN----NLVYNLQENGGSVLYGSAIGECGNNPCLPNPCKNGASCQVKEAEIFHCKCVNGFSGPTCADAHNPCDPNKCHPPSRCQVLPEGGYKCECPMGREGRHCEKVSDKGGAFIPYFTGDSFLELKGLHTYNQDLRQKFSMTIVLLANDSKGMIFYNGQKTDGKGDFISLSLNDGILEFRYDLGKGPAVIRSKEKIKLNEWNTVNLERASRKGEISIN-------------GKDPVRGEAPNQHTDLNLK-ESLFVGGA--PDFRKVARAAAIKDGFKGAIQKITLMGIPILKADNALSSTDVSMYP-------NHPCSKDVCENGGRCNPQLNSYECACRHGFSGHHCQDTIFEKSAGDTEAI-AFDGHTFIEYHNGVTKSEKALLVNKFELSIRTEATHGL-ILWSGKGVERSDYIALAIVDGRVQMTYDLGSKPVVLRST--VRVNTNHWIRIKASRALRDGSLQVGN---EAAVTGSSPLAATQLDTDGALWLGGLEELSVARRLPKAYSTGFIGCVKDVIVDGVELHLVEDA 2014          

HSP 3 Score: 122.479 bits (306), Expect = 3.595e-27
Identity = 154/567 (27.16%), Postives = 223/567 (39.33%), Query Frame = 1
Query:  535 DDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQ-------TKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDP----YQYCR------IDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGICNEE-PRCKEQGKDCPSYQICKSDLVQAKCECPTCPQ-SGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSIC-QMNRFLEPQCICPT-DCVYVRRP-VCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK 2136
            + PC K  C+FGA C         AVC CS+      Q +  VCGSDG  Y S C MK   C LQK IQ+     C    A +   + S    C  Q+              C CP   C  +   +CG+D  TY N C++   +C     ++    G C  C    C +   C      +   C+C    + CT     PVCGSD  TY ++C L++ SC+K+  + V   G C        +   S+ C   +C              +C C+ L+C+     PVCG+DG  Y + C L K  CEKQ+++ V +       PC  +  P P     Q+C        ++N  +        CP + Q    N   +Y   C+ +   C  K           +P +  + GI  E    C     +C      + D  Q    C   P   G+  +VC    K       M ++ C+    A K         C    C F S C ++N   +  C CP+ DC    +  VCGSD  TY + C LK  +C +++ I     G CK
Sbjct:  463 ESPCLKKTCEFGAVCVV---KNSEAVCECSDA---CPQDQDPVCGSDGHTYSSSCQMKAMGCALQKQIQMQHKGPC----ADESCTNCSFGAICDAQT------------GRCVCPKG-CLETRQPVCGSDGTTYDNECKLNVQACTKQLDLKVVAHGECKTCGSTVCSWGSQC------VNNKCEC----QQCTGQPVKPVCGSDGNTYNNDCELRLASCQKQRKIEVAKPGVCDEDCGSGGSGSGSETCEQDRCRRYGGTWDDDMEDERCVCE-LNCQIVLHSPVCGSDGNTYSSDCELKKTRCEKQIDLSVQS-----QGPCPTIVSPPPELVASQHCSQTVYGCCEDNKTAALGVGLAGCPSMCQ---CNHYGSYGGTCDPSTGQCSCKPGVGGLKCDRCEPGFWNFRGIVTENMSGCTPC--NCDGVGSVRDDCEQMSGLCSCKPGVKGMKCNVCPDGSK-------MGVNGCDKGPKAPK--------SCAELVCHFGSSCVEVNG--QAHCECPSPDCDEKNKTKVCGSDGVTYADRCQLKTIACRQDKEIKVEHLGQCK 968          

HSP 4 Score: 121.324 bits (303), Expect = 6.712e-27
Identity = 119/417 (28.54%), Postives = 174/417 (41.73%), Query Frame = 1
Query: 1543 KSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNR------FLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMC--RNGQCVCT---DKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRV-----------APSVIGCISHNYIADEKNKRS-CLCNSI---------GSLNH----ECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKEN 2685
            K  C C K  C  +V PVCG+D  TY + C L +  C T++ + ++  G C  +  C E      S  I  SD + AKC CP   ++     VCG+DG  Y+SEC + M AC T    +++ + G CD C +   S  + C++N          P   CP D      P+C SD  TYE+ C ++  +   N  +  VS G CK      ++  CP  C    +C   NG+  C+    +C      +CG DG  Y N+CE K + C   K I V           +P +        +   KN  + C C+           GS  H     C      C  +  I  Q+   C D         CT CS   FG+   +C+ +TG+C C    +     VC    +  ++ CK N
Sbjct:  189 KGECVCKKIVCTSVVAPVCGSDSSTYSNECELEKAQCNTQRRIKVMRKGPCALKDPCSEVTCSFGSTCIQSSDGLSAKCMCPLSCENVPKHVVCGSDGLDYQSECELNMKACATQK-NIRVHHQGRCDPCSDTLNSLSTACRVNPKTYQQITFAPAESCPPD----EMPICASDGHTYESMCQMERTALKNNLELKKVSLGSCK------EKGGCPNGCKFNAICLLDNGEFRCSCDPIQCDGTYKPLCGKDGKTYPNDCERKLQECRTQKDIPVKQQGPCDLNLESPCLKKTCEFGAVCVVKNSEAVCECSDACPQDQDPVCGSDGHTYSSSCQMKAMGCALQKQIQMQHKGPCAD-------ESCTNCS---FGA---ICDAQTGRCVCPKGCLETRQPVCGSDGTTYDNECKLN 581          

HSP 5 Score: 70.0922 bits (170), Expect = 2.994e-11
Identity = 90/457 (19.69%), Postives = 180/457 (39.39%), Query Frame = 1
Query: 3367 KPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSH-IWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQ-NSDIIL---------NN-------------------------ITQWQGPPCGPLQSPCSKTD---PEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDR-MFRAQMLDNNDYNTLATDGWMWLGGA 4617
            +PC +GG C+    + ++C C  G  G  CE+V+ + I  F   S++ F  ++++    +++ + F      G+L +  +G      F+S+TL + ++E+   T  G   +IS      G+W+ +V+++  +   L++++ P    +       LN+++               +F GGV  +         S+     G I+ + +N+     Q N   +L         NN                         +  + GP C    +PC       P +   +PE     C C    E    R+  +  +     F   + G S  +   +         K ++ I      + GM+    +    K  F+ +++ +G++E   +LG    V+R    + I  N+W+TV + R +R   + I+ +   R +    N +  L     +++GGA
Sbjct: 1324 QPCRHGGTCEEDDND-FTCICPAGRGGAVCEKVIKYFIPSFGGKSYMAF--QTMKAYHTVRIAMEFRASEMTGILLY--NGQKSKKDFLSLTLVEGYVELRFNTGSGTASVISKVLVKPGRWHQLVVVRNRRNAMLSVDNEPSVEGQSPPGTDGLNLDT--------------DLFIGGVLDDMSADVKERTSVSAGLVGCIRMLDVNNLVYNLQENGGSVLYGSAIGECGNNPCLPNPCKNGASCQVKEAEIFHCKCVNGFSGPTCADAHNPCDPNKCHPPSRCQVLPEGGYK-CECPMGREG---RHCEKVSDKGGA-FIPYFTGDSFLELKGLHTYNQDLRQKFSMTIVLLANDSKGMIFYNGQKTDGKGDFISLSLNDGILEFRYDLGKGPAVIR--SKEKIKLNEWNTVNLERASRKGEISINGKDPVRGEA--PNQHTDLNLKESLFVGGA 1752          
BLAST of Agrin, putative vs. Ensembl Zebrafish
Match: agrn (agrin [Source:ZFIN;Acc:ZDB-GENE-030131-1033])

HSP 1 Score: 281.567 bits (719), Expect = 5.929e-76
Identity = 236/768 (30.73%), Postives = 334/768 (43.49%), Query Frame = 1
Query:  538 DPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPN----PDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENN---PCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNG----------QCVCTDKCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRVA-----PSVIG----------CISHNYIADEKNKRS------------CLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF----TEN--GCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGC 2676
            D C    C FGA C++   +P    C C    C +      VCGSD   Y + C +++ +C  Q+ I+V     C  K+             C   +C   +TC+ +       C CP    +     +CG+D + Y + CE+   +C   + I   + GRCD C       +  C +       I   P     PDE+       P+C SD  TY+S C ++  + K  + L  +  G C+ K     C N  C + A C+   N   +CSCD + C  T++ P+CG DG  Y N C      C  Q ++ V     C+ N   PC    C   +    +  N ++ CEC  + CP+   PVCG+D  TY S C +    C  +K + + + G C +     E   +C    IC  D    +C CP  C ++   + VCG+DG TY +EC + + AC T  + LK+   G C  C +  CS+ S C  N+     C C        +PVCGSD  TY N+C L++ SC + R I     G C             E C   +  R G          +CVC   C  V    VCG+DGN Y ++CELK+  C     + V      P+++           C    Y   E NK +            C CN  GS    CDPST QC CK G+ G  CDRC  G+WNF    TEN  GCT C+C+  GS    C   +G C+CKP   G  C+VCP G  +  +GC
Sbjct:   67 DGCRGKLCGFGAVCERDQADPSKGECVCKKIVCTS--VVAPVCGSDSSTYSNECELEKAQCNTQRRIKVMRKGPCALKDP------------CSEVTCSFGSTCIQSSDGLSAKCMCPLSCENVPKHVVCGSDGLDYQSECELNMKACATQKNIRVHHQGRCDPCSDTLNSLSTACRVNPKTYQQITFAPAESCPPDEM-------PICASDGHTYESMCQMERTALKNNLELKKVSLGSCKEK---GGCPN-GCKFNAICL-LDNGEFRCSCDPIQCDGTYK-PLCGKDGKTYPNDCERKLQECRTQKDIPVKQQGPCDLNLESPCLKKTC--EFGAVCVVKNSEAVCEC-SDACPQDQDPVCGSDGHTYSSSCQMKAMGCALQKQIQMQHKGPCAD-----ESCTNCSFGAIC--DAQTGRCVCPKGCLET--RQPVCGSDGTTYDNECKLNVQAC-TKQLDLKVVAHGECKTCGSTVCSWGSQCVNNK-----CECQQCTGQPVKPVCGSDGNTYNNDCELRLASCQKQRKIEVAKPGVCDEDCGSGGSGSGSETCEQDRCRRYGGTWDDDMEDERCVCELNCQIVLHSPVCGSDGNTYSSDCELKKTRCEKQIDLSVQSQGPCPTIVSPPPELVASQHCSQTVYGCCEDNKTAALGVGLAGCPSMCQCNHYGSYGGTCDPSTGQCSCKPGVGGLKCDRCEPGFWNFRGIVTENMSGCTPCNCDGVGSVRDDCEQMSGLCSCKPGVKGMKCNVCPDGSKMGVNGC 789          

HSP 2 Score: 155.221 bits (391), Expect = 3.463e-37
Identity = 161/691 (23.30%), Postives = 290/691 (41.97%), Query Frame = 1
Query: 2725 FLKDSFAKSYWS-GNAENYLSINISLVPYSSD--GIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNV-----KPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKP-----CLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV----SHIWKFKDNSFVIFP---SESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEK-GFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK--PVEGFPWEYNTKFKGCISELYVDEISYNLVLDA 4722
            F+     KSY +    + Y ++ I++   +S+  GI+ Y+    +  D+L++ L   YVE R + GSG   + S+V +  GR H ++V R  R++ L +D   S  G +PP    L+      IG     +   +     V+ G VGC+  L +       +Y + +    ++  S +      P  P+     +   +++ +                  H P     C     CQ   E  Y C+C  G +G  CE+V     + I  F  +SF+      + +  LRQ+  + I  L   + G++ +     D    FIS++LN   LE       G   + S E   + +WN V + +A++   +++N             G   V      + T   +K + +F GG     F   +   ++K  F GAIQKI +    I   ++ +   +++ +          PCSK   E  G C P++N   C C         ++++   +  +T     + G +  +Y     K +K+   N   +  +T +  G+ IL       +  ++ +AI +G +++  +LG K  VLR T    ++ N W  ++  R  R+  L + +    A +  ++      L TDG +WLGG ++       P  Y+T F GC+ ++ VD +  +LV DA
Sbjct: 1259 FIPSFGGKSYMAFQTMKAYHTVRIAMEFRASEMTGILLYNGQKSKK-DFLSLTLVEGYVELRFNTGSGTASVISKVLVKPGRWHQLVVVRNRRNAMLSVDNEPSVEGQSPPGTDGLNLDTDLFIGGVLDDMSADVKERTSVSAGLVGCIRMLDVN----NLVYNLQENGGSVLYGSAIGECGNNPCLPNPCKNGASCQVKEAEIFHCKCVNGFSGPTCADAHNPCDPNKCHPPSRCQVLPEGGYKCECPMGREGRHCEKVSDKGGAFIPYFTGDSFLELKGLHTYNQDLRQKFSMTIVLLANDSKGMIFYNGQKTDGKGDFISLSLNDGILEFRYDLGKGPAVIRSKEKIKLNEWNTVNLERASRKGEISIN-------------GKDPVRGEAPNQHTDLNLK-ESLFVGGA--PDFRKVARAAAIKDGFKGAIQKITLMGIPILKADNALSSTDVSMYP-------NHPCSKDVCENGGRCNPQLNSYECACRHGFSGHHCQDTIFEKSAGDTEAI-AFDGHTFIEYHNGVTKSEKALLVNKFELSIRTEATHGL-ILWSGKGVERSDYIALAIVDGRVQMTYDLGSKPVVLRST--VRVNTNHWIRIKASRALRDGSLQVGN---EAAVTGSSPLAATQLDTDGALWLGGLEELSVARRLPKAYSTGFIGCVKDVIVDGVELHLVEDA 1914          

HSP 3 Score: 121.709 bits (304), Expect = 5.754e-27
Identity = 154/567 (27.16%), Postives = 223/567 (39.33%), Query Frame = 1
Query:  535 DDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQ-------TKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDP----YQYCR------IDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGICNEE-PRCKEQGKDCPSYQICKSDLVQAKCECPTCPQ-SGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSIC-QMNRFLEPQCICPT-DCVYVRRP-VCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK 2136
            + PC K  C+FGA C         AVC CS+      Q +  VCGSDG  Y S C MK   C LQK IQ+     C    A +   + S    C  Q+              C CP   C  +   +CG+D  TY N C++   +C     ++    G C  C    C +   C      +   C+C    + CT     PVCGSD  TY ++C L++ SC+K+  + V   G C        +   S+ C   +C              +C C+ L+C+     PVCG+DG  Y + C L K  CEKQ+++ V +       PC  +  P P     Q+C        ++N  +        CP + Q    N   +Y   C+ +   C  K           +P +  + GI  E    C     +C      + D  Q    C   P   G+  +VC    K       M ++ C+    A K         C    C F S C ++N   +  C CP+ DC    +  VCGSD  TY + C LK  +C +++ I     G CK
Sbjct:  363 ESPCLKKTCEFGAVCVVKNSE---AVCECSDA---CPQDQDPVCGSDGHTYSSSCQMKAMGCALQKQIQMQHKGPC----ADESCTNCSFGAICDAQT------------GRCVCPKG-CLETRQPVCGSDGTTYDNECKLNVQACTKQLDLKVVAHGECKTCGSTVCSWGSQC------VNNKCEC----QQCTGQPVKPVCGSDGNTYNNDCELRLASCQKQRKIEVAKPGVCDEDCGSGGSGSGSETCEQDRCRRYGGTWDDDMEDERCVCE-LNCQIVLHSPVCGSDGNTYSSDCELKKTRCEKQIDLSVQS-----QGPCPTIVSPPPELVASQHCSQTVYGCCEDNKTAALGVGLAGCPSMCQ---CNHYGSYGGTCDPSTGQCSCKPGVGGLKCDRCEPGFWNFRGIVTENMSGCTPC--NCDGVGSVRDDCEQMSGLCSCKPGVKGMKCNVCPDGSK-------MGVNGCDKGPKAPK--------SCAELVCHFGSSCVEVNG--QAHCECPSPDCDEKNKTKVCGSDGVTYADRCQLKTIACRQDKEIKVEHLGQCK 868          

HSP 4 Score: 120.939 bits (302), Expect = 9.960e-27
Identity = 119/417 (28.54%), Postives = 174/417 (41.73%), Query Frame = 1
Query: 1543 KSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNR------FLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMC--RNGQCVCT---DKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRV-----------APSVIGCISHNYIADEKNKRS-CLCNSI---------GSLNH----ECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKEN 2685
            K  C C K  C  +V PVCG+D  TY + C L +  C T++ + ++  G C  +  C E      S  I  SD + AKC CP   ++     VCG+DG  Y+SEC + M AC T    +++ + G CD C +   S  + C++N          P   CP D      P+C SD  TYE+ C ++  +   N  +  VS G CK      ++  CP  C    +C   NG+  C+    +C      +CG DG  Y N+CE K + C   K I V           +P +        +   KN  + C C+           GS  H     C      C  +  I  Q+   C D         CT CS   FG+   +C+ +TG+C C    +     VC    +  ++ CK N
Sbjct:   89 KGECVCKKIVCTSVVAPVCGSDSSTYSNECELEKAQCNTQRRIKVMRKGPCALKDPCSEVTCSFGSTCIQSSDGLSAKCMCPLSCENVPKHVVCGSDGLDYQSECELNMKACATQK-NIRVHHQGRCDPCSDTLNSLSTACRVNPKTYQQITFAPAESCPPD----EMPICASDGHTYESMCQMERTALKNNLELKKVSLGSCK------EKGGCPNGCKFNAICLLDNGEFRCSCDPIQCDGTYKPLCGKDGKTYPNDCERKLQECRTQKDIPVKQQGPCDLNLESPCLKKTCEFGAVCVVKNSEAVCECSDACPQDQDPVCGSDGHTYSSSCQMKAMGCALQKQIQMQHKGPCAD-------ESCTNCS---FGA---ICDAQTGRCVCPKGCLETRQPVCGSDGTTYDNECKLN 481          

HSP 5 Score: 70.8626 bits (172), Expect = 1.632e-11
Identity = 90/457 (19.69%), Postives = 180/457 (39.39%), Query Frame = 1
Query: 3367 KPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSH-IWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQ-NSDIIL---------NN-------------------------ITQWQGPPCGPLQSPCSKTD---PEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDR-MFRAQMLDNNDYNTLATDGWMWLGGA 4617
            +PC +GG C+    + ++C C  G  G  CE+V+ + I  F   S++ F  ++++    +++ + F      G+L +  +G      F+S+TL + ++E+   T  G   +IS      G+W+ +V+++  +   L++++ P    +       LN+++               +F GGV  +         S+     G I+ + +N+     Q N   +L         NN                         +  + GP C    +PC       P +   +PE     C C    E    R+  +  +     F   + G S  +   +         K ++ I      + GM+    +    K  F+ +++ +G++E   +LG    V+R    + I  N+W+TV + R +R   + I+ +   R +    N +  L     +++GGA
Sbjct: 1224 QPCRHGGTCEEDDND-FTCICPAGRGGAVCEKVIKYFIPSFGGKSYMAF--QTMKAYHTVRIAMEFRASEMTGILLY--NGQKSKKDFLSLTLVEGYVELRFNTGSGTASVISKVLVKPGRWHQLVVVRNRRNAMLSVDNEPSVEGQSPPGTDGLNLDT--------------DLFIGGVLDDMSADVKERTSVSAGLVGCIRMLDVNNLVYNLQENGGSVLYGSAIGECGNNPCLPNPCKNGASCQVKEAEIFHCKCVNGFSGPTCADAHNPCDPNKCHPPSRCQVLPEGGYK-CECPMGREG---RHCEKVSDKGGA-FIPYFTGDSFLELKGLHTYNQDLRQKFSMTIVLLANDSKGMIFYNGQKTDGKGDFISLSLNDGILEFRYDLGKGPAVIR--SKEKIKLNEWNTVNLERASRKGEISINGKDPVRGEA--PNQHTDLNLKESLFVGGA 1652          
BLAST of Agrin, putative vs. Ensembl Zebrafish
Match: agrn (agrin [Source:ZFIN;Acc:ZDB-GENE-030131-1033])

HSP 1 Score: 276.559 bits (706), Expect = 1.690e-74
Identity = 229/761 (30.09%), Postives = 345/761 (45.34%), Query Frame = 1
Query:  481 EKRISVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCK---CPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVK--CEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCI-KTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDK-------------CKNKKCSFYSICQMNRFLEPQCICPTDC-VYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF----TEN--GCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKEN 2685
            ++RI V   G  + +    DPCS++ C FG+ C +   +  +A C C    C+   K + VCGSDG+ Y S C +  + C  QK+I+V   H  GR +   D ++  +              C  NP  Y +    P + C      IC +D  TY ++C+M++ + K N  +++  +G C         C+FN IC ++E+G    C C   D +       P+CG D  TY ++C  K++ C+ +  + V  +G C   ++S  C    C +GA C+ K S  V +CS    D     +DPVCG+DG  Y + C +  M C  Q ++ + +   C +  C+         +  I +     C CPK  C +  QPVCG+D  TY++ C L   AC  +  L ++ +G       CK  G    S+    S  V  KCEC  C    + + VCG+DG TY ++C +R  +C+   I +++A  G CD+             C+  +C  Y     +   + +C+C  +C + +  PVCGSD  TY ++C LK   C +   ++  S+GPC      P E                  V +  CS+                       C DNKT  +   + GC S            C CN  GS    CDPST QC CK G+ G  CDRC  G+WNF    TEN  GCT C+C+  GS    C   +G C+CKP   G  C+VCP G  +  +GC++ 
Sbjct:   99 QRRIKVMRKGPCALK----DPCSEVTCSFGSTCIQ-SSDGLSAKCMCP-LSCENVPKHV-VCGSDGLDYQSECELNMKACATQKNIRV---HHQGRCDPCSDTLNSLS------------TACRVNPKTYQQITFAPAESCPPDEMPICASDGHTYESMCQMERTALKNNLELKKVSLGSCKEKGGCPNGCKFNAIC-LLENGE-FRCSC---DPIQCDGTYKPLCGKDGKTYPNDCERKLQECRTQKDIPVKQQGPCDLNLESP-CLKKTCEFGAVCVVKNSEAVCECS----DACPQDQDPVCGSDGHTYSSSCQMKAMGCALQKQIQMQHKGPCADESCTNC------SFGAICDAQTGRCVCPKG-CLETRQPVCGSDGTTYDNECKLNVQACTKQLDLKVVAHG------ECKTCGSTVCSW---GSQCVNNKCECQQCTGQPV-KPVCGSDGNTYNNDCELRQASCQ-KQIKIEVAKPGVCDEDCGSGGSGSGSETCEQDRCRRYGGTWDDDMEDERCVCELNCQIVLHSPVCGSDGNTYSSDCELKKTRCEKQIDLSVQSQGPCPTIVSPPPE-----------------LVASQHCSQTVY------------------GCCEDNKTAALGVGLAGCPSM-----------CQCNHYGSYGGTCDPSTGQCSCKPGVGGLKCDRCEPGFWNFRGIVTENMSGCTPCNCDGVGSVRDDCEQMSGLCSCKPGVKGMKCNVCPDGSKMGVNGCEKG 763          

HSP 2 Score: 155.221 bits (391), Expect = 3.026e-37
Identity = 161/691 (23.30%), Postives = 290/691 (41.97%), Query Frame = 1
Query: 2725 FLKDSFAKSYWS-GNAENYLSINISLVPYSSD--GIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNV-----KPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNG-----GLCQTSSEEMYSCQCLPGYQGITCEEVV----SHIWKFKDNSFVIFP---SESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEK-GFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK--PVEGFPWEYNTKFKGCISELYVDEISYNLVLDA 4722
            F+     KSY +    + Y ++ I++   +S+  GI+ Y+    +  D+L++ L   YVE R + GSG   + S+V +  GR H ++V R  R++ L +D   S  G +PP    L+      IG     +   +     V+ G VGC+  L +       +Y + +    ++  S +      P  P+     +   +++ +                  H PC          CQ   E  Y C+C  G +G  CE+V     + I  F  +SF+      + +  LRQ+  + I  L   + G++ +     D    FIS++LN   LE       G   + S E   + +WN V + +A++   +++N             G   V      + T   +K + +F GG     F   +   ++K  F GAIQKI +    I   ++ +   +++ +          PCSK   E  G C P++N   C C         ++++   +  +T     + G +  +Y     K +K+   N   +  +T +  G+ IL       +  ++ +AI +G +++  +LG K  VLR T    ++ N W  ++  R  R+  L + +    A +  ++      L TDG +WLGG ++       P  Y+T F GC+ ++ VD +  +LV DA
Sbjct: 1232 FIPSFGGKSYMAFQTMKAYHTVRIAMEFRASEMTGILLYNGQKSKK-DFLSLTLVEGYVELRFNTGSGTASVISKVLVKPGRWHQLVVVRNRRNAMLSVDNEPSVEGQSPPGTDGLNLDTDLFIGGVLDDMSADVKERTSVSAGLVGCIRMLDVN----NLVYNLQENGGSVLYGSAIGECGNNPCLPNPCKNGASCQVKEAEIFHCKCVNGFSGPTCADAHNPCDPNKCHPPSRCQVLPEGGYKCECPMGREGRHCEKVSDKGGAFIPYFTGDSFLELKGLHTYNQDLRQKFSMTIVLLANDSKGMIFYNGQKTDGKGDFISLSLNDGILEFRYDLGKGPAVIRSKEKIKLNEWNTVNLERASRKGEISIN-------------GKDPVRGEAPNQHTDLNLK-ESLFVGGA--PDFRKVARAAAIKDGFKGAIQKITLMGIPILKADNALSSTDVSMYP-------NHPCSKDVCENGGRCNPQLNSYECACRHGFSGHHCQDTIFEKSAGDTEAI-AFDGHTFIEYHNRVTKSEKALLVNKFELSIRTEATHGL-ILWSGKGVERSDYIALAIVDGRVQMTYDLGSKPVVLRST--VRVNTNHWIRIKASRALRDGSLQVGN---EAAVTGSSPLAATQLDTDGALWLGGLEELSVARRLPKAYSTGFIGCVKDVIVDGVELHLVEDA 1887          

HSP 3 Score: 123.635 bits (309), Expect = 1.446e-27
Identity = 156/567 (27.51%), Postives = 223/567 (39.33%), Query Frame = 1
Query:  535 DDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQ-------TKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDP----YQYCR------IDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGICNEE-PRCKEQGKDCPSYQICKSDLVQAKCECPTCPQ-SGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSIC-QMNRFLEPQCICPT-DCVYVRRP-VCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK 2136
            + PC K  C+FGA C         AVC CS+      Q +  VCGSDG  Y S C MK   C LQK IQ+     C    A +   + S    C  Q+              C CP   C  +   +CG+D  TY N C++   +C     ++    G C  C    C +   C      +   C+C    + CT     PVCGSD  TY ++C L+  SC+K+I + V   G C        +   S+ C   +C              +C C+ L+C+     PVCG+DG  Y + C L K  CEKQ+++ V +       PC  +  P P     Q+C        ++N  +        CP + Q    N   +Y   C+ +   C  K           +P +  + GI  E    C     +C      + D  Q    C   P   G+  +VC    K       M ++ CE    A K         C    C F S C ++N   +  C CP+ DC    +  VCGSD  TY + C LK  +C +++ I     G CK
Sbjct:  334 ESPCLKKTCEFGAVCVV---KNSEAVCECSDA---CPQDQDPVCGSDGHTYSSSCQMKAMGCALQKQIQMQHKGPC----ADESCTNCSFGAICDAQT------------GRCVCPKG-CLETRQPVCGSDGTTYDNECKLNVQACTKQLDLKVVAHGECKTCGSTVCSWGSQC------VNNKCEC----QQCTGQPVKPVCGSDGNTYNNDCELRQASCQKQIKIEVAKPGVCDEDCGSGGSGSGSETCEQDRCRRYGGTWDDDMEDERCVCE-LNCQIVLHSPVCGSDGNTYSSDCELKKTRCEKQIDLSVQS-----QGPCPTIVSPPPELVASQHCSQTVYGCCEDNKTAALGVGLAGCPSMCQ---CNHYGSYGGTCDPSTGQCSCKPGVGGLKCDRCEPGFWNFRGIVTENMSGCTPC--NCDGVGSVRDDCEQMSGLCSCKPGVKGMKCNVCPDGSK-------MGVNGCEKGPKAPK--------SCAELVCHFGSSCVEVNG--QAHCECPSPDCDEKNKTKVCGSDGVTYADRCQLKTIACRQDKEIKVEHLGQCK 839          

HSP 4 Score: 121.324 bits (303), Expect = 7.008e-27
Identity = 119/417 (28.54%), Postives = 174/417 (41.73%), Query Frame = 1
Query: 1543 KSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNR------FLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMC--RNGQCVCT---DKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRV-----------APSVIGCISHNYIADEKNKRS-CLCNSI---------GSLNH----ECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKEN 2685
            K  C C K  C  +V PVCG+D  TY + C L +  C T++ + ++  G C  +  C E      S  I  SD + AKC CP   ++     VCG+DG  Y+SEC + M AC T    +++ + G CD C +   S  + C++N          P   CP D      P+C SD  TYE+ C ++  +   N  +  VS G CK      ++  CP  C    +C   NG+  C+    +C      +CG DG  Y N+CE K + C   K I V           +P +        +   KN  + C C+           GS  H     C      C  +  I  Q+   C D         CT CS   FG+   +C+ +TG+C C    +     VC    +  ++ CK N
Sbjct:   60 KGECVCKKIVCTSVVAPVCGSDSSTYSNECELEKAQCNTQRRIKVMRKGPCALKDPCSEVTCSFGSTCIQSSDGLSAKCMCPLSCENVPKHVVCGSDGLDYQSECELNMKACATQK-NIRVHHQGRCDPCSDTLNSLSTACRVNPKTYQQITFAPAESCPPD----EMPICASDGHTYESMCQMERTALKNNLELKKVSLGSCK------EKGGCPNGCKFNAICLLENGEFRCSCDPIQCDGTYKPLCGKDGKTYPNDCERKLQECRTQKDIPVKQQGPCDLNLESPCLKKTCEFGAVCVVKNSEAVCECSDACPQDQDPVCGSDGHTYSSSCQMKAMGCALQKQIQMQHKGPCAD-------ESCTNCS---FGA---ICDAQTGRCVCPKGCLETRQPVCGSDGTTYDNECKLN 452          

HSP 5 Score: 70.8626 bits (172), Expect = 1.547e-11
Identity = 90/457 (19.69%), Postives = 180/457 (39.39%), Query Frame = 1
Query: 3367 KPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSH-IWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQ-NSDIIL---------NN-------------------------ITQWQGPPCGPLQSPCSKTD---PEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDR-MFRAQMLDNNDYNTLATDGWMWLGGA 4617
            +PC +GG C+    + ++C C  G  G  CE+V+ + I  F   S++ F  ++++    +++ + F      G+L +  +G      F+S+TL + ++E+   T  G   +IS      G+W+ +V+++  +   L++++ P    +       LN+++               +F GGV  +         S+     G I+ + +N+     Q N   +L         NN                         +  + GP C    +PC       P +   +PE     C C    E    R+  +  +     F   + G S  +   +         K ++ I      + GM+    +    K  F+ +++ +G++E   +LG    V+R    + I  N+W+TV + R +R   + I+ +   R +    N +  L     +++GGA
Sbjct: 1197 QPCRHGGTCEEDDND-FTCICPAGRGGAVCEKVIKYFIPSFGGKSYMAF--QTMKAYHTVRIAMEFRASEMTGILLY--NGQKSKKDFLSLTLVEGYVELRFNTGSGTASVISKVLVKPGRWHQLVVVRNRRNAMLSVDNEPSVEGQSPPGTDGLNLDT--------------DLFIGGVLDDMSADVKERTSVSAGLVGCIRMLDVNNLVYNLQENGGSVLYGSAIGECGNNPCLPNPCKNGASCQVKEAEIFHCKCVNGFSGPTCADAHNPCDPNKCHPPSRCQVLPEGGYK-CECPMGREG---RHCEKVSDKGGA-FIPYFTGDSFLELKGLHTYNQDLRQKFSMTIVLLANDSKGMIFYNGQKTDGKGDFISLSLNDGILEFRYDLGKGPAVIR--SKEKIKLNEWNTVNLERASRKGEISINGKDPVRGEA--PNQHTDLNLKESLFVGGA 1625          
BLAST of Agrin, putative vs. Ensembl Zebrafish
Match: agrn (agrin [Source:ZFIN;Acc:ZDB-GENE-030131-1033])

HSP 1 Score: 276.559 bits (706), Expect = 1.759e-74
Identity = 254/852 (29.81%), Postives = 368/852 (43.19%), Query Frame = 1
Query:  307 KISHENDYHLILVRKIKY-IINCKISI-KSGEDFIMYLKKTEQN-NFFELNYAKEFGNGLFEKRISVFLNGA-TSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPN----PDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENN---PCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNG----------QCVCTDKCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRVA-----PSVIG----------CISHNYIADEKNKRS------------CLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF----TEN--GCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKEN 2685
            K+S   +  L L++K K  II   +S+ +S +  ++  +  + N +  EL Y    G  L      V  N A    ++  D  C    C FGA C++   +P    C C    C +      VCGSD   Y + C +++ +C  Q+ I+V     C  K+             C   +C   +TC+ +       C CP    +     +CG+D + Y + CE+   +C   + I   + GRCD C       +  C +       I   P     PDE+       P+C SD  TY+S C ++  + K  + L  +  G C+ K     C N  C + A C+   N   +CSCD + C  T++ P+CG DG  Y N C      C  Q ++ V     C+ N   PC    C   +    +  N ++ CEC  + CP+   PVCG+D  TY S C +    C  +K + + + G C +     E   +C    IC  D    +C CP  C ++   + VCG+DG TY +EC + + AC T  + LK+   G C  C +  CS+ S C  N+     C C        +PVCGSD  TY N+C L+  SC +   I     G C             E C   +  R G          +CVC   C  V    VCG+DGN Y ++CELK+  C     + V      P+++           C    Y   E NK +            C CN  GS    CDPST QC CK G+ G  CDRC  G+WNF    TEN  GCT C+C+  GS    C   +G C+CKP   G  C+VCP G  +  +GC++ 
Sbjct:    4 KLSARVETVLSLIQKKKAAIIILYVSVDRSSKGHVLNKRVFKLNADLHELLYK---GLLLCPHMTVVLFNAAFLLSKIDPDVCCRGKLCGFGAVCERDQADPSKGECVCKKIVCTS--VVAPVCGSDSSTYSNECELEKAQCNTQRRIKVMRKGPCALKDP------------CSEVTCSFGSTCIQSSDGLSAKCMCPLSCENVPKHVVCGSDGLDYQSECELNMKACATQKNIRVHHQGRCDPCSDTLNSLSTACRVNPKTYQQITFAPAESCPPDEM-------PICASDGHTYESMCQMERTALKNNLELKKVSLGSCKEK---GGCPN-GCKFNAICL-LENGEFRCSCDPIQCDGTYK-PLCGKDGKTYPNDCERKLQECRTQKDIPVKQQGPCDLNLESPCLKKTC--EFGAVCVVKNSEAVCEC-SDACPQDQDPVCGSDGHTYSSSCQMKAMGCALQKQIQMQHKGPCAD-----ESCTNCSFGAIC--DAQTGRCVCPKGCLET--RQPVCGSDGTTYDNECKLNVQAC-TKQLDLKVVAHGECKTCGSTVCSWGSQCVNNK-----CECQQCTGQPVKPVCGSDGNTYNNDCELRQASCQKQIKIEVAKPGVCDEDCGSGGSGSGSETCEQDRCRRYGGTWDDDMEDERCVCELNCQIVLHSPVCGSDGNTYSSDCELKKTRCEKQIDLSVQSQGPCPTIVSPPPELVASQHCSQTVYGCCEDNKTAALGVGLAGCPSMCQCNHYGSYGGTCDPSTGQCSCKPGVGGLKCDRCEPGFWNFRGIVTENMSGCTPCNCDGVGSVRDDCEQMSGLCSCKPGVKGMKCNVCPDGSKMGVNGCEKG 807          

HSP 2 Score: 154.451 bits (389), Expect = 5.979e-37
Identity = 161/691 (23.30%), Postives = 290/691 (41.97%), Query Frame = 1
Query: 2725 FLKDSFAKSYWS-GNAENYLSINISLVPYSSD--GIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNV-----KPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKP-----CLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV----SHIWKFKDNSFVIFP---SESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEK-GFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK--PVEGFPWEYNTKFKGCISELYVDEISYNLVLDA 4722
            F+     KSY +    + Y ++ I++   +S+  GI+ Y+    +  D+L++ L   YVE R + GSG   + S+V +  GR H ++V R  R++ L +D   S  G +PP    L+      IG     +   +     V+ G VGC+  L +       +Y + +    ++  S +      P  P+     +   +++ +                  H P     C     CQ   E  Y C+C  G +G  CE+V     + I  F  +SF+      + +  LRQ+  + I  L   + G++ +     D    FIS++LN   LE       G   + S E   + +WN V + +A++   +++N             G   V      + T   +K + +F GG     F   +   ++K  F GAIQKI +    I   ++ +   +++ +          PCSK   E  G C P++N   C C         ++++   +  +T     + G +  +Y     K +K+   N   +  +T +  G+ IL       +  ++ +AI +G +++  +LG K  VLR T    ++ N W  ++  R  R+  L + +    A +  ++      L TDG +WLGG ++       P  Y+T F GC+ ++ VD +  +LV DA
Sbjct: 1276 FIPSFGGKSYMAFQTMKAYHTVRIAMEFRASEMTGILLYNGQKSKK-DFLSLTLVEGYVELRFNTGSGTASVISKVLVKPGRWHQLVVVRNRRNAMLSVDNEPSVEGQSPPGTDGLNLDTDLFIGGVLDDMSADVKERTSVSAGLVGCIRMLDVN----NLVYNLQENGGSVLYGSAIGECGNNPCLPNPCKNGASCQVKEAEIFHCKCVNGFSGPTCADAHNPCDPNKCHPPSRCQVLPEGGYKCECPMGREGRHCEKVSDKGGAFIPYFTGDSFLELKGLHTYNQDLRQKFSMTIVLLANDSKGMIFYNGQKTDGKGDFISLSLNDGILEFRYDLGKGPAVIRSKEKIKLNEWNTVNLERASRKGEISIN-------------GKDPVRGEAPNQHTDLNLK-ESLFVGGA--PDFRKVARAAAIKDGFKGAIQKITLMGIPILKADNALSSTDVSMYP-------NHPCSKDVCENGGRCNPQLNSYECACRHGFSGHHCQDTIFEKSAGDTEAI-AFDGHTFIEYHNRVTKSEKALLVNKFELSIRTEATHGL-ILWSGKGVERSDYIALAIVDGRVQMTYDLGSKPVVLRST--VRVNTNHWIRIKASRALRDGSLQVGN---EAAVTGSSPLAATQLDTDGALWLGGLEELSVARRLPKAYSTGFIGCVKDVIVDGVELHLVEDA 1931          

HSP 3 Score: 123.25 bits (308), Expect = 1.742e-27
Identity = 156/567 (27.51%), Postives = 223/567 (39.33%), Query Frame = 1
Query:  535 DDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQ-------TKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDP----YQYCR------IDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGICNEE-PRCKEQGKDCPSYQICKSDLVQAKCECPTCPQ-SGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSIC-QMNRFLEPQCICPT-DCVYVRRP-VCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK 2136
            + PC K  C+FGA C         AVC CS+      Q +  VCGSDG  Y S C MK   C LQK IQ+     C    A +   + S    C  Q+              C CP   C  +   +CG+D  TY N C++   +C     ++    G C  C    C +   C      +   C+C    + CT     PVCGSD  TY ++C L+  SC+K+I + V   G C        +   S+ C   +C              +C C+ L+C+     PVCG+DG  Y + C L K  CEKQ+++ V +       PC  +  P P     Q+C        ++N  +        CP + Q    N   +Y   C+ +   C  K           +P +  + GI  E    C     +C      + D  Q    C   P   G+  +VC    K       M ++ CE    A K         C    C F S C ++N   +  C CP+ DC    +  VCGSD  TY + C LK  +C +++ I     G CK
Sbjct:  378 ESPCLKKTCEFGAVCVV---KNSEAVCECSDA---CPQDQDPVCGSDGHTYSSSCQMKAMGCALQKQIQMQHKGPC----ADESCTNCSFGAICDAQT------------GRCVCPKG-CLETRQPVCGSDGTTYDNECKLNVQACTKQLDLKVVAHGECKTCGSTVCSWGSQC------VNNKCEC----QQCTGQPVKPVCGSDGNTYNNDCELRQASCQKQIKIEVAKPGVCDEDCGSGGSGSGSETCEQDRCRRYGGTWDDDMEDERCVCE-LNCQIVLHSPVCGSDGNTYSSDCELKKTRCEKQIDLSVQS-----QGPCPTIVSPPPELVASQHCSQTVYGCCEDNKTAALGVGLAGCPSMCQ---CNHYGSYGGTCDPSTGQCSCKPGVGGLKCDRCEPGFWNFRGIVTENMSGCTPC--NCDGVGSVRDDCEQMSGLCSCKPGVKGMKCNVCPDGSK-------MGVNGCEKGPKAPK--------SCAELVCHFGSSCVEVNG--QAHCECPSPDCDEKNKTKVCGSDGVTYADRCQLKTIACRQDKEIKVEHLGQCK 883          

HSP 4 Score: 70.4774 bits (171), Expect = 2.158e-11
Identity = 90/457 (19.69%), Postives = 180/457 (39.39%), Query Frame = 1
Query: 3367 KPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSH-IWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQ-NSDIIL---------NN-------------------------ITQWQGPPCGPLQSPCSKTD---PEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDR-MFRAQMLDNNDYNTLATDGWMWLGGA 4617
            +PC +GG C+    + ++C C  G  G  CE+V+ + I  F   S++ F  ++++    +++ + F      G+L +  +G      F+S+TL + ++E+   T  G   +IS      G+W+ +V+++  +   L++++ P    +       LN+++               +F GGV  +         S+     G I+ + +N+     Q N   +L         NN                         +  + GP C    +PC       P +   +PE     C C    E    R+  +  +     F   + G S  +   +         K ++ I      + GM+    +    K  F+ +++ +G++E   +LG    V+R    + I  N+W+TV + R +R   + I+ +   R +    N +  L     +++GGA
Sbjct: 1241 QPCRHGGTCEEDDND-FTCICPAGRGGAVCEKVIKYFIPSFGGKSYMAF--QTMKAYHTVRIAMEFRASEMTGILLY--NGQKSKKDFLSLTLVEGYVELRFNTGSGTASVISKVLVKPGRWHQLVVVRNRRNAMLSVDNEPSVEGQSPPGTDGLNLDT--------------DLFIGGVLDDMSADVKERTSVSAGLVGCIRMLDVNNLVYNLQENGGSVLYGSAIGECGNNPCLPNPCKNGASCQVKEAEIFHCKCVNGFSGPTCADAHNPCDPNKCHPPSRCQVLPEGGYK-CECPMGREG---RHCEKVSDKGGA-FIPYFTGDSFLELKGLHTYNQDLRQKFSMTIVLLANDSKGMIFYNGQKTDGKGDFISLSLNDGILEFRYDLGKGPAVIR--SKEKIKLNEWNTVNLERASRKGEISINGKDPVRGEA--PNQHTDLNLKESLFVGGA 1669          
BLAST of Agrin, putative vs. Ensembl Zebrafish
Match: EGFLAM (EGF like, fibronectin type III and laminin G domains [Source:NCBI gene;Acc:799405])

HSP 1 Score: 125.176 bits (313), Expect = 2.904e-28
Identity = 145/664 (21.84%), Postives = 269/664 (40.51%), Query Frame = 1
Query: 2764 NAENYLSINISLVPYSSDGIIFYHSDTDRS-SDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEE-VVSHIWKFKDNSF----VIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNL-NHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCS----PKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXV-IAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDN-NDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISELYVDEISYNLVL 4716
            N+     I++     + DG++ Y  + +    D+ ++ L    + YR + G+GA  + S   + IG+ H++ + R   +  L +D        +    T +       +G A  P    L        GF GC+ SL + +                                 ++D+   P     S  +  +  +       C NGG+C  +  + + C C  GY+G  CEE  +  + +F  + F      +P  S      ++ E+TF P + +G L +  D   R+  F+S++L   ++E       G T + S E+  +  W+ + + + AK   L + N  P              V  +     TQ +  + P++ GGV  N   +  +   L+P + G++QKI +ND  I          N+      PC  + +PC+      G C  + +E  C C+     KH    +  S++           ++ G+S   Y      +  S ++ N+ ++FK+ S DG+L+   +      S  + + +++G +  + NLG  +G   +  N   SD KWH V+ +R+ ++  L +DD  + AQ   +      L  +G +++GG K+       +Y     GCIS   +    Y+L L
Sbjct:  324 NSYQSFQISLEFKAEAEDGLLLYCGENEHGRGDFTSLALIRGKLHYRFNCGTGAAQIISDSSIVIGQWHTVTIFRDGMNGWLRLDNDTPVSSRSQGQYTKITFRTALFLGGA--PNGYWLVRAVGTNRGFQGCMQSLTVNS--------------------------------KAIDIRPWPKGNALSGADIGECSNSVCEKVTCANGGICFANRADGFICLCPLGYKGFLCEESFLLSLPQFNQSMFSYASAPWPQSSHNYLSFMEFEVTFQPTSPDGTLLYTDDATSRD--FLSISLVAGYVEFRFDCGSGATVIRSEEAIAMNVWHELRVSRTAKNGILQVDNQRP--------------VEGMAEGAFTQIKCSS-PLYIGGV-PNYDITKPSAGILRP-YSGSVQKITLNDRGIELNPGQAFGVNVLN-AAHPC--VDNPCAN----GGTCRAKWDEYDCDCALGYDGKHCQKAVTESIE---------IPQFTGRSYLTYDNRDILKRISGSRTNLFMRFKSTSKDGLLLWRGESPMRANSDYLSLGLQDGSLIFSYNLG--SGAATVVINGTFSDGKWHRVKAVRDGQSGKLTVDD--YGAQTGRSPGKMRQLNINGDLYIGGMKEIALHTNRQYMRGLVGCISHFTL-ATDYHLSL 913          

HSP 2 Score: 81.6481 bits (200), Expect = 6.506e-15
Identity = 91/384 (23.70%), Postives = 156/384 (40.62%), Query Frame = 1
Query: 2638 VCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSI---NISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVS---HIWKFKDNSFVIFPSESLQLR---QRLKLEITFLPLANNGLLSFISDGHDR-NPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAK 3759
            +CP+GY      C+E+ +    +   +      S+A + W  ++ NYLS     ++  P S DG + Y +D   S D+L+I L   YVE+R D GSGA  ++S   + +   H + V R  ++  L +D      GM         A   FT  + + P+        D+T    G    L+  +G   KI L ++          + P                     Q+   N+    +     PC NGG C+   +E Y C C  GY G  C++ V+    I +F   S++ + +  +  R    R  L + F   + +GLL +  +   R N  ++S+ L    L  +     G   ++   +   GKW+ V  ++  +
Sbjct:  511 LCPLGYK--GFLCEESFL----LSLPQFNQSMFSYASAPWPQSSHNYLSFMEFEVTFQPTSPDGTLLY-TDDATSRDFLSISLVAGYVEFRFDCGSGATVIRSEEAIAMNVWHELRVSRTAKNGILQVDNQRPVEGM---------AEGAFTQIKCSSPLYIGGVPNYDITKPSAGI---LRPYSGSVQKITLNDRGI-------ELNPG--------------------QAFGVNVLNAAHPCVDNPCANGGTCRAKWDE-YDCDCALGYDGKHCQKAVTESIEIPQFTGRSYLTYDNRDILKRISGSRTNLFMRFKSTSKDGLLLWRGESPMRANSDYLSLGLQDGSLIFSYNLGSGAATVVINGTFSDGKWHRVKAVRDGQ 847          
BLAST of Agrin, putative vs. Ensembl Xenopus
Match: sos1 (SOS Ras/Rac guanine nucleotide exchange factor 1 [Source:Xenbase;Acc:XB-GENE-1011399])

HSP 1 Score: 308.916 bits (790), Expect = 2.889e-84
Identity = 270/935 (28.88%), Postives = 407/935 (43.53%), Query Frame = 1
Query:  202 SDLIIVGRVLNLANSEVI-------VSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDFIMYLKKTEQNNFFELNYAKEFGNGLFE----------------KRISVFLNGAT-SKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQV------------PVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCE---NNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQ-------FIKPDEERCPEDCPLGKMCR-----------NGQCVCTDKCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRVAP--------------------SVIGCISHNYIAD-----EKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF------TENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGF 2727
            +++++ G V  + N + +       V V R LKG +++     +   N    ++V        C   + +G+  I ++    ++ +          + L                  +R+S    G   + Q    D C  + C FGA C+K   +P  A C C  T C +      VCGSD   Y + C ++R +C  Q+ I+V     CG K+             C   SC   +TCV +       C CP        + +CG+D   Y N C++ K +C     + +++ GRCD C+      N  C +            NP    T+ +++            PVC  D VTY ++C +      + I L  ++ G+CQ +   D C    C + + C+     V +CSCD + C +T++ PVCG D   Y N C   K  C ++  + V +   C+    +PC    C   +    +  N K+ CEC ++ C  +  PVCG+DK TY + C L  TAC  KK + I++ G C+   RC +    C    IC+++    +C CPT C  S   + VCGTDG TY+SEC + + AC T  I L++A  G C  C N  C+F + C  N     QC+C T       PVCGS+  TY+N+C LK  SC + +LI     G C+ +           ++  C +D      CR           + +CVC   C  V ++ VCG+DG  Y NECELK+  C   + + VA                     +V GC   N  A           SC C+  GS    CDP+T QC CK G+ G  CDRC  G+WNF       ++GCT C+C+  G+    C   TG C+CK    G  CS CP G      GC+++       DA++  F
Sbjct:   42 ANVVLTGTVEEIMNVDPVHHTYSCKVRVWRYLKGREIVTNDILLDGGNK---VMVGGFGDPTICDNQVSTGDTRIFFVNPAPRSMWPTHRNELMLNSSLMRITLRNLEEVEMCVEEHRRLSADKPGPVPNAQPTLQDVCRGMLCGFGAVCEKSSTDPSQATCICKKTACAS--IVAPVCGSDYSTYSNECELERAQCNQQRRIKVISKGPCGTKDP------------CSTVSCSYGSTCVRSTDGQTAKCICPATCTGVPENVVCGSDGKDYHNECQLNKQACDNQENLYKKFDGRCDPCRIAMNNQNKACRV------------NPR---TRQLEMQYRPEYCPVRRDPVCADDGVTYDNDCVMTRSGFIRGIELQKVHSGQCQPQ---DKCKE-DCKHNSVCLNRRG-VTRCSCDRVTCDSTYK-PVCGGDSRTYANDCERQKAECFQKATIPVKHKGPCDLHSPSPCLNTTCS--FGAACVVKNKKAVCEC-QQVCQAVYDPVCGSDKRTYGNPCELQSTACTLKKEITILHKGPCD---RCGK----CQFGAICEAET--GRCVCPTECVPSA--QPVCGTDGNTYESECELHVRAC-TQQINLQVAAQGDCKTCGNTLCTFGAKCVNN-----QCVCLTCERQPYLPVCGSNGVTYDNQCELKAASCKQMKLIEVSRAGSCEDECGSGTDGSGSGEDSECEQD-----RCRRYGGSWDEDAEDDRCVCDFTCHAVLRILVCGSDGITYSNECELKKTRCEKRQDLYVAGQGACRAATTSSPPLVPHCSHTVYGCCPDNITAALGVGLAGCPSSCQCHQYGSYGGTCDPTTGQCSCKPGVGGLKCDRCEPGFWNFRGIVTDKKSGCTPCNCDPVGAVRDDCEQMTGLCSCKTGISGLKCSQCPDGRKPGLTGCEKDPSAPKSCDAIKCQF 913          

HSP 2 Score: 155.221 bits (391), Expect = 5.044e-37
Identity = 175/759 (23.06%), Postives = 301/759 (39.66%), Query Frame = 1
Query: 2725 FLKDSFAKSYWSGNA-ENYLSINISLVPYSSD--GIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITC---------------------------------------EEVVSHIWKF----KDNSFVIFPSESLQ-----LRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPI----KKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKI------LINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTC-----SPKHENLCIRNSMQHDNPANTN---FFRKYLGKSASKY-------AAVKQKRDKSSTK---NNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLI--DDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGF--PWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 4752
            F+     KSY +    + Y ++ I++   SS+  G++ Y+  +    D++++ + N +VE R + GSG   + S+V +  G+ H ++V R  R   L +DG     G +P     L+      IG A    +  +S    ++ G  GC+  L +      ++Y + +  + ++  S V             +   +P                CQ + PC NG  CQ    EM+ CQCL GY G TC                                       E+V +         + N +     + LQ     L+ +L +E+ FL    NGL+ +     D    F+S++L+  +LE       G   + S E   +  W  V + ++ +   + +N+  Q      K R  P   LN+               +P+F GG    +  + +   S   +F GAIQKI      ++ +ENIR   S I    I+ ++  PC     PC       G C P      C C       + E + I  +       + +   +   ++  + S+          V    D S      N   +  KT +  G+++   K          +A+  G +E+  +LG K  VLR T    ++ N+W  ++ +R+NR+ +L +  +D +  +      +   L TDG +WLGG +K    +  P  Y+T F GC+ ++ VD+   +LV DA  N  PIL C
Sbjct: 1411 FIPGFGGKSYLAFKMMKAYHTVRIAMEFRSSEQNGLLLYNGQS-LGKDFISLAVNNGFVELRFNTGSGTGIITSKVPIEPGKWHQLVVNRNRRSGMLSVDGESHVNGESPSGTDGLNLDTDLFIGGAPEDQMAVVSERTSLSVGLKGCIRQLDVN----NQLYNLQEGGADVLYGSGVG------------ECGNNP----------------CQPN-PCHNGAACQVKEAEMFHCQCLSGYTGPTCADERNPCDPNPCHVSATCLVLPEGGAKCECPMGREGEFCEKVSNQDLNLPFLPQFNGYSYLEMKGLQTFATDLQDKLAMEVVFLASNPNGLIFYNGQKTDGKGDFVSLSLHDGNLEYRYDLGKGAAVIKSKEKIPLNTWLSVSLERSGRKGLMRINNMEQVTGESPKSRKAPHTALNLK--------------EPLFVGGAPDFSKLARAAAAST--SFEGAIQKISIKGLPVLREENIR---SAI---EISTFRSHPCTKKPFPCQN----GGLCSPNKGNYECVCQRGFSGSQCEKVTIEKAAGESEAVSFDGKTYLEYHIAVTKSQLTNEIPETGPVDNPDDPSEKALLVNQFELSIKTEATQGLILWSGKGTERAYYI-ALAVVGGYVEMTYDLGSKPVVLRST--VPVNTNEWIHIKAVRDNRDGILRVGNEDPVHGSSPFGVKE---LDTDGALWLGGIEKLSASYKLPKAYSTGFIGCMKDVLVDQQDLHLVEDAL-NKPPILYC 2102          

HSP 3 Score: 117.857 bits (294), Expect = 1.325e-25
Identity = 154/568 (27.11%), Postives = 215/568 (37.85%), Query Frame = 1
Query:  526 VQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTK----------IQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCE----NNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGICNEEPRCKEQGK---DCPSYQICKSDLVQAK--CECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQ-MNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK 2136
            + +  PC    C FGA C         AVC C    CQA      VCGSD   Y + C ++   C L+K I +     C R    Q G        C+ ++              C CP + C  S+  +CGTD  TY + CE+   +C     ++    G C  C    C F   C      +   C C      C +   +PVCGS+ VTY ++C LK  SCK+   + V   G C+ +           +   C   +C              +C CD+  C    R  VCG+DGI Y N+C L K  CEK+ +++V     C     ++P     C      C  DN   +        CP   Q    +   +Y   C+ T   C  K           +P +  + GI  +    K+ G    +C      + D  Q    C C T   SGL  S C  DG+         +  CE +  A K         C   KC F + C  +  F   +C  P         VCGSDD TY + C LK  +C + R IT    GPC+
Sbjct:  468 LHSPSPCLNTTCSFGAACVV---KNKKAVCECQQV-CQAVYD--PVCGSDKRTYGNPCELQSTACTLKKEITILHKGPCDRCGKCQFGA------ICEAET------------GRCVCPTE-CVPSAQPVCGTDGNTYESECELHVRACTQQINLQVAAQGDCKTCGNTLCTFGAKC------VNNQCVCLT----CERQPYLPVCGSNGVTYDNQCELKAASCKQMKLIEVSRAGSCEDECGSGTDGSGSGEDSECEQDRCRRYGGSWDEDAEDDRCVCDFT-CHAVLRILVCGSDGITYSNECELKKTRCEKRQDLYVAGQGACRAATTSSPPLVPHCSHTVYGCCPDNI-TAALGVGLAGCPSSCQ---CHQYGSYGGTCDPTTGQCSCKPGVGGLKCDRCEPGFWNFRGIVTD----KKSGCTPCNCDPVGAVRDDCEQMTGLCSCKT-GISGLKCSQC-PDGR------KPGLTGCEKDPSAPK--------SCDAIKCQFGATCVVIGGFAHCECPSPLCAEANLTKVCGSDDVTYGDWCQLKTIACRQGRTITVKHTGPCQ 975          

HSP 4 Score: 69.3218 bits (168), Expect = 7.358e-11
Identity = 88/437 (20.14%), Postives = 175/437 (40.05%), Query Frame = 1
Query: 3355 CQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSH-IWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDE--NIRFQNSDIILNN---------------------------------ITQWQGPPCGPLQSPCSKTDP------EKGFCVPEMNETICTCSPKHEN-LCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDD 4536
            C++H PCL+GG C+ + ++ ++C C  G  G  CE+ + + I  F   S++ F  + ++    +++ + F     NGLL +  +G      FIS+ +N   +E+   T  G   + S      GKW+ +V+ +  +   L+++             G  +VN           +    +F GG   +     S   SL     G I+++ +N++  N++   +D++  +                                 ++ + GP C   ++PC   DP           +PE     C C    E   C + S Q     N  F  ++ G S  +   ++        K  + + F  ++ +G++    +    K  F+ +++ +G +E   +LG   G   I   + I  N W +V + R+ R  ++ I++
Sbjct: 1373 CESH-PCLHGGTCEDNGKD-FTCSCPAGRGGAVCEKSIKYFIPGFGGKSYLAF--KMMKAYHTVRIAMEFRSSEQNGLLLY--NGQSLGKDFISLAVNNGFVELRFNTGSGTGIITSKVPIEPGKWHQLVVNRNRRSGMLSVD-------------GESHVNGESPSGTDGLNLDTD-LFIGGAPEDQMAVVSERTSLSVGLKGCIRQLDVNNQLYNLQEGGADVLYGSGVGECGNNPCQPNPCHNGAACQVKEAEMFHCQCLSGYTGPTCADERNPC---DPNPCHVSATCLVLPEGGAK-CECPMGREGEFCEKVSNQD---LNLPFLPQFNGYSYLEMKGLQTFATDLQDKLAMEVVFLASNPNGLIFYNGQKTDGKGDFVSLSLHDGNLEYRYDLG--KGAAVIKSKEKIPLNTWLSVSLERSGRKGLMRINN 1780          

HSP 5 Score: 67.0106 bits (162), Expect = 3.211e-10
Identity = 88/443 (19.86%), Postives = 161/443 (36.34%), Query Frame = 1
Query: 2560 GSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVD--AVELGFLKDSFAKSY--------WSGNAENYLSINISLVPYSSDGIIFYHSD-TDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFL----TNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV-------SHIWKFKDNSFVIF------------------------PSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILK 3750
            G     C  E   C+  P  +   C V P G +           +  KV    + L FL      SY        ++ + ++ L++ +  +  + +G+IFY+   TD   D++++ L +  +EYR DLG GA  +KS+ ++ +    S+ +ER  R   + I+  +   G +P       T L+      +G A  P  + L+     +  F G +  + I                                    + V+ + +     E    +     +   PC NGGLC + ++  Y C C  G+ G  CE+V        S    F   +++ +                        PSE   L  + +L I     A  GL+ +   G +R   +I++ +   ++E+T         L S       +W H+  ++
Sbjct: 1617 GYTGPTCADERNPCDPNPCHVSATCLVLPEGGAKCECPMGREGEFCEKVSNQDLNLPFLPQFNGYSYLEMKGLQTFATDLQDKLAMEVVFLASNPNGLIFYNGQKTDGKGDFVSLSLHDGNLEYRYDLGKGAAVIKSKEKIPLNTWLSVSLERSGRKGLMRINNMEQVTGESPKSRKAPHTALNLKEPLFVGGA--PDFSKLARAAAASTSFEGAIQKISI----------------------------------KGLPVLREENIRSAIEISTFRSHPCTKKPFPCQNGGLC-SPNKGNYECVCQRGFSGSQCEKVTIEKAAGESEAVSFDGKTYLEYHIAVTKSQLTNEIPETGPVDNPDDPSEKALLVNQFELSIKT--EATQGLILWSGKGTERA-YYIALAVVGGYVEMTYDLGSKPVVLRSTVPVNTNEWIHIKAVR 2019          

HSP 6 Score: 56.9954 bits (136), Expect = 3.945e-7
Identity = 30/77 (38.96%), Postives = 44/77 (57.14%), Query Frame = 1
Query: 1021 CKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKI 1251
            C  +KC+F   C ++  G    C+CP+P  LC +     VCGSDDVTY   C LK  +C++  ++TV + G CQ  +
Sbjct:  906 CDAIKCQFGATCVVI--GGFAHCECPSP--LCAEANLTKVCGSDDVTYGDWCQLKTIACRQGRTITVKHTGPCQETV 978          
BLAST of Agrin, putative vs. Ensembl Xenopus
Match: sos1 (SOS Ras/Rac guanine nucleotide exchange factor 1 [Source:Xenbase;Acc:XB-GENE-1011399])

HSP 1 Score: 308.531 bits (789), Expect = 3.786e-84
Identity = 270/935 (28.88%), Postives = 407/935 (43.53%), Query Frame = 1
Query:  202 SDLIIVGRVLNLANSEVI-------VSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDFIMYLKKTEQNNFFELNYAKEFGNGLFE----------------KRISVFLNGAT-SKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQV------------PVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCE---NNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQ-------FIKPDEERCPEDCPLGKMCR-----------NGQCVCTDKCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRVAP--------------------SVIGCISHNYIAD-----EKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF------TENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGF 2727
            +++++ G V  + N + +       V V R LKG +++     +   N    ++V        C   + +G+  I ++    ++ +          + L                  +R+S    G   + Q    D C  + C FGA C+K   +P  A C C  T C +      VCGSD   Y + C ++R +C  Q+ I+V     CG K+             C   SC   +TCV +       C CP        + +CG+D   Y N C++ K +C     + +++ GRCD C+      N  C +            NP    T+ +++            PVC  D VTY ++C +      + I L  ++ G+CQ +   D C    C + + C+     V +CSCD + C +T++ PVCG D   Y N C   K  C ++  + V +   C+    +PC    C   +    +  N K+ CEC ++ C  +  PVCG+DK TY + C L  TAC  KK + I++ G C+   RC +    C    IC+++    +C CPT C  S   + VCGTDG TY+SEC + + AC T  I L++A  G C  C N  C+F + C  N     QC+C T       PVCGS+  TY+N+C LK  SC + +LI     G C+ +           ++  C +D      CR           + +CVC   C  V ++ VCG+DG  Y NECELK+  C   + + VA                     +V GC   N  A           SC C+  GS    CDP+T QC CK G+ G  CDRC  G+WNF       ++GCT C+C+  G+    C   TG C+CK    G  CS CP G      GC+++       DA++  F
Sbjct:   42 ANVVLTGTVEEIMNVDPVHHTYSCKVRVWRYLKGREIVTNDILLDGGNK---VMVGGFGDPTICDNQVSTGDTRIFFVNPAPRSMWPTHRNELMLNSSLMRITLRNLEEVEMCVEEHRRLSADKPGPVPNAQPTLQDVCRGMLCGFGAVCEKSSTDPSQATCICKKTACAS--IVAPVCGSDYSTYSNECELERAQCNQQRRIKVISKGPCGTKDP------------CSTVSCSYGSTCVRSTDGQTAKCICPATCTGVPENVVCGSDGKDYHNECQLNKQACDNQENLYKKFDGRCDPCRIAMNNQNKACRV------------NPR---TRQLEMQYRPEYCPVRRDPVCADDGVTYDNDCVMTRSGFIRGIELQKVHSGQCQPQ---DKCKE-DCKHNSVCLNRRG-VTRCSCDRVTCDSTYK-PVCGGDSRTYANDCERQKAECFQKATIPVKHKGPCDLHSPSPCLNTTCS--FGAACVVKNKKAVCEC-QQVCQAVYDPVCGSDKRTYGNPCELQSTACTLKKEITILHKGPCD---RCGK----CQFGAICEAET--GRCVCPTECVPSA--QPVCGTDGNTYESECELHVRAC-TQQINLQVAAQGDCKTCGNTLCTFGAKCVNN-----QCVCLTCERQPYLPVCGSNGVTYDNQCELKAASCKQMKLIEVSRAGSCEDECGSGTDGSGSGEDSECEQD-----RCRRYGGSWDEDAEDDRCVCDFTCHAVLRILVCGSDGITYSNECELKKTRCEKRQDLYVAGQGACRAATTSSPPLVPHCSHTVYGCCPDNITAALGVGLAGCPSSCQCHQYGSYGGTCDPTTGQCSCKPGVGGLKCDRCEPGFWNFRGIVTDKKSGCTPCNCDPVGAVRDDCEQMTGLCSCKTGISGLKCSQCPDGRKPGLTGCEKDPSAPKSCDAIKCQF 913          

HSP 2 Score: 160.229 bits (404), Expect = 1.497e-38
Identity = 179/753 (23.77%), Postives = 307/753 (40.77%), Query Frame = 1
Query: 2725 FLKDSFAKSYWSGNA-ENYLSINISLVPYSSD--GIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITC---------------------------------------EEVVSHIWKF----KDNSFVIFPSESLQ-----LRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPI----KKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKI------LINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHE-NLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKR-----------DKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLI--DDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGF--PWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 4752
            F+     KSY +    + Y ++ I++   SS+  G++ Y+  +    D++++ + N +VE R + GSG   + S+V +  G+ H ++V R  R   L +DG     G +P     L+      IG A    +  +S    ++ G  GC+  L +      ++Y + +  + ++  S V                         E  N    + CQ + PC NG  CQ    EM+ CQCL GY G TC                                       E+V +         + N +     + LQ     L+ +L +E+ FL    NGL+ +     D    F+S++L+  +LE       G   + S E   +  W  V + ++ +   + +N+  Q      K R  P   LN+               +P+F GG    +  + +   S   +F GAIQKI      ++ +ENIR   S I    I+ ++  PC     PC       G C P      C C      + C + +++    A  +    + GK+  +Y     KR           +K+   N   +  KT +  G+ IL     + +  ++ +A+  G +E+  +LG K  VLR T    ++ N+W  ++ +R+NR+ +L +  +D +  +      +   L TDG +WLGG +K    +  P  Y+T F GC+ ++ VD+   +LV DA  N  PIL C
Sbjct: 1411 FIPGFGGKSYLAFKMMKAYHTVRIAMEFRSSEQNGLLLYNGQS-LGKDFISLAVNNGFVELRFNTGSGTGIITSKVPIEPGKWHQLVVNRNRRSGMLSVDGESHVNGESPSGTDGLNLDTDLFIGGAPEDQMAVVSERTSLSVGLKGCIRQLDVN----NQLYNLQEGGADVLYGSGV------------------------GECGN----NPCQPN-PCHNGAACQVKEAEMFHCQCLSGYTGPTCADERNPCDPNPCHVSATCLVLPEGGAKCECPMGREGEFCEKVSNQDLNLPFLPQFNGYSYLEMKGLQTFATDLQDKLAMEVVFLASNPNGLIFYNGQKTDGKGDFVSLSLHDGNLEYRYDLGKGAAVIKSKEKIPLNTWLSVSLERSGRKGLMRINNMEQVTGESPKSRKAPHTALNL--------------KEPLFVGGAPDFSKLARAAAAST--SFEGAIQKISIKGLPVLREENIR---SAI---EISTFRSHPCTKKPFPCQN----GGLCSPNKGNYECVCQRGFSGSQCEKVTIE--KAAGESEAVSFDGKTYLEYHIAVTKRTGPVDNPDDPSEKALLVNQFELSIKTEATQGL-ILWSGKGTERAYYIALAVVGGYVEMTYDLGSKPVVLRST--VPVNTNEWIHIKAVRDNRDGILRVGNEDPVHGSSPFGVKE---LDTDGALWLGGIEKLSASYKLPKAYSTGFIGCMKDVLVDQQDLHLVEDAL-NKPPILYC 2094          

HSP 3 Score: 117.857 bits (294), Expect = 1.323e-25
Identity = 154/568 (27.11%), Postives = 215/568 (37.85%), Query Frame = 1
Query:  526 VQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTK----------IQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCE----NNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGICNEEPRCKEQGK---DCPSYQICKSDLVQAK--CECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQ-MNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK 2136
            + +  PC    C FGA C         AVC C    CQA      VCGSD   Y + C ++   C L+K I +     C R    Q G        C+ ++              C CP + C  S+  +CGTD  TY + CE+   +C     ++    G C  C    C F   C      +   C C      C +   +PVCGS+ VTY ++C LK  SCK+   + V   G C+ +           +   C   +C              +C CD+  C    R  VCG+DGI Y N+C L K  CEK+ +++V     C     ++P     C      C  DN   +        CP   Q    +   +Y   C+ T   C  K           +P +  + GI  +    K+ G    +C      + D  Q    C C T   SGL  S C  DG+         +  CE +  A K         C   KC F + C  +  F   +C  P         VCGSDD TY + C LK  +C + R IT    GPC+
Sbjct:  468 LHSPSPCLNTTCSFGAACVV---KNKKAVCECQQV-CQAVYD--PVCGSDKRTYGNPCELQSTACTLKKEITILHKGPCDRCGKCQFGA------ICEAET------------GRCVCPTE-CVPSAQPVCGTDGNTYESECELHVRACTQQINLQVAAQGDCKTCGNTLCTFGAKC------VNNQCVCLT----CERQPYLPVCGSNGVTYDNQCELKAASCKQMKLIEVSRAGSCEDECGSGTDGSGSGEDSECEQDRCRRYGGSWDEDAEDDRCVCDFT-CHAVLRILVCGSDGITYSNECELKKTRCEKRQDLYVAGQGACRAATTSSPPLVPHCSHTVYGCCPDNI-TAALGVGLAGCPSSCQ---CHQYGSYGGTCDPTTGQCSCKPGVGGLKCDRCEPGFWNFRGIVTD----KKSGCTPCNCDPVGAVRDDCEQMTGLCSCKT-GISGLKCSQC-PDGR------KPGLTGCEKDPSAPK--------SCDAIKCQFGATCVVIGGFAHCECPSPLCAEANLTKVCGSDDVTYGDWCQLKTIACRQGRTITVKHTGPCQ 975          

HSP 4 Score: 70.0922 bits (170), Expect = 4.437e-11
Identity = 88/435 (20.23%), Postives = 161/435 (37.01%), Query Frame = 1
Query: 2560 GSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVD--AVELGFLKDSFAKSY--------WSGNAENYLSINISLVPYSSDGIIFYHSD-TDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFL----TNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV-------SHIWKFKDNSFVIF----------------PSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILK 3750
            G     C  E   C+  P  +   C V P G +           +  KV    + L FL      SY        ++ + ++ L++ +  +  + +G+IFY+   TD   D++++ L +  +EYR DLG GA  +KS+ ++ +    S+ +ER  R   + I+  +   G +P       T L+      +G A  P  + L+     +  F G +  + I                                    + V+ + +     E    +     +   PC NGGLC + ++  Y C C  G+ G  CE+V        S    F   +++ +                PSE   L  + +L I     A  GL+ +   G +R   +I++ +   ++E+T         L S       +W H+  ++
Sbjct: 1617 GYTGPTCADERNPCDPNPCHVSATCLVLPEGGAKCECPMGREGEFCEKVSNQDLNLPFLPQFNGYSYLEMKGLQTFATDLQDKLAMEVVFLASNPNGLIFYNGQKTDGKGDFVSLSLHDGNLEYRYDLGKGAAVIKSKEKIPLNTWLSVSLERSGRKGLMRINNMEQVTGESPKSRKAPHTALNLKEPLFVGGA--PDFSKLARAAAASTSFEGAIQKISI----------------------------------KGLPVLREENIRSAIEISTFRSHPCTKKPFPCQNGGLC-SPNKGNYECVCQRGFSGSQCEKVTIEKAAGESEAVSFDGKTYLEYHIAVTKRTGPVDNPDDPSEKALLVNQFELSIKT--EATQGLILWSGKGTERA-YYIALAVVGGYVEMTYDLGSKPVVLRSTVPVNTNEWIHIKAVR 2011          

HSP 5 Score: 68.9366 bits (167), Expect = 8.557e-11
Identity = 88/437 (20.14%), Postives = 175/437 (40.05%), Query Frame = 1
Query: 3355 CQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSH-IWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDE--NIRFQNSDIILNN---------------------------------ITQWQGPPCGPLQSPCSKTDP------EKGFCVPEMNETICTCSPKHEN-LCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDD 4536
            C++H PCL+GG C+ + ++ ++C C  G  G  CE+ + + I  F   S++ F  + ++    +++ + F     NGLL +  +G      FIS+ +N   +E+   T  G   + S      GKW+ +V+ +  +   L+++             G  +VN           +    +F GG   +     S   SL     G I+++ +N++  N++   +D++  +                                 ++ + GP C   ++PC   DP           +PE     C C    E   C + S Q     N  F  ++ G S  +   ++        K  + + F  ++ +G++    +    K  F+ +++ +G +E   +LG   G   I   + I  N W +V + R+ R  ++ I++
Sbjct: 1373 CESH-PCLHGGTCEDNGKD-FTCSCPAGRGGAVCEKSIKYFIPGFGGKSYLAF--KMMKAYHTVRIAMEFRSSEQNGLLLY--NGQSLGKDFISLAVNNGFVELRFNTGSGTGIITSKVPIEPGKWHQLVVNRNRRSGMLSVD-------------GESHVNGESPSGTDGLNLDTD-LFIGGAPEDQMAVVSERTSLSVGLKGCIRQLDVNNQLYNLQEGGADVLYGSGVGECGNNPCQPNPCHNGAACQVKEAEMFHCQCLSGYTGPTCADERNPC---DPNPCHVSATCLVLPEGGAK-CECPMGREGEFCEKVSNQD---LNLPFLPQFNGYSYLEMKGLQTFATDLQDKLAMEVVFLASNPNGLIFYNGQKTDGKGDFVSLSLHDGNLEYRYDLG--KGAAVIKSKEKIPLNTWLSVSLERSGRKGLMRINN 1780          

HSP 6 Score: 56.9954 bits (136), Expect = 4.010e-7
Identity = 30/77 (38.96%), Postives = 44/77 (57.14%), Query Frame = 1
Query: 1021 CKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKI 1251
            C  +KC+F   C ++  G    C+CP+P  LC +     VCGSDDVTY   C LK  +C++  ++TV + G CQ  +
Sbjct:  906 CDAIKCQFGATCVVI--GGFAHCECPSP--LCAEANLTKVCGSDDVTYGDWCQLKTIACRQGRTITVKHTGPCQETV 978          
BLAST of Agrin, putative vs. Ensembl Xenopus
Match: sos1 (SOS Ras/Rac guanine nucleotide exchange factor 1 [Source:Xenbase;Acc:XB-GENE-1011399])

HSP 1 Score: 307.76 bits (787), Expect = 6.413e-84
Identity = 270/935 (28.88%), Postives = 407/935 (43.53%), Query Frame = 1
Query:  202 SDLIIVGRVLNLANSEVI-------VSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDFIMYLKKTEQNNFFELNYAKEFGNGLFE----------------KRISVFLNGAT-SKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQV------------PVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCE---NNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQ-------FIKPDEERCPEDCPLGKMCR-----------NGQCVCTDKCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRVAP--------------------SVIGCISHNYIAD-----EKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF------TENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGF 2727
            +++++ G V  + N + +       V V R LKG +++     +   N    ++V        C   + +G+  I ++    ++ +          + L                  +R+S    G   + Q    D C  + C FGA C+K   +P  A C C  T C +      VCGSD   Y + C ++R +C  Q+ I+V     CG K+             C   SC   +TCV +       C CP        + +CG+D   Y N C++ K +C     + +++ GRCD C+      N  C +            NP    T+ +++            PVC  D VTY ++C +      + I L  ++ G+CQ +   D C    C + + C+     V +CSCD + C +T++ PVCG D   Y N C   K  C ++  + V +   C+    +PC    C   +    +  N K+ CEC ++ C  +  PVCG+DK TY + C L  TAC  KK + I++ G C+   RC +    C    IC+++    +C CPT C  S   + VCGTDG TY+SEC + + AC T  I L++A  G C  C N  C+F + C  N     QC+C T       PVCGS+  TY+N+C LK  SC + +LI     G C+ +           ++  C +D      CR           + +CVC   C  V ++ VCG+DG  Y NECELK+  C   + + VA                     +V GC   N  A           SC C+  GS    CDP+T QC CK G+ G  CDRC  G+WNF       ++GCT C+C+  G+    C   TG C+CK    G  CS CP G      GC+++       DA++  F
Sbjct:   42 ANVVLTGTVEEIMNVDPVHHTYSCKVRVWRYLKGREIVTNDILLDGGNK---VMVGGFGDPTICDNQVSTGDTRIFFVNPAPRSMWPTHRNELMLNSSLMRITLRNLEEVEMCVEEHRRLSADKPGPVPNAQPTLQDVCRGMLCGFGAVCEKSSTDPSQATCICKKTACAS--IVAPVCGSDYSTYSNECELERAQCNQQRRIKVISKGPCGTKDP------------CSTVSCSYGSTCVRSTDGQTAKCICPATCTGVPENVVCGSDGKDYHNECQLNKQACDNQENLYKKFDGRCDPCRIAMNNQNKACRV------------NPR---TRQLEMQYRPEYCPVRRDPVCADDGVTYDNDCVMTRSGFIRGIELQKVHSGQCQPQ---DKCKE-DCKHNSVCLNRRG-VTRCSCDRVTCDSTYK-PVCGGDSRTYANDCERQKAECFQKATIPVKHKGPCDLHSPSPCLNTTCS--FGAACVVKNKKAVCEC-QQVCQAVYDPVCGSDKRTYGNPCELQSTACTLKKEITILHKGPCD---RCGK----CQFGAICEAET--GRCVCPTECVPSA--QPVCGTDGNTYESECELHVRAC-TQQINLQVAAQGDCKTCGNTLCTFGAKCVNN-----QCVCLTCERQPYLPVCGSNGVTYDNQCELKAASCKQMKLIEVSRAGSCEDECGSGTDGSGSGEDSECEQD-----RCRRYGGSWDEDAEDDRCVCDFTCHAVLRILVCGSDGITYSNECELKKTRCEKRQDLYVAGQGACRAATTSSPPLVPHCSHTVYGCCPDNITAALGVGLAGCPSSCQCHQYGSYGGTCDPTTGQCSCKPGVGGLKCDRCEPGFWNFRGIVTDKKSGCTPCNCDPVGAVRDDCEQMTGLCSCKTGISGLKCSQCPDGRKPGLTGCEKDPSAPKSCDAIKCQF 913          

HSP 2 Score: 166.392 bits (420), Expect = 1.953e-40
Identity = 178/742 (23.99%), Postives = 306/742 (41.24%), Query Frame = 1
Query: 2725 FLKDSFAKSYWSGNA-ENYLSINISLVPYSSD--GIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITC---------------------------------------EEVVSHIWKF----KDNSFVIFPSESLQ-----LRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPI----KKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKI------LINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHE-NLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLI--DDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGF--PWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 4752
            F+     KSY +    + Y ++ I++   SS+  G++ Y+  +    D++++ + N +VE R + GSG   + S+V +  G+ H ++V R  R   L +DG     G +P     L+      IG A    +  +S    ++ G  GC+  L +      ++Y + +  + ++  S V                         E  N    + CQ + PC NG  CQ    EM+ CQCL GY G TC                                       E+V +         + N +     + LQ     L+ +L +E+ FL    NGL+ +     D    F+S++L+  +LE       G   + S E   +  W  V + ++ +   + +N+  Q      K R  P   LN+               +P+F GG    +  + +   S   +F GAIQKI      ++ +ENIR   S I    I+ ++  PC     PC       G C P      C C      + C + +++    A  +    + GK+  +Y     K +K+   N   +  KT +  G+ IL     + +  ++ +A+  G +E+  +LG K  VLR T    ++ N+W  ++ +R+NR+ +L +  +D +  +      +   L TDG +WLGG +K    +  P  Y+T F GC+ ++ VD+   +LV DA  N  PIL C
Sbjct: 1411 FIPGFGGKSYLAFKMMKAYHTVRIAMEFRSSEQNGLLLYNGQS-LGKDFISLAVNNGFVELRFNTGSGTGIITSKVPIEPGKWHQLVVNRNRRSGMLSVDGESHVNGESPSGTDGLNLDTDLFIGGAPEDQMAVVSERTSLSVGLKGCIRQLDVN----NQLYNLQEGGADVLYGSGV------------------------GECGN----NPCQPN-PCHNGAACQVKEAEMFHCQCLSGYTGPTCADERNPCDPNPCHVSATCLVLPEGGAKCECPMGREGEFCEKVSNQDLNLPFLPQFNGYSYLEMKGLQTFATDLQDKLAMEVVFLASNPNGLIFYNGQKTDGKGDFVSLSLHDGNLEYRYDLGKGAAVIKSKEKIPLNTWLSVSLERSGRKGLMRINNMEQVTGESPKSRKAPHTALNL--------------KEPLFVGGAPDFSKLARAAAAST--SFEGAIQKISIKGLPVLREENIR---SAI---EISTFRSHPCTKKPFPCQN----GGLCSPNKGNYECVCQRGFSGSQCEKVTIE--KAAGESEAVSFDGKTYLEYHIAVTKSEKALLVNQFELSIKTEATQGL-ILWSGKGTERAYYIALAVVGGYVEMTYDLGSKPVVLRST--VPVNTNEWIHIKAVRDNRDGILRVGNEDPVHGSSPFGVKE---LDTDGALWLGGIEKLSASYKLPKAYSTGFIGCMKDVLVDQQDLHLVEDAL-NKPPILYC 2083          

HSP 3 Score: 117.087 bits (292), Expect = 1.882e-25
Identity = 154/568 (27.11%), Postives = 215/568 (37.85%), Query Frame = 1
Query:  526 VQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTK----------IQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCE----NNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGICNEEPRCKEQGK---DCPSYQICKSDLVQAK--CECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQ-MNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK 2136
            + +  PC    C FGA C         AVC C    CQA      VCGSD   Y + C ++   C L+K I +     C R    Q G        C+ ++              C CP + C  S+  +CGTD  TY + CE+   +C     ++    G C  C    C F   C      +   C C      C +   +PVCGS+ VTY ++C LK  SCK+   + V   G C+ +           +   C   +C              +C CD+  C    R  VCG+DGI Y N+C L K  CEK+ +++V     C     ++P     C      C  DN   +        CP   Q    +   +Y   C+ T   C  K           +P +  + GI  +    K+ G    +C      + D  Q    C C T   SGL  S C  DG+         +  CE +  A K         C   KC F + C  +  F   +C  P         VCGSDD TY + C LK  +C + R IT    GPC+
Sbjct:  468 LHSPSPCLNTTCSFGAACVV---KNKKAVCECQQV-CQAVYD--PVCGSDKRTYGNPCELQSTACTLKKEITILHKGPCDRCGKCQFGA------ICEAET------------GRCVCPTE-CVPSAQPVCGTDGNTYESECELHVRACTQQINLQVAAQGDCKTCGNTLCTFGAKC------VNNQCVCLT----CERQPYLPVCGSNGVTYDNQCELKAASCKQMKLIEVSRAGSCEDECGSGTDGSGSGEDSECEQDRCRRYGGSWDEDAEDDRCVCDFT-CHAVLRILVCGSDGITYSNECELKKTRCEKRQDLYVAGQGACRAATTSSPPLVPHCSHTVYGCCPDNI-TAALGVGLAGCPSSCQ---CHQYGSYGGTCDPTTGQCSCKPGVGGLKCDRCEPGFWNFRGIVTD----KKSGCTPCNCDPVGAVRDDCEQMTGLCSCKT-GISGLKCSQC-PDGR------KPGLTGCEKDPSAPK--------SCDAIKCQFGATCVVIGGFAHCECPSPLCAEANLTKVCGSDDVTYGDWCQLKTIACRQGRTITVKHTGPCQ 975          

HSP 4 Score: 71.633 bits (174), Expect = 1.243e-11
Identity = 84/422 (19.91%), Postives = 160/422 (37.91%), Query Frame = 1
Query: 2560 GSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVD--AVELGFLKDSFAKSY--------WSGNAENYLSINISLVPYSSDGIIFYHSD-TDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFL----TNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV-------SHIWKFKDNSFVIFPSESLQLRQRL---KLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILK 3750
            G     C  E   C+  P  +   C V P G +           +  KV    + L FL      SY        ++ + ++ L++ +  +  + +G+IFY+   TD   D++++ L +  +EYR DLG GA  +KS+ ++ +    S+ +ER  R   + I+  +   G +P       T L+      +G A  P  + L+     +  F G +  + I                                    + V+ + +     E    +     +   PC NGGLC + ++  Y C C  G+ G  CE+V        S    F   +++ +     +  + L   + E++    A  GL+ +   G +R   +I++ +   ++E+T         L S       +W H+  ++
Sbjct: 1617 GYTGPTCADERNPCDPNPCHVSATCLVLPEGGAKCECPMGREGEFCEKVSNQDLNLPFLPQFNGYSYLEMKGLQTFATDLQDKLAMEVVFLASNPNGLIFYNGQKTDGKGDFVSLSLHDGNLEYRYDLGKGAAVIKSKEKIPLNTWLSVSLERSGRKGLMRINNMEQVTGESPKSRKAPHTALNLKEPLFVGGA--PDFSKLARAAAASTSFEGAIQKISI----------------------------------KGLPVLREENIRSAIEISTFRSHPCTKKPFPCQNGGLC-SPNKGNYECVCQRGFSGSQCEKVTIEKAAGESEAVSFDGKTYLEYHIAVTKSEKALLVNQFELSIKTEATQGLILWSGKGTERA-YYIALAVVGGYVEMTYDLGSKPVVLRSTVPVNTNEWIHIKAVR 2000          

HSP 5 Score: 68.9366 bits (167), Expect = 8.479e-11
Identity = 88/437 (20.14%), Postives = 175/437 (40.05%), Query Frame = 1
Query: 3355 CQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSH-IWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDE--NIRFQNSDIILNN---------------------------------ITQWQGPPCGPLQSPCSKTDP------EKGFCVPEMNETICTCSPKHEN-LCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDD 4536
            C++H PCL+GG C+ + ++ ++C C  G  G  CE+ + + I  F   S++ F  + ++    +++ + F     NGLL +  +G      FIS+ +N   +E+   T  G   + S      GKW+ +V+ +  +   L+++             G  +VN           +    +F GG   +     S   SL     G I+++ +N++  N++   +D++  +                                 ++ + GP C   ++PC   DP           +PE     C C    E   C + S Q     N  F  ++ G S  +   ++        K  + + F  ++ +G++    +    K  F+ +++ +G +E   +LG   G   I   + I  N W +V + R+ R  ++ I++
Sbjct: 1373 CESH-PCLHGGTCEDNGKD-FTCSCPAGRGGAVCEKSIKYFIPGFGGKSYLAF--KMMKAYHTVRIAMEFRSSEQNGLLLY--NGQSLGKDFISLAVNNGFVELRFNTGSGTGIITSKVPIEPGKWHQLVVNRNRRSGMLSVD-------------GESHVNGESPSGTDGLNLDTD-LFIGGAPEDQMAVVSERTSLSVGLKGCIRQLDVNNQLYNLQEGGADVLYGSGVGECGNNPCQPNPCHNGAACQVKEAEMFHCQCLSGYTGPTCADERNPC---DPNPCHVSATCLVLPEGGAK-CECPMGREGEFCEKVSNQD---LNLPFLPQFNGYSYLEMKGLQTFATDLQDKLAMEVVFLASNPNGLIFYNGQKTDGKGDFVSLSLHDGNLEYRYDLG--KGAAVIKSKEKIPLNTWLSVSLERSGRKGLMRINN 1780          

HSP 6 Score: 58.5362 bits (140), Expect = 1.173e-7
Identity = 53/219 (24.20%), Postives = 96/219 (43.84%), Query Frame = 1
Query: 2623 GKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWS-GNAENYLSIN---ISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDV----TDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKP 3255
            G Y  VC  G+S S   C++ +I +   ++  + F   ++ + + +   +E  L +N   +S+   ++ G+I +       + Y+ + +   YVE   DLGS  + L+S V +       I   R NRD  L +   D  +G +P  +  LD      +G      I  LS +  +    + GF+GC+           K  L++QQ   ++E +  KP
Sbjct: 1878 GNYECVCQRGFSGSQ--CEKVTIEKAAGESEAVSFDGKTYLEYHIAVTKSEKALLVNQFELSIKTEATQGLILWSGKGTERAYYIALAVVGGYVEMTYDLGSKPVVLRSTVPVNTNEWIHIKAVRDNRDGILRVGNEDPVHGSSPFGVKELDTDGALWLGG-----IEKLSASYKLPKAYSTGFIGCM-----------KDVLVDQQDLHLVEDALNKP 2078          

HSP 7 Score: 56.6102 bits (135), Expect = 4.323e-7
Identity = 30/77 (38.96%), Postives = 44/77 (57.14%), Query Frame = 1
Query: 1021 CKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKI 1251
            C  +KC+F   C ++  G    C+CP+P  LC +     VCGSDDVTY   C LK  +C++  ++TV + G CQ  +
Sbjct:  906 CDAIKCQFGATCVVI--GGFAHCECPSP--LCAEANLTKVCGSDDVTYGDWCQLKTIACRQGRTITVKHTGPCQETV 978          
BLAST of Agrin, putative vs. Ensembl Xenopus
Match: sos1 (SOS Ras/Rac guanine nucleotide exchange factor 1 [Source:Xenbase;Acc:XB-GENE-1011399])

HSP 1 Score: 307.76 bits (787), Expect = 6.481e-84
Identity = 266/918 (28.98%), Postives = 402/918 (43.79%), Query Frame = 1
Query:  202 SDLIIVGRVLNLANSEVI-------VSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDFIMYLKKTEQNNFFELNYAKEFGNGLFEKRISVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQV------------PVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCE---NNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQ-------FIKPDEERCPEDCPLGKMCR-----------NGQCVCTDKCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRVAP--------------------SVIGCISHNYIAD-----EKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF------TENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGF 2727
            +++++ G V  + N + +       V V R LKG +++     +   N    ++V        C   + +G+  I ++    ++ +          + L    +          +V     C  + C FGA C+K   +P  A C C  T C +      VCGSD   Y + C ++R +C  Q+ I+V     CG K+             C   SC   +TCV +       C CP        + +CG+D   Y N C++ K +C     + +++ GRCD C+      N  C +            NP    T+ +++            PVC  D VTY ++C +      + I L  ++ G+CQ +   D C    C + + C+     V +CSCD + C +T++ PVCG D   Y N C   K  C ++  + V +   C+    +PC    C   +    +  N K+ CEC ++ C  +  PVCG+DK TY + C L  TAC  KK + I++ G C+   RC +    C    IC+++    +C CPT C  S   + VCGTDG TY+SEC + + AC T  I L++A  G C  C N  C+F + C  N     QC+C T       PVCGS+  TY+N+C LK  SC + +LI     G C+ +           ++  C +D      CR           + +CVC   C  V ++ VCG+DG  Y NECELK+  C   + + VA                     +V GC   N  A           SC C+  GS    CDP+T QC CK G+ G  CDRC  G+WNF       ++GCT C+C+  G+    C   TG C+CK    G  CS CP G      GC+++       DA++  F
Sbjct:   42 ANVVLTGTVEEIMNVDPVHHTYSCKVRVWRYLKGREIVTNDILLDGGNK---VMVGGFGDPTICDNQVSTGDTRIFFVNPAPRSMWPTHRNELMLNSSLMRITLRNLEEVEMCVEV-----CRGMLCGFGAVCEKSSTDPSQATCICKKTACAS--IVAPVCGSDYSTYSNECELERAQCNQQRRIKVISKGPCGTKDP------------CSTVSCSYGSTCVRSTDGQTAKCICPATCTGVPENVVCGSDGKDYHNECQLNKQACDNQENLYKKFDGRCDPCRIAMNNQNKACRV------------NPR---TRQLEMQYRPEYCPVRRDPVCADDGVTYDNDCVMTRSGFIRGIELQKVHSGQCQPQ---DKCKE-DCKHNSVCLNRRG-VTRCSCDRVTCDSTYK-PVCGGDSRTYANDCERQKAECFQKATIPVKHKGPCDLHSPSPCLNTTCS--FGAACVVKNKKAVCEC-QQVCQAVYDPVCGSDKRTYGNPCELQSTACTLKKEITILHKGPCD---RCGK----CQFGAICEAET--GRCVCPTECVPSA--QPVCGTDGNTYESECELHVRAC-TQQINLQVAAQGDCKTCGNTLCTFGAKCVNN-----QCVCLTCERQPYLPVCGSNGVTYDNQCELKAASCKQMKLIEVSRAGSCEDECGSGTDGSGSGEDSECEQD-----RCRRYGGSWDEDAEDDRCVCDFTCHAVLRILVCGSDGITYSNECELKKTRCEKRQDLYVAGQGACRAATTSSPPLVPHCSHTVYGCCPDNITAALGVGLAGCPSSCQCHQYGSYGGTCDPTTGQCSCKPGVGGLKCDRCEPGFWNFRGIVTDKKSGCTPCNCDPVGAVRDDCEQMTGLCSCKTGISGLKCSQCPDGRKPGLTGCEKDPSAPKSCDAIKCQF 891          

HSP 2 Score: 157.147 bits (396), Expect = 1.112e-37
Identity = 172/743 (23.15%), Postives = 299/743 (40.24%), Query Frame = 1
Query: 2725 FLKDSFAKSYWSGNA-ENYLSINISLVPYSSD--GIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEE----------------------------VVSHIWKF------KDNSFVIFPS-------ESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKI------LINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHE-NLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTK------------NNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLI--DDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGF--PWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 4752
            F+     KSY +    + Y ++ I++   SS+  G++ Y+  +    D++++ + N +VE R + GSG   + S+V +  G+ H ++V R  R   L +DG     G +P     L+      IG A    +  +S    ++ G  GC+  L +      ++Y + +  + ++  S V             +   +P                CQ + PC NG  CQ    EM+ CQCL GY G TC +                             +    +F      +D +    P        E   L+  L +E+ FL    NGL+ +     D    F+S++L+  +LE       G   + S E   +  W  V + ++ +   + +N+  Q   +   P   LN+               +P+F GG    +  + +   S   +F GAIQKI      ++ +ENIR   S I    I+ ++  PC     PC       G C P      C C      + C + +++    A  +    + GK+  +Y     K  +  +             N   +  KT +  G+++   K          +A+  G +E+  +LG K  VLR T    ++ N+W  ++ +R+NR+ +L +  +D +  +      +   L TDG +WLGG +K    +  P  Y+T F GC+ ++ VD+   +LV DA  N  PIL C
Sbjct: 1362 FIPGFGGKSYLAFKMMKAYHTVRIAMEFRSSEQNGLLLYNGQS-LGKDFISLAVNNGFVELRFNTGSGTGIITSKVPIEPGKWHQLVVNRNRRSGMLSVDGESHVNGESPSGTDGLNLDTDLFIGGAPEDQMAVVSERTSLSVGLKGCIRQLDVN----NQLYNLQEGGADVLYGSGVG------------ECGNNP----------------CQPN-PCHNGAACQVKEAEMFHCQCLSGYTGPTCADERNPCDPNPCHVSATCLVLPEGGAKCECPMGREGEFCEKVSNQDLNLPFLPQFNGYSYLEMKGLQTFLAMEVVFLASNPNGLIFYNGQKTDGKGDFVSLSLHDGNLEYRYDLGKGAAVIKSKEKIPLNTWLSVSLERSGRKGLMRINNMEQVTGESPAPHTALNLK--------------EPLFVGGAPDFSKLARAAAAST--SFEGAIQKISIKGLPVLREENIR---SAI---EISTFRSHPCTKKPFPCQN----GGLCSPNKGNYECVCQRGFSGSQCEKVTIE--KAAGESEAVSFDGKTYLEYHIAVTKSTQIPSPFIHFLGSLALLVNQFELSIKTEATQGLILWSGKGTERAYYI-ALAVVGGYVEMTYDLGSKPVVLRST--VPVNTNEWIHIKAVRDNRDGILRVGNEDPVHGSSPFGVKE---LDTDGALWLGGIEKLSASYKLPKAYSTGFIGCMKDVLVDQQDLHLVEDAL-NKPPILYC 2035          

HSP 3 Score: 117.857 bits (294), Expect = 1.052e-25
Identity = 154/568 (27.11%), Postives = 215/568 (37.85%), Query Frame = 1
Query:  526 VQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTK----------IQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCE----NNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGICNEEPRCKEQGK---DCPSYQICKSDLVQAK--CECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQ-MNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK 2136
            + +  PC    C FGA C         AVC C    CQA      VCGSD   Y + C ++   C L+K I +     C R    Q G        C+ ++              C CP + C  S+  +CGTD  TY + CE+   +C     ++    G C  C    C F   C      +   C C      C +   +PVCGS+ VTY ++C LK  SCK+   + V   G C+ +           +   C   +C              +C CD+  C    R  VCG+DGI Y N+C L K  CEK+ +++V     C     ++P     C      C  DN   +        CP   Q    +   +Y   C+ T   C  K           +P +  + GI  +    K+ G    +C      + D  Q    C C T   SGL  S C  DG+         +  CE +  A K         C   KC F + C  +  F   +C  P         VCGSDD TY + C LK  +C + R IT    GPC+
Sbjct:  446 LHSPSPCLNTTCSFGAACVV---KNKKAVCECQQV-CQAVYD--PVCGSDKRTYGNPCELQSTACTLKKEITILHKGPCDRCGKCQFGA------ICEAET------------GRCVCPTE-CVPSAQPVCGTDGNTYESECELHVRACTQQINLQVAAQGDCKTCGNTLCTFGAKC------VNNQCVCLT----CERQPYLPVCGSNGVTYDNQCELKAASCKQMKLIEVSRAGSCEDECGSGTDGSGSGEDSECEQDRCRRYGGSWDEDAEDDRCVCDFT-CHAVLRILVCGSDGITYSNECELKKTRCEKRQDLYVAGQGACRAATTSSPPLVPHCSHTVYGCCPDNI-TAALGVGLAGCPSSCQ---CHQYGSYGGTCDPTTGQCSCKPGVGGLKCDRCEPGFWNFRGIVTD----KKSGCTPCNCDPVGAVRDDCEQMTGLCSCKT-GISGLKCSQC-PDGR------KPGLTGCEKDPSAPK--------SCDAIKCQFGATCVVIGGFAHCECPSPLCAEANLTKVCGSDDVTYGDWCQLKTIACRQGRTITVKHTGPCQ 953          

HSP 4 Score: 77.7962 bits (190), Expect = 1.645e-13
Identity = 87/423 (20.57%), Postives = 158/423 (37.35%), Query Frame = 1
Query: 2560 GSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVD--AVELGFLKDSFAKSYWSGNA-ENYLSINISLVPYSSDGIIFYHSD-TDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV-------SHIWKFKDNSFVIF----------PSESLQLRQRLKL-----EITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILK 3750
            G     C  E   C+  P  +   C V P G +           +  KV    + L FL      SY      + +L++ +  +  + +G+IFY+   TD   D++++ L +  +EYR DLG GA  +KS+ ++ +    S+ +ER  R   + I+  +   G +P   T L+      +G A  P  + L+     +  F G +  + I                                    + V+ + +     E    +     +   PC NGGLC + ++  Y C C  G+ G  CE+V        S    F   +++ +          PS  +     L L     E++    A  GL+ +   G +R   +I++ +   ++E+T         L S       +W H+  ++
Sbjct: 1568 GYTGPTCADERNPCDPNPCHVSATCLVLPEGGAKCECPMGREGEFCEKVSNQDLNLPFLPQFNGYSYLEMKGLQTFLAMEVVFLASNPNGLIFYNGQKTDGKGDFVSLSLHDGNLEYRYDLGKGAAVIKSKEKIPLNTWLSVSLERSGRKGLMRINNMEQVTGESPAPHTALNLKEPLFVGGA--PDFSKLARAAAASTSFEGAIQKISI----------------------------------KGLPVLREENIRSAIEISTFRSHPCTKKPFPCQNGGLC-SPNKGNYECVCQRGFSGSQCEKVTIEKAAGESEAVSFDGKTYLEYHIAVTKSTQIPSPFIHFLGSLALLVNQFELSIKTEATQGLILWSGKGTER-AYYIALAVVGGYVEMTYDLGSKPVVLRSTVPVNTNEWIHIKAVR 1952          

HSP 5 Score: 67.0106 bits (162), Expect = 3.142e-10
Identity = 97/489 (19.84%), Postives = 195/489 (39.88%), Query Frame = 1
Query: 3355 CQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSH-IWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDE--NIRFQNSDIILNN---------------------------------ITQWQGPPCGPLQSPCSKTDP------EKGFCVPEMNETICTCSPKHEN-LCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVE-GFPWEYNTKFKGCISELYV 4689
            C++H PCL+GG C+ + ++ ++C C  G  G  CE+ + + I  F   S++ F  + ++    +++ + F     NGLL +  +G      FIS+ +N   +E+   T  G   + S      GKW+ +V+ +  +   L+++             G  +VN           +    +F GG   +     S   SL     G I+++ +N++  N++   +D++  +                                 ++ + GP C   ++PC   DP           +PE     C C    E   C + S Q     N  F  ++ G S  +   ++       T   + + F  ++ +G++    +    K  F+ +++ +G +E   +LG   G   I   + I  N W +V + R+ R  ++ I++ M +        +  L     +++GGA    +       +T F+G I ++ +
Sbjct: 1324 CESH-PCLHGGTCEDNGKD-FTCSCPAGRGGAVCEKSIKYFIPGFGGKSYLAF--KMMKAYHTVRIAMEFRSSEQNGLLLY--NGQSLGKDFISLAVNNGFVELRFNTGSGTGIITSKVPIEPGKWHQLVVNRNRRSGMLSVD-------------GESHVNGESPSGTDGLNLDTD-LFIGGAPEDQMAVVSERTSLSVGLKGCIRQLDVNNQLYNLQEGGADVLYGSGVGECGNNPCQPNPCHNGAACQVKEAEMFHCQCLSGYTGPTCADERNPC---DPNPCHVSATCLVLPEGGAK-CECPMGREGEFCEKVSNQD---LNLPFLPQFNGYSYLEMKGLQ-------TFLAMEVVFLASNPNGLIFYNGQKTDGKGDFVSLSLHDGNLEYRYDLG--KGAAVIKSKEKIPLNTWLSVSLERSGRKGLMRINN-MEQVTGESPAPHTALNLKEPLFVGGAPDFSKLARAAAASTSFEGAIQKISI 1775          

HSP 6 Score: 56.9954 bits (136), Expect = 3.963e-7
Identity = 30/77 (38.96%), Postives = 44/77 (57.14%), Query Frame = 1
Query: 1021 CKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKI 1251
            C  +KC+F   C ++  G    C+CP+P  LC +     VCGSDDVTY   C LK  +C++  ++TV + G CQ  +
Sbjct:  884 CDAIKCQFGATCVVI--GGFAHCECPSP--LCAEANLTKVCGSDDVTYGDWCQLKTIACRQGRTITVKHTGPCQETV 956          
BLAST of Agrin, putative vs. Ensembl Xenopus
Match: sos1 (SOS Ras/Rac guanine nucleotide exchange factor 1 [Source:Xenbase;Acc:XB-GENE-1011399])

HSP 1 Score: 307.76 bits (787), Expect = 6.709e-84
Identity = 271/926 (29.27%), Postives = 410/926 (44.28%), Query Frame = 1
Query:  202 SDLIIVGRVLNLANSEVI-------VSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDFIMYLKKTEQN------NFFELNYA--KEFGNGLFEKRISVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQV------------PVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCE---NNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQ-------FIKPDEERCPEDCPLGKMCR-----------NGQCVCTDKCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRVAP--------------------SVIGCISHNYIAD-----EKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF------TENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGF 2727
            +++++ G V  + N + +       V V R LKG +++     +   N    ++V        C   + +G+  I ++    ++      N   LN +  +     L E  + V  N    + +  D+ C  + C FGA C+K   +P  A C C  T C +      VCGSD   Y + C ++R +C  Q+ I+V     CG++              C   SC   +TCV +       C CP        + +CG+D   Y N C++ K +C     + +++ GRCD C+      N  C +            NP    T+ +++            PVC  D VTY ++C +      + I L  ++ G+CQ +   D C    C + + C+     V +CSCD + C +T++ PVCG D   Y N C   K  C ++  + V +   C+    +PC    C   +    +  N K+ CEC ++ C  +  PVCG+DK TY + C L  TAC  KK + I++ G C+   RC +    C    IC+++    +C CPT C  S   + VCGTDG TY+SEC + + AC T  I L++A  G C  C N  C+F + C  N     QC+C T       PVCGS+  TY+N+C LK  SC + +LI     G C+ +           ++  C +D      CR           + +CVC   C  V ++ VCG+DG  Y NECELK+  C   + + VA                     +V GC   N  A           SC C+  GS    CDP+T QC CK G+ G  CDRC  G+WNF       ++GCT C+C+  G+    C   TG C+CK    G  CS CP G      GC+++       DA++  F
Sbjct:   42 ANVVLTGTVEEIMNVDPVHHTYSCKVRVWRYLKGREIVTNDILLDGGNK---VMVGGFGDPTICDNQVSTGDTRIFFVNPAPRSMWPTHRNELMLNSSLMRITLRNLEEVEMCVEGNFMFIQFMPIDNMCRGMLCGFGAVCEKSSTDPSQATCICKKTACAS--IVAPVCGSDYSTYSNECELERAQCNQQRRIKVISKGPCGKRCDP-----------CSTVSCSYGSTCVRSTDGQTAKCICPATCTGVPENVVCGSDGKDYHNECQLNKQACDNQENLYKKFDGRCDPCRIAMNNQNKACRV------------NPR---TRQLEMQYRPEYCPVRRDPVCADDGVTYDNDCVMTRSGFIRGIELQKVHSGQCQPQ---DKCKE-DCKHNSVCLNRRG-VTRCSCDRVTCDSTYK-PVCGGDSRTYANDCERQKAECFQKATIPVKHKGPCDLHSPSPCLNTTCS--FGAACVVKNKKAVCEC-QQVCQAVYDPVCGSDKRTYGNPCELQSTACTLKKEITILHKGPCD---RCGK----CQFGAICEAET--GRCVCPTECVPSA--QPVCGTDGNTYESECELHVRAC-TQQINLQVAAQGDCKTCGNTLCTFGAKCVNN-----QCVCLTCERQPYLPVCGSNGVTYDNQCELKAASCKQMKLIEVSRAGSCEDECGSGTDGSGSGEDSECEQD-----RCRRYGGSWDEDAEDDRCVCDFTCHAVLRILVCGSDGITYSNECELKKTRCEKRQDLYVAGQGACRAATTSSPPLVPHCSHTVYGCCPDNITAALGVGLAGCPSSCQCHQYGSYGGTCDPTTGQCSCKPGVGGLKCDRCEPGFWNFRGIVTDKKSGCTPCNCDPVGAVRDDCEQMTGLCSCKTGISGLKCSQCPDGRKPGLTGCEKDPSAPKSCDAIKCQF 905          

HSP 2 Score: 165.622 bits (418), Expect = 3.283e-40
Identity = 169/732 (23.09%), Postives = 298/732 (40.71%), Query Frame = 1
Query: 2725 FLKDSFAKSYWSGNA-ENYLSINISLVPYSSD--GIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITC---------------------------------------EEVVSHIWKF----KDNSFVIFPSESLQ-----LRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHE-NLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLI--DDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGF--PWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 4752
            F+     KSY +    + Y ++ I++   SS+  G++ Y+  +    D++++ + N +VE R + GSG   + S+V +  G+ H ++V R  R   L +DG     G +P     L+      IG A    +  +S    ++ G  GC+  L +      ++Y + +  + ++  S V             +   +P                CQ + PC NG  CQ    EM+ CQCL GY G TC                                       E+V +         + N +     + LQ     L+ +L +E+ FL    NGL+ +     D    F+S++L+  +LE       G   + S E   +  W  V + ++ +   + +N+  Q   +   P   LN+               +P+F GG    +  + +   S   +F GAIQK+             +  N I+ ++  PC     PC       G C P      C C      + C + +++    A  +    + GK+  +Y     K +K+   N   +  KT +  G+ IL     + +  ++ +A+  G +E+  +LG K  VLR T    ++ N+W  ++ +R+NR+ +L +  +D +  +      +   L TDG +WLGG +K    +  P  Y+T F GC+ ++ VD+   +LV DA  N  PIL C
Sbjct: 1378 FIPGFGGKSYLAFKMMKAYHTVRIAMEFRSSEQNGLLLYNGQS-LGKDFISLAVNNGFVELRFNTGSGTGIITSKVPIEPGKWHQLVVNRNRRSGMLSVDGESHVNGESPSGTDGLNLDTDLFIGGAPEDQMAVVSERTSLSVGLKGCIRQLDVN----NQLYNLQEGGADVLYGSGVG------------ECGNNP----------------CQPN-PCHNGAACQVKEAEMFHCQCLSGYTGPTCADERNPCDPNPCHVSATCLVLPEGGAKCECPMGREGEFCEKVSNQDLNLPFLPQFNGYSYLEMKGLQTFATDLQDKLAMEVVFLASNPNGLIFYNGQKTDGKGDFVSLSLHDGNLEYRYDLGKGAAVIKSKEKIPLNTWLSVSLERSGRKGLMRINNMEQVTGESPAPHTALNL--------------KEPLFVGGAPDFSKLARAAAAST--SFEGAIQKV-----------GSLFRNVISTFRSHPCTKKPFPCQN----GGLCSPNKGNYECVCQRGFSGSQCEKVTIE--KAAGESEAVSFDGKTYLEYHIAVTKSEKALLVNQFELSIKTEATQGL-ILWSGKGTERAYYIALAVVGGYVEMTYDLGSKPVVLRST--VPVNTNEWIHIKAVRDNRDGILRVGNEDPVHGSSPFGVKE---LDTDGALWLGGIEKLSASYKLPKAYSTGFIGCMKDVLVDQQDLHLVEDAL-NKPPILYC 2035          

HSP 3 Score: 117.857 bits (294), Expect = 1.035e-25
Identity = 154/568 (27.11%), Postives = 215/568 (37.85%), Query Frame = 1
Query:  526 VQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTK----------IQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCE----NNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGICNEEPRCKEQGK---DCPSYQICKSDLVQAK--CECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQ-MNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK 2136
            + +  PC    C FGA C         AVC C    CQA      VCGSD   Y + C ++   C L+K I +     C R    Q G        C+ ++              C CP + C  S+  +CGTD  TY + CE+   +C     ++    G C  C    C F   C      +   C C      C +   +PVCGS+ VTY ++C LK  SCK+   + V   G C+ +           +   C   +C              +C CD+  C    R  VCG+DGI Y N+C L K  CEK+ +++V     C     ++P     C      C  DN   +        CP   Q    +   +Y   C+ T   C  K           +P +  + GI  +    K+ G    +C      + D  Q    C C T   SGL  S C  DG+         +  CE +  A K         C   KC F + C  +  F   +C  P         VCGSDD TY + C LK  +C + R IT    GPC+
Sbjct:  460 LHSPSPCLNTTCSFGAACVV---KNKKAVCECQQV-CQAVYD--PVCGSDKRTYGNPCELQSTACTLKKEITILHKGPCDRCGKCQFGA------ICEAET------------GRCVCPTE-CVPSAQPVCGTDGNTYESECELHVRACTQQINLQVAAQGDCKTCGNTLCTFGAKC------VNNQCVCLT----CERQPYLPVCGSNGVTYDNQCELKAASCKQMKLIEVSRAGSCEDECGSGTDGSGSGEDSECEQDRCRRYGGSWDEDAEDDRCVCDFT-CHAVLRILVCGSDGITYSNECELKKTRCEKRQDLYVAGQGACRAATTSSPPLVPHCSHTVYGCCPDNI-TAALGVGLAGCPSSCQ---CHQYGSYGGTCDPTTGQCSCKPGVGGLKCDRCEPGFWNFRGIVTD----KKSGCTPCNCDPVGAVRDDCEQMTGLCSCKT-GISGLKCSQC-PDGR------KPGLTGCEKDPSAPK--------SCDAIKCQFGATCVVIGGFAHCECPSPLCAEANLTKVCGSDDVTYGDWCQLKTIACRQGRTITVKHTGPCQ 967          

HSP 4 Score: 70.8626 bits (172), Expect = 2.329e-11
Identity = 84/418 (20.10%), Postives = 158/418 (37.80%), Query Frame = 1
Query: 2560 GSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVD--AVELGFLKDSFAKSY--------WSGNAENYLSINISLVPYSSDGIIFYHSD-TDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV-------SHIWKFKDNSFVIFPSESLQLRQRL---KLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILK 3750
            G     C  E   C+  P  +   C V P G +           +  KV    + L FL      SY        ++ + ++ L++ +  +  + +G+IFY+   TD   D++++ L +  +EYR DLG GA  +KS+ ++ +    S+ +ER  R   + I+  +   G +P   T L+      +G A  P  + L+     +  F G +  +                                  F+N +       +     K+            PC NGGLC + ++  Y C C  G+ G  CE+V        S    F   +++ +     +  + L   + E++    A  GL+ +   G +R   +I++ +   ++E+T         L S       +W H+  ++
Sbjct: 1584 GYTGPTCADERNPCDPNPCHVSATCLVLPEGGAKCECPMGREGEFCEKVSNQDLNLPFLPQFNGYSYLEMKGLQTFATDLQDKLAMEVVFLASNPNGLIFYNGQKTDGKGDFVSLSLHDGNLEYRYDLGKGAAVIKSKEKIPLNTWLSVSLERSGRKGLMRINNMEQVTGESPAPHTALNLKEPLFVGGA--PDFSKLARAAAASTSFEGAIQKVGSL-------------------------------FRNVISTF----RSHPCTKKPF----------PCQNGGLC-SPNKGNYECVCQRGFSGSQCEKVTIEKAAGESEAVSFDGKTYLEYHIAVTKSEKALLVNQFELSIKTEATQGLILWSGKGTERA-YYIALAVVGGYVEMTYDLGSKPVVLRSTVPVNTNEWIHIKAVR 1952          

HSP 5 Score: 70.4774 bits (171), Expect = 2.733e-11
Identity = 93/464 (20.04%), Postives = 185/464 (39.87%), Query Frame = 1
Query: 3355 CQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSH-IWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDE--NIRFQNSDIILNN---------------------------------ITQWQGPPCGPLQSPCSKTDP------EKGFCVPEMNETICTCSPKHEN-LCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGA 4617
            C++H PCL+GG C+ + ++ ++C C  G  G  CE+ + + I  F   S++ F  + ++    +++ + F     NGLL +  +G      FIS+ +N   +E+   T  G   + S      GKW+ +V+ +  +   L+++             G  +VN           +    +F GG   +     S   SL     G I+++ +N++  N++   +D++  +                                 ++ + GP C   ++PC   DP           +PE     C C    E   C + S Q     N  F  ++ G S  +   ++        K  + + F  ++ +G++    +    K  F+ +++ +G +E   +LG   G   I   + I  N W +V + R+ R  ++ I++ M +        +  L     +++GGA
Sbjct: 1340 CESH-PCLHGGTCEDNGKD-FTCSCPAGRGGAVCEKSIKYFIPGFGGKSYLAF--KMMKAYHTVRIAMEFRSSEQNGLLLY--NGQSLGKDFISLAVNNGFVELRFNTGSGTGIITSKVPIEPGKWHQLVVNRNRRSGMLSVD-------------GESHVNGESPSGTDGLNLDTD-LFIGGAPEDQMAVVSERTSLSVGLKGCIRQLDVNNQLYNLQEGGADVLYGSGVGECGNNPCQPNPCHNGAACQVKEAEMFHCQCLSGYTGPTCADERNPC---DPNPCHVSATCLVLPEGGAK-CECPMGREGEFCEKVSNQD---LNLPFLPQFNGYSYLEMKGLQTFATDLQDKLAMEVVFLASNPNGLIFYNGQKTDGKGDFVSLSLHDGNLEYRYDLG--KGAAVIKSKEKIPLNTWLSVSLERSGRKGLMRINN-MEQVTGESPAPHTALNLKEPLFVGGA 1773          

HSP 6 Score: 58.5362 bits (140), Expect = 1.140e-7
Identity = 53/219 (24.20%), Postives = 96/219 (43.84%), Query Frame = 1
Query: 2623 GKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWS-GNAENYLSIN---ISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDV----TDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKP 3255
            G Y  VC  G+S S   C++ +I +   ++  + F   ++ + + +   +E  L +N   +S+   ++ G+I +       + Y+ + +   YVE   DLGS  + L+S V +       I   R NRD  L +   D  +G +P  +  LD      +G      I  LS +  +    + GF+GC+           K  L++QQ   ++E +  KP
Sbjct: 1830 GNYECVCQRGFSGSQ--CEKVTIEKAAGESEAVSFDGKTYLEYHIAVTKSEKALLVNQFELSIKTEATQGLILWSGKGTERAYYIALAVVGGYVEMTYDLGSKPVVLRSTVPVNTNEWIHIKAVRDNRDGILRVGNEDPVHGSSPFGVKELDTDGALWLGG-----IEKLSASYKLPKAYSTGFIGCM-----------KDVLVDQQDLHLVEDALNKP 2030          

HSP 7 Score: 56.9954 bits (136), Expect = 4.133e-7
Identity = 30/77 (38.96%), Postives = 44/77 (57.14%), Query Frame = 1
Query: 1021 CKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKI 1251
            C  +KC+F   C ++  G    C+CP+P  LC +     VCGSDDVTY   C LK  +C++  ++TV + G CQ  +
Sbjct:  898 CDAIKCQFGATCVVI--GGFAHCECPSP--LCAEANLTKVCGSDDVTYGDWCQLKTIACRQGRTITVKHTGPCQETV 970          
BLAST of Agrin, putative vs. Ensembl Mouse
Match: Agrn (agrin [Source:MGI Symbol;Acc:MGI:87961])

HSP 1 Score: 315.079 bits (806), Expect = 2.401e-86
Identity = 255/907 (28.11%), Postives = 393/907 (43.33%), Query Frame = 1
Query:  205 DLIIVGRVLNLANSEVI-------VSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDFIMYLKKT------EQNNFFELNYAK-----------EFGNGLFEKRISVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKN----IQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCEN--NPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGK-MCR-----------NGQCVCTDKCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRVA-------PSVI---------------GCISHNYIADEKN-----KRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFT------ENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKEN 2685
            ++++ G V  + N + +       V V R LKG D++ +   +   N    +++      + C   + +G+  I ++            N   LN +            EF     E +  +    A S      D C  + C FGA C+    +P  A C C    C A      VCGSD   Y + C ++R +C  Q+ I++     CG ++             C + +C   +TCV +       C CP     +    +CG+D + Y + C++ + +C     I +++ G CD C+    + N IC +         +  +P+ L           P+CG D VTY+++C +      + + L  +  G+CQT+   D C    C + + C+        CSCD + C   +R PVC  DG  YDN C+  +  C +Q  +   +   C+   +PC G +C   +       NGK+ CEC +  C     PVCG+D VTY S+C L   AC   + + +   G C+   RC +    C    +C+ +    +C CP+ C +S   + VCG+DG TY SEC + +HAC T+ I+L +A+ G C  C    C+F ++C        QC+CP        PVCGSD  TY + C L+  +C +   I     GPC+            ED    + +CR           +G CVC   C  V K  VCG+DG  Y  EC LK+  C   + + VA       P++                GC   N  A +         +C CN  GS +  CDP T QC C+ G+ G  CDRC  G+WNF        +GCT CSC+  G+    C   TG C+C+P   G  C  CP G ++ + GC+ +
Sbjct:   46 NVVLTGTVEEILNVDPVQHTYSCKVRVWRYLKGKDVVAQESLLDGGNK---VVIGGFGDPLICDNQVSTGDTRIFFVNPAPPYLWPAHKNELMLNSSLMRITLRNLEEVEF---CVEDKPGIHFTAAPS---MPPDVCRGMLCGFGAVCEPSVEDPGRASCVCKKNVCPA--MVAPVCGSDASTYSNECELQRAQCNQQRRIRLLRQGPCGSRDP------------CANVTCSFGSTCVPSADGQTASCLCPTTCFGAPDGTVCGSDGVDYPSECQLLRHACANQEHIFKKFDGPCDPCQGSMSDLNHICRVNP-------RTRHPEMLLRPENCPAQHTPICGDDGVTYENDCVMSRIGAARGLLLQKVRSGQCQTR---DQCPET-CQFNSVCLSRRGR-PHCSCDRVTCDGAYR-PVCAQDGHTYDNDCWRQQAECRQQQTIPPKHQGPCDQTPSPCRGAQCA--FGATCTVKNGKAVCEC-QRVCSGGYDPVCGSDGVTYGSVCELESMACTLGREIRVARRGPCD---RCGQ----CRFGSLCEVE--TGRCVCPSECVESA--QPVCGSDGHTYASECELHVHAC-THQISLYVASAGHCQTCGETVCTFGAVCSAG-----QCVCPRCEHPPPGPVCGSDGVTYLSACELREAACQQQVQIEEARAGPCEPAECGSGGSGSGEDNACEQELCRQHGGVWDEDSEDGPCVCDFSCQSVLKSPVCGSDGVTYSTECHLKKARCEARQELYVAAQGACRGPTLAPLLPMASPHCAQTPYGCCQDNVTAAQGVGLAGCPSTCHCNPHGSYSGTCDPVTGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGHSGCTPCSCDPRGAVRDDCEQMTGLCSCRPGVAGPKCGQCPDGQALGHLGCEAD 896          

HSP 2 Score: 160.229 bits (404), Expect = 1.078e-38
Identity = 162/718 (22.56%), Postives = 293/718 (40.81%), Query Frame = 1
Query: 2650 GYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNV--------KPNCPHID-----FKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV----SHIWKFKDNSFVIFPSESLQ-----LRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCG-PLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK-PV-EGFPWEYNTKFKGCISELYVDEISYNLVLDA 4722
            G+S S    +  ++ E KV    +   K     ++ +  A + L + +      ++G++ Y+ +  R  D+L + L + +V++R D GSG   L S V +  GR H + + R  R   L +DG     G +P     L+      +G      + T+     V  G  GC+  L I      ++ L + Q + +++SS V         PN  H        +  V + + P         + K  + CQ + PC     C   S     C C  G  G  CE V+    S  +    N F     + L      L +++ LE+ FL    +GLL +     D    F+S+ L+  HLE       G   + S E   +G W  V + +  +   L +   P+ + +  +P   LN+               +P++ GG     F+  +   ++   F GAIQ + +    +  Q   +   ++  + G PC   + +PC       G C+P      C C      L     +   +  +      + G++  +Y     + +K+   N+  +  +T +  G+ +L       +  ++ +AI +G ++++ +LG +  VLR T    ++ N+W  V+  R +R   L + +    A +  ++      L TDG +WLGG +K PV +  P  Y T F GC+ ++ V     +L+ DA
Sbjct: 1341 GFSCSCTAGRAGTVCE-KVQLPSVPAFKGHSFLAFPTLRAYHTLRLALEFRALETEGLLLYNGNA-RGKDFLALALLDGHVQFRFDTGSGPAVLTSLVPVEPGRWHRLELSRHWRQGTLSVDGEAPVVGESPSGTDGLNLDTKLYVGGLPEEQVATVLDRTSVGIGLKGCIRMLDIN---NQQLELSDWQRA-VVQSSGVGECGDHPCSPNPCHGGALCQALEAGVFLCQCPPGRFGPTCADEK--NPCQPN-PCHGSAPCHVLSRGGAKCACPLGRSGSFCETVLENAGSRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVFLARGPSGLLLYNGQKTDGKGDFVSLALHNRHLEFRYDLGKGAAIIRSKEPIALGTWVRVFLERNGRKGALQVGDGPRVLGESPVPHTMLNL--------------KEPLYVGGAP--DFSKLARGAAVASGFDGAIQLVSLRGHQLLTQEHVLRAVDVAPFAGHPCTQAVDNPCLN----GGSCIPREATYECLCPGGFSGLHCEKGIVEKSVGDLETL-AFDGRTYIEYLNAVTESEKALQSNHFELSLRTEATQGL-VLWIGKVGERADYMALAIVDGHLQLSYDLGSQPVVLRST--VKVNTNRWLRVRAHREHREGSLQVGN---EAPVTGSSPLGATQLDTDGALWLGGLQKLPVGQALPKAYGTGFVGCLRDVVVGHRQLHLLEDA 2022          

HSP 3 Score: 138.658 bits (348), Expect = 4.640e-32
Identity = 150/586 (25.60%), Postives = 217/586 (37.03%), Query Frame = 1
Query:  529 QNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTK---------IQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENN------PCSGVKCPD-PYQYCRIDNNGK---------STCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGI----------CNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCG--TDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPT-DCVYVRRP-VCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK 2136
            Q   PC    C FGA C    G    AVC C    C  G     VCGSDG+ Y S C ++   C L + I+V+    C R    + G        C+ ++              C CP++ C  S+  +CG+D  TY + CE+   +C     +     G C  C    C F  +C   +      C CP     C      PVCGSD VTY S C L+  +C++++ +     G C+            + + C    C          +    C CD+  C++  + PVCG+DG+ Y  +C L K  CE + E++V     C         P +   C   PY  C+ +             STC C              N   +Y   C+     C  +           +P +  + GI          C+ +PR   +  DC        + +   C C    + G+    CG   DG+      H+   A  T  +            C    C F + C        QC+CPT  C       VCGSD  TY NEC LK  +C +   I+  S GPC+
Sbjct:  465 QTPSPCRGAQCAFGATCTVKNGK---AVCECQRV-CSGGYD--PVCGSDGVTYGSVCELESMACTLGREIRVARRGPCDRCGQCRFG------SLCEVET------------GRCVCPSE-CVESAQPVCGSDGHTYASECELHVHACTHQISLYVASAGHCQTCGETVCTFGAVCSAGQ------CVCPR----CEHPPPGPVCGSDGVTYLSACELREAACQQQVQIEEARAGPCEPAECGSGGSGSGEDNACEQELCRQHGGVWDEDSEDGPCVCDF-SCQSVLKSPVCGSDGVTYSTECHLKKARCEARQELYVAAQGACRGPTLAPLLPMASPHCAQTPYGCCQDNVTAAQGVGLAGCPSTCHC--------------NPHGSYSGTCDPVTGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGHSGCTPCSCDPRGAVR-DDC--------EQMTGLCSC----RPGVAGPKCGQCPDGQALG---HLGCEADPTTPVT-----------CVEMHCEFGASCVEEAGFA-QCVCPTLTCPEANSTKVCGSDGVTYGNECQLKTIACRQRLDISIQSLGPCR 972          

HSP 4 Score: 85.5001 bits (210), Expect = 5.917e-16
Identity = 84/377 (22.28%), Postives = 152/377 (40.32%), Query Frame = 1
Query: 2593 GKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSY--------WSGNAENYLSINISLVPYSSDGIIFYHSD-TDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVS-------HIWKFKDNSFVIF---PSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVT 3666
            G   C  L+ G     CP+G S    G    ++ EN   A    FL D    SY        +  +    +++ +  +     G++ Y+   TD   D++++ L NR++E+R DLG GA  ++S+  + +G    + +ER  R   L +       G +P   T L+      +G A  P  + L+    V  GF G +  + +   +     L+ Q+   ++ + +V P   H     +VD                          PCLNGG C    E  Y C C  G+ G+ CE+ +            F   +++ +    +ES +  Q    E++    A  GL+ +I    +R   ++++ +   HL+++
Sbjct: 1588 GSAPCHVLSRGGAKCACPLGRS----GSFCETVLEN---AGSRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVFLARGPSGLLLYNGQKTDGKGDFVSLALHNRHLEFRYDLGKGAAIIRSKEPIALGTWVRVFLERNGRKGALQVGDGPRVLGESPVPHTMLNLKEPLYVGGA--PDFSKLARGAAVASGFDGAIQLVSLRGHQ-----LLTQE--HVLRAVDVAPFAGH-PCTQAVD-------------------------NPCLNGGSC-IPREATYECLCPGGFSGLHCEKGIVEKSVGDLETLAFDGRTYIEYLNAVTESEKALQSNHFELSLRTEATQGLVLWIGKVGERA-DYMALAIVDGHLQLS 1920          

HSP 5 Score: 73.9442 bits (180), Expect = 1.924e-12
Identity = 88/432 (20.37%), Postives = 167/432 (38.66%), Query Frame = 1
Query: 3367 KPCLNGGLCQ-TSSEEMYSCQCLPGYQGITCEEV-VSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIR---FQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPK-------------HENLCIRNSMQH------------------------DNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDD 4536
            +PCL+GG CQ   S + +SC C  G  G  CE+V +  +  FK +SF+ FP  +L+    L+L + F  L   GLL +  +G+ R   F+++ L   H++    T  G   L S+     G+W+ + + +  +   L+++     + +       LN+++               ++ GG+      +  +  S+     G I+ + IN++ +    +Q + +  + + +    PC P  +PC      +     E    +C C P                N C  ++  H                        +N  +  F   + G S  +   +         K  + + F      G+L+   +    K  F+ +A+ N  +E   +LG    ++R    + I+   W  V + RN R   L + D
Sbjct: 1325 QPCLHGGTCQDLDSGKGFSCSCTAGRAGTVCEKVQLPSVPAFKGHSFLAFP--TLRAYHTLRLALEFRALETEGLLLY--NGNARGKDFLALALLDGHVQFRFDTGSGPAVLTSLVPVEPGRWHRLELSRHWRQGTLSVDGEAPVVGESPSGTDGLNLDTK--------------LYVGGLPEEQVATVLDRTSVGIGLKGCIRMLDINNQQLELSDWQRAVVQSSGVGECGDHPCSP--NPCHGGALCQAL---EAGVFLCQCPPGRFGPTCADEKNPCQPNPCHGSAPCHVLSRGGAKCACPLGRSGSFCETVLENAGSRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVFLARGPSGLLLYNGQKTDGKGDFVSLALHNRHLEFRYDLGKGAAIIR--SKEPIALGTWVRVFLERNGRKGALQVGD 1731          

HSP 6 Score: 59.3066 bits (142), Expect = 4.993e-8
Identity = 65/288 (22.57%), Postives = 110/288 (38.19%), Query Frame = 1
Query:  661 VCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTN-----PYPYCKCPND-KCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIES--CKKKISLTVMYKGKCQTKIQSDI-CSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGV 1497
            VCGSDG+ Y + C +K+  C  ++ + V+    C R       +  ++    Q     PY  C  N           CP+   C+   S         Y+  C+     C     +      RCD C+     F GI      G  T C C +P      + +        +T    C   +    C +      +    C+    + + C  + C +GA C++ +   AQC C  L C       VCG+DG+ Y N+C L  ++C +++++ + +   C  +   GV
Sbjct:  719 VCGSDGVTYSTECHLKKARCEARQELYVAAQGAC-RGPTLAPLLPMASPHCAQT----PYGCCQDNVTAAQGVGLAGCPSTCHCNPHGS---------YSGTCDPVTGQCSCRPGVGGL---RCDRCEPGFWNFRGIVTDGHSGC-TPCSC-DPRGAVRDDCE-------QMTGLCSCRPGVAGPKCGQCPDGQALGHLGCEADPTTPVTCVEMHCEFGASCVEEAG-FAQCVCPTLTCPEANSTKVCGSDGVTYGNECQLKTIACRQRLDISIQSLGPCRESVAPGV 979          
BLAST of Agrin, putative vs. Ensembl Mouse
Match: Agrn (agrin [Source:MGI Symbol;Acc:MGI:87961])

HSP 1 Score: 310.457 bits (794), Expect = 6.037e-85
Identity = 234/780 (30.00%), Postives = 350/780 (44.87%), Query Frame = 1
Query:  514 TSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKN----IQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCEN--NPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGK-MCR-----------NGQCVCTDKCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRVA-------PSVI---------------GCISHNYIADEKN-----KRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFT------ENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKEN 2685
            T+      D C  + C FGA C+    +P  A C C    C A      VCGSD   Y + C ++R +C  Q+ I++     CG ++             C + +C   +TCV +       C CP     +    +CG+D + Y + C++ + +C     I +++ G CD C+    + N IC +         +  +P+ L           P+CG D VTY+++C +      + + L  +  G+CQT+   D C    C + + C+        CSCD + C   +R PVC  DG  YDN C+  +  C +Q  +   +   C+   +PC G +C   +       NGK+ CEC +  C     PVCG+D VTY S+C L   AC   + + +   G C+   RC +    C    +C+ +    +C CP+ C +S   + VCG+DG TY SEC + +HAC T+ I+L +A+ G C  C    C+F ++C        QC+CP        PVCGSD  TY + C L+  +C +   I     GPC+            ED    + +CR           +G CVC   C  V K  VCG+DG  Y  EC LK+  C   + + VA       P++                GC   N  A +         +C CN  GS +  CDP T QC C+ G+ G  CDRC  G+WNF        +GCT CSC+  G+    C   TG C+C+P   G  C  CP G ++ + GC+ +
Sbjct:   57 TAAPSMPPDVCRGMLCGFGAVCEPSVEDPGRASCVCKKNVCPA--MVAPVCGSDASTYSNECELQRAQCNQQRRIRLLRQGPCGSRDP------------CANVTCSFGSTCVPSADGQTASCLCPTTCFGAPDGTVCGSDGVDYPSECQLLRHACANQEHIFKKFDGPCDPCQGSMSDLNHICRVNP-------RTRHPEMLLRPENCPAQHTPICGDDGVTYENDCVMSRIGAARGLLLQKVRSGQCQTR---DQCPET-CQFNSVCLSRRGR-PHCSCDRVTCDGAYR-PVCAQDGHTYDNDCWRQQAECRQQQTIPPKHQGPCDQTPSPCRGAQCA--FGATCTVKNGKAVCEC-QRVCSGGYDPVCGSDGVTYGSVCELESMACTLGREIRVARRGPCD---RCGQ----CRFGSLCEVE--TGRCVCPSECVESA--QPVCGSDGHTYASECELHVHAC-THQISLYVASAGHCQTCGETVCTFGAVCSAG-----QCVCPRCEHPPPGPVCGSDGVTYLSACELREAACQQQVQIEEARAGPCEPAECGSGGSGSGEDNACEQELCRQHGGVWDEDSEDGPCVCDFSCQSVLKSPVCGSDGVTYSTECHLKKARCEARQELYVAAQGACRGPTLAPLLPMASPHCAQTPYGCCQDNVTAAQGVGLAGCPSTCHCNPHGSYSGTCDPVTGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGHSGCTPCSCDPRGAVRDDCEQMTGLCSCRPGVAGPKCGQCPDGQALGHLGCEAD 789          

HSP 2 Score: 160.229 bits (404), Expect = 1.128e-38
Identity = 162/718 (22.56%), Postives = 293/718 (40.81%), Query Frame = 1
Query: 2650 GYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNV--------KPNCPHID-----FKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV----SHIWKFKDNSFVIFPSESLQ-----LRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCG-PLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK-PV-EGFPWEYNTKFKGCISELYVDEISYNLVLDA 4722
            G+S S    +  ++ E KV    +   K     ++ +  A + L + +      ++G++ Y+ +  R  D+L + L + +V++R D GSG   L S V +  GR H + + R  R   L +DG     G +P     L+      +G      + T+     V  G  GC+  L I      ++ L + Q + +++SS V         PN  H        +  V + + P         + K  + CQ + PC     C   S     C C  G  G  CE V+    S  +    N F     + L      L +++ LE+ FL    +GLL +     D    F+S+ L+  HLE       G   + S E   +G W  V + +  +   L +   P+ + +  +P   LN+               +P++ GG     F+  +   ++   F GAIQ + +    +  Q   +   ++  + G PC   + +PC       G C+P      C C      L     +   +  +      + G++  +Y     + +K+   N+  +  +T +  G+ +L       +  ++ +AI +G ++++ +LG +  VLR T    ++ N+W  V+  R +R   L + +    A +  ++      L TDG +WLGG +K PV +  P  Y T F GC+ ++ V     +L+ DA
Sbjct: 1234 GFSCSCTAGRAGTVCE-KVQLPSVPAFKGHSFLAFPTLRAYHTLRLALEFRALETEGLLLYNGNA-RGKDFLALALLDGHVQFRFDTGSGPAVLTSLVPVEPGRWHRLELSRHWRQGTLSVDGEAPVVGESPSGTDGLNLDTKLYVGGLPEEQVATVLDRTSVGIGLKGCIRMLDIN---NQQLELSDWQRA-VVQSSGVGECGDHPCSPNPCHGGALCQALEAGVFLCQCPPGRFGPTCADEK--NPCQPN-PCHGSAPCHVLSRGGAKCACPLGRSGSFCETVLENAGSRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVFLARGPSGLLLYNGQKTDGKGDFVSLALHNRHLEFRYDLGKGAAIIRSKEPIALGTWVRVFLERNGRKGALQVGDGPRVLGESPVPHTMLNL--------------KEPLYVGGAP--DFSKLARGAAVASGFDGAIQLVSLRGHQLLTQEHVLRAVDVAPFAGHPCTQAVDNPCLN----GGSCIPREATYECLCPGGFSGLHCEKGIVEKSVGDLETL-AFDGRTYIEYLNAVTESEKALQSNHFELSLRTEATQGL-VLWIGKVGERADYMALAIVDGHLQLSYDLGSQPVVLRST--VKVNTNRWLRVRAHREHREGSLQVGN---EAPVTGSSPLGATQLDTDGALWLGGLQKLPVGQALPKAYGTGFVGCLRDVVVGHRQLHLLEDA 1915          

HSP 3 Score: 137.887 bits (346), Expect = 6.455e-32
Identity = 150/586 (25.60%), Postives = 217/586 (37.03%), Query Frame = 1
Query:  529 QNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTK---------IQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENN------PCSGVKCPD-PYQYCRIDNNGK---------STCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGI----------CNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCG--TDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPT-DCVYVRRP-VCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK 2136
            Q   PC    C FGA C    G    AVC C    C  G     VCGSDG+ Y S C ++   C L + I+V+    C R    + G        C+ ++              C CP++ C  S+  +CG+D  TY + CE+   +C     +     G C  C    C F  +C   +      C CP     C      PVCGSD VTY S C L+  +C++++ +     G C+            + + C    C          +    C CD+  C++  + PVCG+DG+ Y  +C L K  CE + E++V     C         P +   C   PY  C+ +             STC C              N   +Y   C+     C  +           +P +  + GI          C+ +PR   +  DC        + +   C C    + G+    CG   DG+      H+   A  T  +            C    C F + C        QC+CPT  C       VCGSD  TY NEC LK  +C +   I+  S GPC+
Sbjct:  358 QTPSPCRGAQCAFGATCTVKNGK---AVCECQRV-CSGGYD--PVCGSDGVTYGSVCELESMACTLGREIRVARRGPCDRCGQCRFG------SLCEVET------------GRCVCPSE-CVESAQPVCGSDGHTYASECELHVHACTHQISLYVASAGHCQTCGETVCTFGAVCSAGQ------CVCPR----CEHPPPGPVCGSDGVTYLSACELREAACQQQVQIEEARAGPCEPAECGSGGSGSGEDNACEQELCRQHGGVWDEDSEDGPCVCDF-SCQSVLKSPVCGSDGVTYSTECHLKKARCEARQELYVAAQGACRGPTLAPLLPMASPHCAQTPYGCCQDNVTAAQGVGLAGCPSTCHC--------------NPHGSYSGTCDPVTGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGHSGCTPCSCDPRGAVR-DDC--------EQMTGLCSC----RPGVAGPKCGQCPDGQALG---HLGCEADPTTPVT-----------CVEMHCEFGASCVEEAGFA-QCVCPTLTCPEANSTKVCGSDGVTYGNECQLKTIACRQRLDISIQSLGPCR 865          

HSP 4 Score: 85.1149 bits (209), Expect = 7.719e-16
Identity = 84/377 (22.28%), Postives = 152/377 (40.32%), Query Frame = 1
Query: 2593 GKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSY--------WSGNAENYLSINISLVPYSSDGIIFYHSD-TDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVS-------HIWKFKDNSFVIF---PSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVT 3666
            G   C  L+ G     CP+G S    G    ++ EN   A    FL D    SY        +  +    +++ +  +     G++ Y+   TD   D++++ L NR++E+R DLG GA  ++S+  + +G    + +ER  R   L +       G +P   T L+      +G A  P  + L+    V  GF G +  + +   +     L+ Q+   ++ + +V P   H     +VD                          PCLNGG C    E  Y C C  G+ G+ CE+ +            F   +++ +    +ES +  Q    E++    A  GL+ +I    +R   ++++ +   HL+++
Sbjct: 1481 GSAPCHVLSRGGAKCACPLGRS----GSFCETVLEN---AGSRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVFLARGPSGLLLYNGQKTDGKGDFVSLALHNRHLEFRYDLGKGAAIIRSKEPIALGTWVRVFLERNGRKGALQVGDGPRVLGESPVPHTMLNLKEPLYVGGA--PDFSKLARGAAVASGFDGAIQLVSLRGHQ-----LLTQE--HVLRAVDVAPFAGH-PCTQAVD-------------------------NPCLNGGSC-IPREATYECLCPGGFSGLHCEKGIVEKSVGDLETLAFDGRTYIEYLNAVTESEKALQSNHFELSLRTEATQGLVLWIGKVGERA-DYMALAIVDGHLQLS 1813          

HSP 5 Score: 73.559 bits (179), Expect = 2.274e-12
Identity = 88/432 (20.37%), Postives = 167/432 (38.66%), Query Frame = 1
Query: 3367 KPCLNGGLCQ-TSSEEMYSCQCLPGYQGITCEEV-VSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIR---FQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPK-------------HENLCIRNSMQH------------------------DNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDD 4536
            +PCL+GG CQ   S + +SC C  G  G  CE+V +  +  FK +SF+ FP  +L+    L+L + F  L   GLL +  +G+ R   F+++ L   H++    T  G   L S+     G+W+ + + +  +   L+++     + +       LN+++               ++ GG+      +  +  S+     G I+ + IN++ +    +Q + +  + + +    PC P  +PC      +     E    +C C P                N C  ++  H                        +N  +  F   + G S  +   +         K  + + F      G+L+   +    K  F+ +A+ N  +E   +LG    ++R    + I+   W  V + RN R   L + D
Sbjct: 1218 QPCLHGGTCQDLDSGKGFSCSCTAGRAGTVCEKVQLPSVPAFKGHSFLAFP--TLRAYHTLRLALEFRALETEGLLLY--NGNARGKDFLALALLDGHVQFRFDTGSGPAVLTSLVPVEPGRWHRLELSRHWRQGTLSVDGEAPVVGESPSGTDGLNLDTK--------------LYVGGLPEEQVATVLDRTSVGIGLKGCIRMLDINNQQLELSDWQRAVVQSSGVGECGDHPCSP--NPCHGGALCQAL---EAGVFLCQCPPGRFGPTCADEKNPCQPNPCHGSAPCHVLSRGGAKCACPLGRSGSFCETVLENAGSRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVFLARGPSGLLLYNGQKTDGKGDFVSLALHNRHLEFRYDLGKGAAIIR--SKEPIALGTWVRVFLERNGRKGALQVGD 1624          

HSP 6 Score: 59.3066 bits (142), Expect = 5.965e-8
Identity = 65/288 (22.57%), Postives = 110/288 (38.19%), Query Frame = 1
Query:  661 VCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYP-----YCKCPND-KCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIES--CKKKISLTVMYKGKCQTKIQSDI-CSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGV 1497
            VCGSDG+ Y + C +K+  C  ++ + V+    C R       +  ++    Q     PY  C  N           CP+   C+   S         Y+  C+     C     +      RCD C+     F GI      G  T C C +P      + +        +T    C   +    C +      +    C+    + + C  + C +GA C++ +   AQC C  L C       VCG+DG+ Y N+C L  ++C +++++ + +   C  +   GV
Sbjct:  612 VCGSDGVTYSTECHLKKARCEARQELYVAAQGAC-RGPTLAPLLPMASPHCAQT----PYGCCQDNVTAAQGVGLAGCPSTCHCNPHGS---------YSGTCDPVTGQCSCRPGVGGL---RCDRCEPGFWNFRGIVTDGHSGC-TPCSC-DPRGAVRDDCE-------QMTGLCSCRPGVAGPKCGQCPDGQALGHLGCEADPTTPVTCVEMHCEFGASCVEEAG-FAQCVCPTLTCPEANSTKVCGSDGVTYGNECQLKTIACRQRLDISIQSLGPCRESVAPGV 872          
BLAST of Agrin, putative vs. Ensembl Mouse
Match: Agrn (agrin [Source:MGI Symbol;Acc:MGI:87961])

HSP 1 Score: 310.457 bits (794), Expect = 6.875e-85
Identity = 234/780 (30.00%), Postives = 350/780 (44.87%), Query Frame = 1
Query:  514 TSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKN----IQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCEN--NPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGK-MCR-----------NGQCVCTDKCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRVA-------PSVI---------------GCISHNYIADEKN-----KRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFT------ENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKEN 2685
            T+      D C  + C FGA C+    +P  A C C    C A      VCGSD   Y + C ++R +C  Q+ I++     CG ++             C + +C   +TCV +       C CP     +    +CG+D + Y + C++ + +C     I +++ G CD C+    + N IC +         +  +P+ L           P+CG D VTY+++C +      + + L  +  G+CQT+   D C    C + + C+        CSCD + C   +R PVC  DG  YDN C+  +  C +Q  +   +   C+   +PC G +C   +       NGK+ CEC +  C     PVCG+D VTY S+C L   AC   + + +   G C+   RC +    C    +C+ +    +C CP+ C +S   + VCG+DG TY SEC + +HAC T+ I+L +A+ G C  C    C+F ++C        QC+CP        PVCGSD  TY + C L+  +C +   I     GPC+            ED    + +CR           +G CVC   C  V K  VCG+DG  Y  EC LK+  C   + + VA       P++                GC   N  A +         +C CN  GS +  CDP T QC C+ G+ G  CDRC  G+WNF        +GCT CSC+  G+    C   TG C+C+P   G  C  CP G ++ + GC+ +
Sbjct:   57 TAAPSMPPDVCRGMLCGFGAVCEPSVEDPGRASCVCKKNVCPA--MVAPVCGSDASTYSNECELQRAQCNQQRRIRLLRQGPCGSRDP------------CANVTCSFGSTCVPSADGQTASCLCPTTCFGAPDGTVCGSDGVDYPSECQLLRHACANQEHIFKKFDGPCDPCQGSMSDLNHICRVNP-------RTRHPEMLLRPENCPAQHTPICGDDGVTYENDCVMSRIGAARGLLLQKVRSGQCQTR---DQCPET-CQFNSVCLSRRGR-PHCSCDRVTCDGAYR-PVCAQDGHTYDNDCWRQQAECRQQQTIPPKHQGPCDQTPSPCRGAQCA--FGATCTVKNGKAVCEC-QRVCSGGYDPVCGSDGVTYGSVCELESMACTLGREIRVARRGPCD---RCGQ----CRFGSLCEVE--TGRCVCPSECVESA--QPVCGSDGHTYASECELHVHAC-THQISLYVASAGHCQTCGETVCTFGAVCSAG-----QCVCPRCEHPPPGPVCGSDGVTYLSACELREAACQQQVQIEEARAGPCEPAECGSGGSGSGEDNACEQELCRQHGGVWDEDSEDGPCVCDFSCQSVLKSPVCGSDGVTYSTECHLKKARCEARQELYVAAQGACRGPTLAPLLPMASPHCAQTPYGCCQDNVTAAQGVGLAGCPSTCHCNPHGSYSGTCDPVTGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGHSGCTPCSCDPRGAVRDDCEQMTGLCSCRPGVAGPKCGQCPDGQALGHLGCEAD 789          

HSP 2 Score: 147.902 bits (372), Expect = 5.848e-35
Identity = 166/741 (22.40%), Postives = 296/741 (39.95%), Query Frame = 1
Query: 2650 GYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNV--------KPNCPHID-----FKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV----SHIWKFKDNSFVIFPSESLQ-----LRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPI----KKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCG-PLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYA-AVKQKR------------------DKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK-PV-EGFPWEYNTKFKGCISELYVDEISYNLVLDA 4722
            G+S S    +  ++ E KV    +   K     ++ +  A + L + +      ++G++ Y+ +  R  D+L + L + +V++R D GSG   L S V +  GR H + + R  R   L +DG     G +P     L+      +G      + T+     V  G  GC+  L I      ++ L + Q + +++SS V         PN  H        +  V + + P         + K  + CQ + PC     C   S     C C  G  G  CE V+    S  +    N F     + L      L +++ LE+ FL    +GLL +     D    F+S+ L+  HLE       G   + S E   +G W  V + +  +   L +   P+ +    K R +P   LN+               +P++ GG     F+  +   ++   F GAIQ + +    +  Q   +   ++  + G PC   + +PC       G C+P      C C      L     +   +  +      + G++  +Y  AV +                    +K+   N+  +  +T +  G+ +L       +  ++ +AI +G ++++ +LG +  VLR T    ++ N+W  V+  R +R   L + +    A +  ++      L TDG +WLGG +K PV +  P  Y T F GC+ ++ V     +L+ DA
Sbjct: 1234 GFSCSCTAGRAGTVCE-KVQLPSVPAFKGHSFLAFPTLRAYHTLRLALEFRALETEGLLLYNGNA-RGKDFLALALLDGHVQFRFDTGSGPAVLTSLVPVEPGRWHRLELSRHWRQGTLSVDGEAPVVGESPSGTDGLNLDTKLYVGGLPEEQVATVLDRTSVGIGLKGCIRMLDIN---NQQLELSDWQRA-VVQSSGVGECGDHPCSPNPCHGGALCQALEAGVFLCQCPPGRFGPTCADEK--NPCQPN-PCHGSAPCHVLSRGGAKCACPLGRSGSFCETVLENAGSRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVFLARGPSGLLLYNGQKTDGKGDFVSLALHNRHLEFRYDLGKGAAIIRSKEPIALGTWVRVFLERNGRKGALQVGDGPRVLGESPKSRKVPHTMLNL--------------KEPLYVGGAP--DFSKLARGAAVASGFDGAIQLVSLRGHQLLTQEHVLRAVDVAPFAGHPCTQAVDNPCLN----GGSCIPREATYECLCPGGFSGLHCEKGIVEKSVGDLETL-AFDGRTYIEYLNAVTESELTNEIPAPETLDSRALFSEKALQSNHFELSLRTEATQGL-VLWIGKVGERADYMALAIVDGHLQLSYDLGSQPVVLRST--VKVNTNRWLRVRAHREHREGSLQVGN---EAPVTGSSPLGATQLDTDGALWLGGLQKLPVGQALPKAYGTGFVGCLRDVVVGHRQLHLLEDA 1938          

HSP 3 Score: 137.887 bits (346), Expect = 6.714e-32
Identity = 150/586 (25.60%), Postives = 217/586 (37.03%), Query Frame = 1
Query:  529 QNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTK---------IQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENN------PCSGVKCPD-PYQYCRIDNNGK---------STCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGI----------CNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCG--TDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPT-DCVYVRRP-VCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK 2136
            Q   PC    C FGA C    G    AVC C    C  G     VCGSDG+ Y S C ++   C L + I+V+    C R    + G        C+ ++              C CP++ C  S+  +CG+D  TY + CE+   +C     +     G C  C    C F  +C   +      C CP     C      PVCGSD VTY S C L+  +C++++ +     G C+            + + C    C          +    C CD+  C++  + PVCG+DG+ Y  +C L K  CE + E++V     C         P +   C   PY  C+ +             STC C              N   +Y   C+     C  +           +P +  + GI          C+ +PR   +  DC        + +   C C    + G+    CG   DG+      H+   A  T  +            C    C F + C        QC+CPT  C       VCGSD  TY NEC LK  +C +   I+  S GPC+
Sbjct:  358 QTPSPCRGAQCAFGATCTVKNGK---AVCECQRV-CSGGYD--PVCGSDGVTYGSVCELESMACTLGREIRVARRGPCDRCGQCRFG------SLCEVET------------GRCVCPSE-CVESAQPVCGSDGHTYASECELHVHACTHQISLYVASAGHCQTCGETVCTFGAVCSAGQ------CVCPR----CEHPPPGPVCGSDGVTYLSACELREAACQQQVQIEEARAGPCEPAECGSGGSGSGEDNACEQELCRQHGGVWDEDSEDGPCVCDF-SCQSVLKSPVCGSDGVTYSTECHLKKARCEARQELYVAAQGACRGPTLAPLLPMASPHCAQTPYGCCQDNVTAAQGVGLAGCPSTCHC--------------NPHGSYSGTCDPVTGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGHSGCTPCSCDPRGAVR-DDC--------EQMTGLCSC----RPGVAGPKCGQCPDGQALG---HLGCEADPTTPVT-----------CVEMHCEFGASCVEEAGFA-QCVCPTLTCPEANSTKVCGSDGVTYGNECQLKTIACRQRLDISIQSLGPCR 865          

HSP 4 Score: 75.8702 bits (185), Expect = 4.483e-13
Identity = 92/426 (21.60%), Postives = 163/426 (38.26%), Query Frame = 1
Query: 2593 GKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSY--------WSGNAENYLSINISLVPYSSDGIIFYHSD-TDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFL----TNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVS-------HIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIG-KWNHVVILKAAKYIYLNLNHSPQPIKKR 3807
            G   C  L+ G     CP+G S    G    ++ EN   A    FL D    SY        +  +    +++ +  +     G++ Y+   TD   D++++ L NR++E+R DLG GA  ++S+  + +G    + +ER  R   L +       G +P       T L+      +G A  P  + L+    V  GF G +  + +   +     L+ Q+   ++ + +V P   H     +VD                          PCLNGG C    E  Y C C  G+ G+ CE+ +            F   +++ +      L    + E+T    A   L        D    F    L  NH E++ RT    T+ + +    +G + +++ +     ++ L+ +   QP+  R
Sbjct: 1481 GSAPCHVLSRGGAKCACPLGRS----GSFCETVLEN---AGSRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVFLARGPSGLLLYNGQKTDGKGDFVSLALHNRHLEFRYDLGKGAAIIRSKEPIALGTWVRVFLERNGRKGALQVGDGPRVLGESPKSRKVPHTMLNLKEPLYVGGA--PDFSKLARGAAVASGFDGAIQLVSLRGHQ-----LLTQE--HVLRAVDVAPFAGH-PCTQAVD-------------------------NPCLNGGSC-IPREATYECLCPGGFSGLHCEKGIVEKSVGDLETLAFDGRTYIEY------LNAVTESELTNEIPAPETL--------DSRALFSEKALQSNHFELSLRTE--ATQGLVLWIGKVGERADYMALAIVDGHLQLSYDLGSQPVVLR 1847          

HSP 5 Score: 73.9442 bits (180), Expect = 2.222e-12
Identity = 88/432 (20.37%), Postives = 167/432 (38.66%), Query Frame = 1
Query: 3367 KPCLNGGLCQ-TSSEEMYSCQCLPGYQGITCEEV-VSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIR---FQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPK-------------HENLCIRNSMQH------------------------DNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDD 4536
            +PCL+GG CQ   S + +SC C  G  G  CE+V +  +  FK +SF+ FP  +L+    L+L + F  L   GLL +  +G+ R   F+++ L   H++    T  G   L S+     G+W+ + + +  +   L+++     + +       LN+++               ++ GG+      +  +  S+     G I+ + IN++ +    +Q + +  + + +    PC P  +PC      +     E    +C C P                N C  ++  H                        +N  +  F   + G S  +   +         K  + + F      G+L+   +    K  F+ +A+ N  +E   +LG    ++R    + I+   W  V + RN R   L + D
Sbjct: 1218 QPCLHGGTCQDLDSGKGFSCSCTAGRAGTVCEKVQLPSVPAFKGHSFLAFP--TLRAYHTLRLALEFRALETEGLLLY--NGNARGKDFLALALLDGHVQFRFDTGSGPAVLTSLVPVEPGRWHRLELSRHWRQGTLSVDGEAPVVGESPSGTDGLNLDTK--------------LYVGGLPEEQVATVLDRTSVGIGLKGCIRMLDINNQQLELSDWQRAVVQSSGVGECGDHPCSP--NPCHGGALCQAL---EAGVFLCQCPPGRFGPTCADEKNPCQPNPCHGSAPCHVLSRGGAKCACPLGRSGSFCETVLENAGSRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVFLARGPSGLLLYNGQKTDGKGDFVSLALHNRHLEFRYDLGKGAAIIR--SKEPIALGTWVRVFLERNGRKGALQVGD 1624          

HSP 6 Score: 58.9214 bits (141), Expect = 6.610e-8
Identity = 67/298 (22.48%), Postives = 109/298 (36.58%), Query Frame = 1
Query:  661 VCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTN-----PYPYCKCPND-KCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDEL------------CTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDI-CSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGV 1497
            VCGSDG+ Y + C +K+  C  ++ + V+    C R       +  ++    Q     PY  C  N           CP+   C+   S         Y+  C+     C     +      RCD C+     F GI      G  T C C     +            C   +  P CG                C    +L  +    C+    + + C  + C +GA C++ +   AQC C  L C       VCG+DG+ Y N+C L  ++C +++++ + +   C  +   GV
Sbjct:  612 VCGSDGVTYSTECHLKKARCEARQELYVAAQGAC-RGPTLAPLLPMASPHCAQT----PYGCCQDNVTAAQGVGLAGCPSTCHCNPHGS---------YSGTCDPVTGQCSCRPGVGGL---RCDRCEPGFWNFRGIVTDGHSGC-TPCSCDPRGAVRDDCEQMTGLCSCRPGVAGPKCGQ---------------CPDGQALGHL---GCEADPTTPVTCVEMHCEFGASCVEEAG-FAQCVCPTLTCPEANSTKVCGSDGVTYGNECQLKTIACRQRLDISIQSLGPCRESVAPGV 872          
BLAST of Agrin, putative vs. Ensembl Mouse
Match: Agrn (agrin [Source:MGI Symbol;Acc:MGI:87961])

HSP 1 Score: 298.901 bits (764), Expect = 8.274e-83
Identity = 248/851 (29.14%), Postives = 372/851 (43.71%), Query Frame = 1
Query:  337 ILVRKIKYIINCKISIKSGEDFIMYLKKTEQNNFFELNYAKEFGNGLFEKRISVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKN----IQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCEN--NPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGK-MCR-----------NGQCVCTDKCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRVA-------PSVI---------------GCISHNYIADEKN-----KRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFT------ENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVEL 2721
            +LVR   ++I C I         + L  T    F  L +   +  G+            T+      D C  + C FGA C+    +P  A C C    C A      VCGSD   Y + C ++R +C  Q+ I++     CG ++             C + +C   +TCV +       C CP     +    +CG+D + Y + C++ + +C     I +++ G CD C+    + N IC +         +  +P+ L           P+CG D VTY+++C +      + + L  +  G+CQT+   D C    C + + C+        CSCD + C   +R PVC  DG  YDN C+  +  C +Q  +   +   C+   +PC G +C   +       NGK+ CEC +  C     PVCG+D VTY S+C L   AC   + + +   G C+   RC +    C    +C+ +    +C CP+ C +S   + VCG+DG TY SEC + +HAC T+ I+L +A+ G C  C    C+F ++C        QC+CP        PVCGSD  TY + C L+  +C +   I     GPC+            ED    + +CR           +G CVC   C  V K  VCG+DG  Y  EC LK+  C   + + VA       P++                GC   N  A +         +C CN  GS +  CDP T QC C+ G+ G  CDRC  G+WNF        +GCT CSC+  G+    C   TG C+C+P   G  C  CP G ++ + GC+ +      V  VE+
Sbjct:   18 VLVRY--FMIPCNI--------CLILLATSTLGFAVLLFLSNYKPGIH----------FTAAPSMPPDVCRGMLCGFGAVCEPSVEDPGRASCVCKKNVCPA--MVAPVCGSDASTYSNECELQRAQCNQQRRIRLLRQGPCGSRDP------------CANVTCSFGSTCVPSADGQTASCLCPTTCFGAPDGTVCGSDGVDYPSECQLLRHACANQEHIFKKFDGPCDPCQGSMSDLNHICRVNP-------RTRHPEMLLRPENCPAQHTPICGDDGVTYENDCVMSRIGAARGLLLQKVRSGQCQTR---DQCPET-CQFNSVCLSRRGR-PHCSCDRVTCDGAYR-PVCAQDGHTYDNDCWRQQAECRQQQTIPPKHQGPCDQTPSPCRGAQCA--FGATCTVKNGKAVCEC-QRVCSGGYDPVCGSDGVTYGSVCELESMACTLGREIRVARRGPCD---RCGQ----CRFGSLCEVET--GRCVCPSECVESA--QPVCGSDGHTYASECELHVHAC-THQISLYVASAGHCQTCGETVCTFGAVCSAG-----QCVCPRCEHPPPGPVCGSDGVTYLSACELREAACQQQVQIEEARAGPCEPAECGSGGSGSGEDNACEQELCRQHGGVWDEDSEDGPCVCDFSCQSVLKSPVCGSDGVTYSTECHLKKARCEARQELYVAAQGACRGPTLAPLLPMASPHCAQTPYGCCQDNVTAAQGVGLAGCPSTCHCNPHGSYSGTCDPVTGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGHSGCTPCSCDPRGAVRDDCEQMTGLCSCRPGVAGPKCGQCPDGQALGHLGCEADPT--TPVTCVEM 799          

HSP 2 Score: 129.413 bits (324), Expect = 1.847e-29
Identity = 150/586 (25.60%), Postives = 217/586 (37.03%), Query Frame = 1
Query:  529 QNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTK---------IQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENN------PCSGVKCPD-PYQYCRIDNNGK---------STCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGI----------CNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCG--TDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPT-DCVYVRRP-VCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK 2136
            Q   PC    C FGA C    G    AVC C    C  G     VCGSDG+ Y S C ++   C L + I+V+    C R    + G        C+ ++              C CP++ C  S+  +CG+D  TY + CE+   +C     +     G C  C    C F  +C   +      C CP     C      PVCGSD VTY S C L+  +C++++ +     G C+            + + C    C          +    C CD+  C++  + PVCG+DG+ Y  +C L K  CE + E++V     C         P +   C   PY  C+ +             STC C              N   +Y   C+     C  +           +P +  + GI          C+ +PR   +  DC        + +   C C    + G+    CG   DG+      H+   A  T  +            C    C F + C        QC+CPT  C       VCGSD  TY NEC LK  +C +   I+  S GPC+
Sbjct:  358 QTPSPCRGAQCAFGATCTVKNGK---AVCECQRV-CSGGYD--PVCGSDGVTYGSVCELESMACTLGREIRVARRGPCDRCGQCRFG------SLCEVET------------GRCVCPSE-CVESAQPVCGSDGHTYASECELHVHACTHQISLYVASAGHCQTCGETVCTFGAVCSAGQ------CVCPR----CEHPPPGPVCGSDGVTYLSACELREAACQQQVQIEEARAGPCEPAECGSGGSGSGEDNACEQELCRQHGGVWDEDSEDGPCVCDF-SCQSVLKSPVCGSDGVTYSTECHLKKARCEARQELYVAAQGACRGPTLAPLLPMASPHCAQTPYGCCQDNVTAAQGVGLAGCPSTCHC--------------NPHGSYSGTCDPVTGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGHSGCTPCSCDPRGAVR-DDC--------EQMTGLCSC----RPGVAGPKCGQCPDGQALG---HLGCEADPTTPVT-----------CVEMHCEFGASCVEEAGFA-QCVCPTLTCPEANSTKVCGSDGVTYGNECQLKTIACRQRLDISIQSLGPCR 865          

HSP 3 Score: 55.4546 bits (132), Expect = 6.525e-7
Identity = 65/289 (22.49%), Postives = 110/289 (38.06%), Query Frame = 1
Query:  661 VCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYP-----YCKCPND-KCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIES--CKKKISLTVMYKGKCQTKIQSDI-CSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVK 1500
            VCGSDG+ Y + C +K+  C  ++ + V+    C R       +  ++    Q     PY  C  N           CP+   C+   S         Y+  C+     C     +      RCD C+     F GI      G  T C C +P      + +        +T    C   +    C +      +    C+    + + C  + C +GA C++ +   AQC C  L C       VCG+DG+ Y N+C L  ++C +++++ + +   C  +   GV 
Sbjct:  612 VCGSDGVTYSTECHLKKARCEARQELYVAAQGAC-RGPTLAPLLPMASPHCAQT----PYGCCQDNVTAAQGVGLAGCPSTCHCNPHGS---------YSGTCDPVTGQCSCRPGVGGL---RCDRCEPGFWNFRGIVTDGHSGC-TPCSC-DPRGAVRDDCE-------QMTGLCSCRPGVAGPKCGQCPDGQALGHLGCEADPTTPVTCVEMHCEFGASCVEEAG-FAQCVCPTLTCPEANSTKVCGSDGVTYGNECQLKTIACRQRLDISIQSLGPCRESVAPGVS 873          
BLAST of Agrin, putative vs. Ensembl Mouse
Match: Egflam (EGF-like, fibronectin type III and laminin G domains [Source:MGI Symbol;Acc:MGI:2146149])

HSP 1 Score: 127.487 bits (319), Expect = 7.132e-29
Identity = 148/668 (22.16%), Postives = 271/668 (40.57%), Query Frame = 1
Query: 2764 NAENYLSINISLVPYSSDGIIFYHSDTDRS-SDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQT----HKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVS-HIWKFKDN----SFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENL-CIRNSMQH--DNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXV-IAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISELYVD-EISYNLVLDA 4722
            N+     + +     + DG++ Y  +++    D++++ L  R + +R + G+G   + S  ++ +G  H++ + R   +  L ++      G +    + +       +G A  P    L        GF GC+ SL +                   +  +++P  P     N  DV E                  C +       C++GG C     + Y C C  G++G  CE+  +  I +F+++    +   +P E        + EITF P + +G+L +  D   ++  F+S+ +   H+E       G   L S     +G+W+ + + + AK   L ++   Q + + +   GF  +              N  IF GGV  N  +   N   L P F G+IQKI++ND  I  ++      N+     P  G   +PC+      G C P      C C    E L C +    H  +         +++G+S   Y      +  S +++N  ++FKT + DG+L+          S  + + +R+G +  + NLG  +GV  I  N + SD +WH V+ +R+ ++  + +DD   R           L  +G +++GG K+       +Y     GCIS   +  +   +LV DA
Sbjct:  404 NSYQAFQVTLEFRAEAEDGLLLYCGESEHGRGDFMSLALIRRSLHFRFNCGTGIAIIISETKIKLGAWHTVTLYRDGLNGMLQLNNGTPVTGQSQGQYSKITFRTPLYLGGA--PSAYWLVRATGTNRGFQGCVQSLSVNG-----------------KKIDMRP-WPLGKALNGADVGE------------------CSSGICDEASCIHGGTCAAIKADSYICLCPLGFRGRHCEDAFALTIPQFRESLRSYAATPWPLEPQHYLSFTEFEITFRPDSGDGVLLYSYDTGSKD--FLSINMAAGHVEFRFDCGSGTGVLRSEAPLTLGQWHDLRVSRTAKNGILQVDK--QKVVEGMAEGGFTQIKC------------NTDIFIGGVP-NYDDVKKNSGILHP-FSGSIQKIILNDRTIHVKHDFTSGVNVENAAHPCVG---APCA----HGGSCRPRKEGYECDCPLGFEGLNCQKECGNHCLNTIIEAIEIPQFIGRSYLTYDNPNILKRVSGSRSNAFMRFKTTAKDGLLLWRGDSPMRPNSDFISLGLRDGALIFSYNLG--SGVASIMVNGSFSDGRWHRVKAVRDGQSGKITVDDYGARTGK-SPGLMRQLNINGALYVGGMKEIALHTNRQYLRGLVGCISHFTLSTDYHISLVEDA 1005          

HSP 2 Score: 82.4185 bits (202), Expect = 3.718e-15
Identity = 98/405 (24.20%), Postives = 162/405 (40.00%), Query Frame = 1
Query: 2605 CKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLK-----DSFAKSYWSGNAENYLSIN---ISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCE-EVVSH----------IWKFKDNSFVIFPSESLQLR---QRLKLEITFLPLANNGLLSFISDGHDR-NPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILK 3750
            C  +    Y  +CP+G+      C+         DA  L   +      S+A + W    ++YLS     I+  P S DG++ Y  DT  S D+L+I +   +VE+R D GSG   L+S   LT+G+ H + V R  ++  L +D      GM     T +       IG    P  + +     +   F G +  +           ++N +T  +             DF + V+V            EN     +     PC +GG C+   +E Y C C  G++G+ C+ E  +H          I +F   S++ + + ++  R    R    + F   A +GLL +  D   R N  FIS+ L    L  +     GV  ++   S   G+W+ V  ++
Sbjct:  580 CAAIKADSYICLCPLGFR--GRHCE---------DAFALTIPQFRESLRSYAATPWPLEPQHYLSFTEFEITFRPDSGDGVLLYSYDTG-SKDFLSINMAAGHVEFRFDCGSGTGVLRSEAPLTLGQWHDLRVSRTAKNGILQVDKQKVVEGMAEGGFTQIKCNTDIFIGGV--PNYDDVKKNSGILHPFSGSIQKI-----------ILNDRTIHVKH-----------DFTSGVNV------------ENAA---HPCVGAPCAHGGSCR-PRKEGYECDCPLGFEGLNCQKECGNHCLNTIIEAIEIPQFIGRSYLTYDNPNILKRVSGSRSNAFMRFKTTAKDGLLLWRGDSPMRPNSDFISLGLRDGALIFSYNLGSGVASIMVNGSFSDGRWHRVKAVR 932          
BLAST of Agrin, putative vs. UniProt/SwissProt
Match: sp|P25304|AGRIN_RAT (Agrin OS=Rattus norvegicus OX=10116 GN=Agrn PE=1 SV=2)

HSP 1 Score: 317.775 bits (813), Expect = 2.364e-86
Identity = 232/779 (29.78%), Postives = 357/779 (45.83%), Query Frame = 1
Query:  538 DPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKN----IQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCEN--NPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK------LQFIKPDEERCPEDCPLGKMCR-----------NGQCVCTDKCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRVA-------PSVI---------------GCISHNYIADEKN-----KRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFT------ENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSI 2691
            D C  + C FGA C+    +P  A C C    C A      VCGSD   Y + C ++R +C  Q+ I++     CG ++             C + +C   +TCV +       C CP     +    +CG+D + Y + C++   +C +   I +++ G CD C+    + N IC +         +  +P+ L           P+CG D VTY+++C +      + + L  +  G+CQT+   D C    C + + C+        CSCD + C  ++R PVC  DG  Y+N C+  +  C +Q  +   +   C+   +PC GV+C   +       NGK+ CEC +  C  I  PVCG+D VTY S+C L   AC   + + +   G C+   +C+  G  C        ++   +C CP+ C +S   + VCG+DG TY SEC + +HAC T+ I+L +A+ G C  C  K C+F ++C        QC+CP        PVCGSD  TY + C L+  +C +   I     GPC+            +++ C ++     +CR           +G CVC   C  V +  VCG+DG  Y  EC+LK+  C   + + VA       P++                GC   N+ A +         +C CN  GS +  CDP+T QC C+ G+ G  CDRC  G+WNF        +GCT CSC+  G+    C   TG C+C+P   G  C  CP G  + + GC+ + +
Sbjct:   65 DVCRGMLCGFGAVCEPSVEDPGRASCVCKKNACPA--TVAPVCGSDASTYSNECELQRAQCNQQRRIRLLRQGPCGSRDP------------CANVTCSFGSTCVPSADGQTASCLCPTTCFGAPDGTVCGSDGVDYPSECQLLSHACASQEHIFKKFNGPCDPCQGSMSDLNHICRVNP-------RTRHPEMLLRPENCPAQHTPICGDDGVTYENDCVMSRIGATRGLLLQKVRSGQCQTR---DQCPET-CQFNSVCLSRRGR-PHCSCDRVTCDGSYR-PVCAQDGHTYNNDCWRQQAECRQQRAIPPKHQGPCDQTPSPCHGVQCA--FGAVCTVKNGKAECEC-QRVCSGIYDPVCGSDGVTYGSVCELESMACTLGREIQVARRGPCDPCGQCRF-GSLC--------EVETGRCVCPSECVESA--QPVCGSDGHTYASECELHVHAC-THQISLYVASAGHCQTCGEKVCTFGAVCSAG-----QCVCPRCEHPPPGPVCGSDGVTYLSACELREAACQQQVQIEEAHAGPCEPAECGSGGSGSGEDDECEQE-----LCRQRGGIWDEDSEDGPCVCDFSCQSVPRSPVCGSDGVTYGTECDLKKARCESQQELYVAAQGACRGPTLAPLLPVAFPHCAQTPYGCCQDNFTAAQGVGLAGCPSTCHCNPHGSYSGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGHSGCTPCSCDPRGAVRDDCEQMTGLCSCRPGVAGPKCGQCPDGQVLGHLGCEADPM 791          

HSP 2 Score: 141.354 bits (355), Expect = 4.651e-32
Identity = 161/742 (21.70%), Postives = 294/742 (39.62%), Query Frame = 1
Query: 2650 GYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSV------DVIE--------DPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV----SHIWKFKDNSFVIFPSESLQ-----LRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPI----KKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCG-PLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKY--AAVKQK-----------------RDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK-PV-EGFPWEYNTKFKGCISELYVDEISYNLVLDA 4722
            G++ S    +  S+ E KV    +   K     ++ +  A + L + +      ++G++ Y+ +  R  D+L + L +  V++R D GSG   L S V +  GR H + + R  R   L +DG     G +P     L+      +G      +  +     V  G  GC+  L I      ++ L + Q +  ++SS V     H    N          +E         P +   +  +    K  CQ + PC     C+  S     C+C  G  G  C+ V+    S  +    N F     + L      L +++ LE+ FL    +GLL +     D    F+S+ L+  HLE       G   + S E   +G W  V + +  +   L +   P+ +    K R +P   LN+               +P++ GG     F+  +   ++   F G IQ + +    +  Q   +   +++ +   PC   L +PC       G CVP      C C      L     +   +  +      + G++  +Y  A ++ +                  +K+   N+  +  +T +  G+ +L     + +  ++ +AI +G ++++ +LG +  VLR T    ++ N+W  ++  R +R   L + +    A +  ++      L TDG +WLGG +K PV +  P  Y T F GC+ ++ V     +L+ DA
Sbjct: 1243 GFTCSCTAGRGGSVCE-KVQPPSMPAFKGHSFLAFPTLRAYHTLRLALEFRALETEGLLLYNGNA-RGKDFLALALLDGRVQFRFDTGSGPAVLTSLVPVEPGRWHRLELSRHWRQGTLSVDGETPVVGESPSGTDGLNLDTNLYVGGIPEEQVAMVLDRTSVGVGLKGCIRMLDIN---NQQLELSDWQRA-AVQSSGVGECGDHPCLPNPCHGGALCQALEAGMFLCQCPPGRFGPTCADE---KSPCQPN-PCHGAAPCRVLSSGGAKCECPLGRSGTFCQTVLETAGSRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVFLARGPSGLLLYNGQKTDGKGDFVSLALHNRHLEFCYDLGKGAAVIRSKEPIALGTWVRVFLERNGRKGALQVGDGPRVLGESPKSRKVPHTMLNL--------------KEPLYIGGAP--DFSKLARGAAVSSGFSGVIQLVSLRGHQLLTQEHVLRAVDVSPFADHPCTQALGNPCLN----GGSCVPREATYECLCPGGFSGLHCEKGLVEKSVGDLETL-AFDGRTYIEYLNAVIESELTNEIPAPETLDSRALFSEKALQSNHFELSLRTEATQGL-VLWIGKAAERADYMALAIVDGHLQLSYDLGSQPVVLRST--VKVNTNRWLRIRAHREHREGSLQVGN---EAPVTGSSPLGATQLDTDGALWLGGLQKLPVGQALPKAYGTGFVGCLRDVVVGHRQLHLLEDA 1947          

HSP 3 Score: 134.035 bits (336), Expect = 6.289e-30
Identity = 155/589 (26.32%), Postives = 221/589 (37.52%), Query Frame = 1
Query:  529 QNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVS---PNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTK---------IQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCEN---NPCSGVKCPD----PYQYCRIDNNGK---------STCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGI----------CNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCG--TDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPT-DCVYVRRP-VCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK 2136
            Q   PC  + C FGA C    G    A C C    C        VCGSDG+ Y S C ++   C L + IQV+   P   CG+               C+      + +        C CP++ C  S+  +CG+D  TY + CE+   +C     +     G C  C    C F  +C   +      C CP     C      PVCGSD VTY S C L+  +C++++ +   + G C+            + D C    C          +    C CD+  C++  R PVCG+DG+ Y  +C L K  CE Q E++V     C      P   V  P     PY  C+ +             STC C              N   +Y   C+     C  +           +P +  + GI          C+ +PR   +  DC        + +   C C    + G+    CG   DG+      H+    CE + +        T   C    C F + C + +    QCICPT  C       VCGSD  TY NEC LK  +C +   I+  S GPC+
Sbjct:  358 QTPSPCHGVQCAFGAVCTVKNGK---AECECQRV-CSGIYD--PVCGSDGVTYGSVCELESMACTLGREIQVARRGPCDPCGQ---------------CR------FGSLCEVETGRCVCPSE-CVESAQPVCGSDGHTYASECELHVHACTHQISLYVASAGHCQTCGEKVCTFGAVCSAGQ------CVCPR----CEHPPPGPVCGSDGVTYLSACELREAACQQQVQIEEAHAGPCEPAECGSGGSGSGEDDECEQELCRQRGGIWDEDSEDGPCVCDF-SCQSVPRSPVCGSDGVTYGTECDLKKARCESQQELYVAAQGACRGPTLAPLLPVAFPHCAQTPYGCCQDNFTAAQGVGLAGCPSTCHC--------------NPHGSYSGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGHSGCTPCSCDPRGAVR-DDC--------EQMTGLCSC----RPGVAGPKCGQCPDGQVLG---HL---GCEADPM--------TPVTCVEIHCEFGASC-VEKAGFAQCICPTLTCPEANSTKVCGSDGVTYGNECQLKAIACRQRLDISTQSLGPCQ 865          

HSP 4 Score: 68.9366 bits (167), Expect = 4.156e-10
Identity = 88/425 (20.71%), Postives = 158/425 (37.18%), Query Frame = 1
Query: 2593 GKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSY--------WSGNAENYLSINISLVPYSSDGIIFYHSD-TDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFL----TNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVS-------HIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKR 3807
            G   C+ L+ G     CP+G S    G    ++ E    A    FL D    SY        +  +    +++ +  +     G++ Y+   TD   D++++ L NR++E+  DLG GA  ++S+  + +G    + +ER  R   L +       G +P       T L+      IG A  P  + L+    V+ GF G +  + +   +     L+ Q+   ++ + +V P   H   +                              PCLNGG C    E  Y C C  G+ G+ CE+ +            F   +++ +      L   ++ E+T    A   L        D    F    L  NH E++ RT      L+        + +++ +     ++ L+ +   QP+  R
Sbjct: 1490 GAAPCRVLSSGGAKCECPLGRS----GTFCQTVLET---AGSRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVFLARGPSGLLLYNGQKTDGKGDFVSLALHNRHLEFCYDLGKGAAVIRSKEPIALGTWVRVFLERNGRKGALQVGDGPRVLGESPKSRKVPHTMLNLKEPLYIGGA--PDFSKLARGAAVSSGFSGVIQLVSLRGHQ-----LLTQE--HVLRAVDVSPFADHPCTQ--------------------------ALGNPCLNGGSC-VPREATYECLCPGGFSGLHCEKGLVEKSVGDLETLAFDGRTYIEY------LNAVIESELTNEIPAPETL--------DSRALFSEKALQSNHFELSLRTE-ATQGLVLWIGKAAERADYMALAIVDGHLQLSYDLGSQPVVLR 1856          

HSP 5 Score: 65.0846 bits (157), Expect = 5.950e-9
Identity = 86/432 (19.91%), Postives = 162/432 (37.50%), Query Frame = 1
Query: 3367 KPCLNGGLCQ-TSSEEMYSCQCLPGYQGITCEEV-VSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIR---FQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSP--------KHENLCIRNSMQHDNP-----------------------------ANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDD 4536
            +PCL+GG CQ   S + ++C C  G  G  CE+V    +  FK +SF+ FP  +L+    L+L + F  L   GLL +  +G+ R   F+++ L    ++    T  G   L S+     G+W+ + + +  +   L+++     + +       LN+++               ++ GG+         +  S+     G I+ + IN++ +    +Q + +  + + +    PC  L +PC      +     E    +C C P          ++ C  N      P                              +  F   + G S  +   +         K  + + F      G+L+   +    K  F+ +A+ N  +E   +LG    V+R    + I+   W  V + RN R   L + D
Sbjct: 1227 QPCLHGGTCQDQDSGKGFTCSCTAGRGGSVCEKVQPPSMPAFKGHSFLAFP--TLRAYHTLRLALEFRALETEGLLLY--NGNARGKDFLALALLDGRVQFRFDTGSGPAVLTSLVPVEPGRWHRLELSRHWRQGTLSVDGETPVVGESPSGTDGLNLDTN--------------LYVGGIPEEQVAMVLDRTSVGVGLKGCIRMLDINNQQLELSDWQRAAVQSSGVGECGDHPC--LPNPCHGGALCQAL---EAGMFLCQCPPGRFGPTCADEKSPCQPNPCHGAAPCRVLSSGGAKCECPLGRSGTFCQTVLETAGSRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVFLARGPSGLLLYNGQKTDGKGDFVSLALHNRHLEFCYDLGKGAAVIR--SKEPIALGTWVRVFLERNGRKGALQVGD 1633          

HSP 6 Score: 59.6918 bits (143), Expect = 2.936e-7
Identity = 63/285 (22.11%), Postives = 110/285 (38.60%), Query Frame = 1
Query:  661 VCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHIC-GRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEI-------TYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIES--CKKKISLTVMYKGKCQTKIQSDI-CSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENN 1482
            VCGSDG+ Y + C +K+  C  Q+ + V+    C G   A    ++              +  C   PY  C+  ++   +    + G           +Y+  C+     C     +      RCD C+     F GI      G  T C C +P      + +        +T    C   +    C +     V+    C+    + + C  I C +GA C++ +   AQC C  L C       VCG+DG+ Y N+C L  ++C +++++   +   C+ +
Sbjct:  612 VCGSDGVTYGTECDLKKARCESQQELYVAAQGACRGPTLAPLLPVA--------------FPHCAQTPYGCCQ--DNFTAAQGVGLAGCPSTCHCNPHGSYSGTCDPATGQCSCRPGVGGL---RCDRCEPGFWNFRGIVTDGHSGC-TPCSC-DPRGAVRDDCE-------QMTGLCSCRPGVAGPKCGQCPDGQVLGHLGCEADPMTPVTCVEIHCEFGASCVEKAG-FAQCICPTLTCPEANSTKVCGSDGVTYGNECQLKAIACRQRLDISTQSLGPCQES 867          
BLAST of Agrin, putative vs. UniProt/SwissProt
Match: sp|O00468|AGRIN_HUMAN (Agrin OS=Homo sapiens OX=9606 GN=AGRN PE=1 SV=6)

HSP 1 Score: 315.079 bits (806), Expect = 1.673e-85
Identity = 256/907 (28.22%), Postives = 391/907 (43.11%), Query Frame = 1
Query:  205 DLIIVGRVLNLANSEVI-------VSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDFIM-------YLKKTEQNNFF--------ELNYAKEFGNGLFEKRISVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNI----QVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCEN--NPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPED--CPLGKMCR-----------NGQCVCTDKCSKVKLR-VCGTDGNYYENECELKRKACIDNKTIRVA-------------PSVI---------GCISHNYIADEKN-----KRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF------TENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENS 2688
            ++++ G V  + N + +       V V R LKG DL+     +   N    +++      + C   + +G+  I        YL    +N            L   +E    + +K  + F    T       D C  + C FGA C+     P  A C C  + C +      VCGSD   Y + C ++R +C  Q+ I++     CG ++             C + +C   +TC  +       C CP     +    +CG+D   Y   C++ + +C     + +++ G CD C+    + +  C +         +   P+ L         Q PVCG D VTY+++C +      + + L  +  G+CQ +   D C    C + A C+       +CSCD + C   +R PVC  DG  YD+ C+  +  C +Q  +   +   C+   +PC GV+C   +       NG++ CEC  + C  +  PVCG+D VTY S C L  TAC   + + +   G C+   RC +    C    +C+++    +C CP+ C    L + VCG+DG TY SEC + +HAC T+ I+L +A+ G C+ C +  C+F ++C        QC+CP        PVCGSD  TY + C L+  +C +   I     GPC+            ED  C   ++CR           +G CVC   C  V    VCG+DG  Y  ECELK+  C   + + VA             P V          GC   N  A           +C CN  GS    CDP+T QC C+ G+ G  CDRC  G+WNF        +GCT CSC+  G+    C   TG C+CKP   G  C  CP G ++   GC+ ++
Sbjct:   44 NVVLTGTVEEILNVDPVQHTYSCKVRVWRYLKGKDLVARESLLDGGNK---VVISGFGDPLICDNQVSTGDTRIFFVNPAPPYLWPAHKNELMLNSSLMRITLRNLEEVEFCVEDKPGTHF----TPVPPTPPDACRGMLCGFGAVCEPNAEGPGRASCVCKKSPCPS--VVAPVCGSDASTYSNECELQRAQCSQQRRIRLLSRGPCGSRDP------------CSNVTCSFGSTCARSADGLTASCLCPATCRGAPEGTVCGSDGADYPGECQLLRRACARQENVFKKFDGPCDPCQGALPDPSRSCRVNP-------RTRRPEMLLRPESCPARQAPVCGDDGVTYENDCVMGRSGAARGLLLQKVRSGQCQGR---DQCPE-PCRFNAVCLSRRGR-PRCSCDRVTCDGAYR-PVCAQDGRTYDSDCWRQQAECRQQRAIPSKHQGPCDQAPSPCLGVQCA--FGATCAVKNGQAACEC-LQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCD---RCGQ----CRFGALCEAE--TGRCVCPSEC--VALAQPVCGSDGHTYPSECMLHVHAC-THQISLHVASAGPCETCGDAVCAFGAVCSAG-----QCVCPRCEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQ-ELCRQRGGIWDEDSEDGPCVCDFSCQSVPGSPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTPYGCCQDNITAARGVGLAGCPSACQCNPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPDGRALGPAGCEADA 895          

HSP 2 Score: 160.229 bits (404), Expect = 7.940e-38
Identity = 179/652 (27.45%), Postives = 255/652 (39.11%), Query Frame = 1
Query:  493 SVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATC-VTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDP------YQYCRI--------DNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEE------PRCKEQGKDCPSYQICKSDLVQAK----CECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRF------LEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPE-DCPLGKMC----RNGQCVCTD-KCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRV 2334
             + L    S Q Q  D C +  C+F A C    G P    C C    C    +   VC  DG  YDS C  ++ EC  Q++I            ++  G        C    C   ATC V N    C+C    C S    +CG+D +TY + CE++  +C   R I+    G CD C   +C F  +CE  E G    C CP+    C    Q PVCGSD  TY SEC L + +C  +ISL V   G C+T      C +  C +GA C     +  QC C    C++    PVCG+DG+ Y + C L + +C +Q ++    +  CE   C               + CR           +G   C+   +  P    PVCG+D VTY + C L +  C +++ L++   G C         P         P Y  C+ ++  A+      CP+  Q       C   G +Y   C      C   S    +  +  CD+C+    +F  I    R        +PQ     DC  +   +C         +C      C + R +     GP   +        C E  C  G  C     +  CVC    C +    +VCG+DG  Y NEC+LK  AC     I +
Sbjct:  378 GLLLQKVRSGQCQGRDQCPE-PCRFNAVCLSRRGRP---RCSCDRVTCDGAYR--PVCAQDGRTYDSDCWRQQAECRQQRAI-----------PSKHQGPCDQAPSPCLGVQCAFGATCAVKNGQAACEC-LQACSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCG--QCRFGALCEA-ETGR---CVCPS---ECVALAQ-PVCGSDGHTYPSECMLHVHACTHQISLHVASAGPCET------CGDAVCAFGAVC-----SAGQCVCPR--CEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDFSCQSVPG--SPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTP-YGCCQDNITAARGVGLAGCPSACQ-------CNPHG-SYGGTCDPATGQC---SCRPGVGGL-RCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQMTG-LCSCKPGVAGPKC----GQCPDGRAL-----GPAGCEADASAPATCAEMRCEFGARCVEESGSAHCVCPMLTCPEANATKVCGSDGVTYGNECQLKTIACRQGLQISI 963          

HSP 3 Score: 127.102 bits (318), Expect = 1.027e-27
Identity = 168/755 (22.25%), Postives = 282/755 (37.35%), Query Frame = 1
Query: 2593 GKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLS---------SLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV----SHIWKFKDNSFVIFPSESLQ-----LRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPI----KKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQS-PCSKTDPEKGFCVPEMNETICTC----SPKH--ENLCIRNSMQHDNPA-NTNFFRKYLGKSASKYAA----VKQKRD-------KSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK-PV-EGFPWEYNTKFKGCISELYVDEISYNLVLDA 4722
            G C    L  G  CS CP G        +  ++ E  + A    F   SF  ++ +  A + L + +        G++ Y+ +  R  D+L + L +  V+ R D GSG   L S V +  G+ H + + R  R   L +DG     G +P     L+      +G               V  G  GC+           L I  G  T+   + +        +      P  + +      + P         + K    CQ + PC     C+   E    C+C  G +G  C+       S  +    N F       L      L +++ LE+ FL    +GLL +     D    F+S+ L    LE       G   + S E   +G W  V + +  +   L +   P+ +    K R +P   LN+               +P++ GG     F+  +   ++   F GAIQ + +    +      +   ++T + G PC      PC         CVP     +C C    S  H  + L  +++   D  A +   F +YL        A    V +  D       K+   N+  +  +T +  G+ +L     + +  ++ +AI +G ++++ NLG +  VLR T    ++ N+W  V   R  R   L + +    A +  ++      L TDG +WLGG  + PV    P  Y T F GC+ ++ V     +L+ DA
Sbjct: 1342 GTCQDWALGGGFTCS-CPAG--------RGGAVCEKVLGAPVPAFEGRSFL-AFPTLRAYHTLRLALEFRALEPQGLLLYNGNA-RGKDFLALALLDGRVQLRFDTGSGPAVLTSAVPVEPGQWHRLELSRHWRRGTLSVDGETPVLGESPSGTDGLNLDTDLFVGGVPEDQAAVALERTFVGAGLRGCIRLLDVNNQRLELGIGPGAATRGSGVGECGDHPCLPNPCHGGAPCQNLEAGRFHCQCPPGRVGPTCADEK--SPCQPN-PCHGAAPCRVLPEGGAQCECPLGREGTFCQTASGQDGSGPFLADFNGFSHLELRGLHTFARDLGEKMALEVVFLARGPSGLLLYNGQKTDGKGDFVSLALRDRRLEFRYDLGKGAAVIRSREPVTLGAWTRVSLERNGRKGALRVGDGPRVLGESPKSRKVPHTVLNL--------------KEPLYVGGAP--DFSKLARAAAVSSGFDGAIQLVSLGGRQLLTPEHVLRQVDVTSFAGHPCTRASGHPCLN----GASCVPREAAYVCLCPGGFSGPHCEKGLVEKSAGDVDTLAFDGRTFVEYLNAVTESELANEIPVPETLDSGALHSEKALQSNHFELSLRTEATQGL-VLWSGKATERADYVALAIVDGHLQLSYNLGSQPVVLRST--VPVNTNRWLRVVAHREQREGSLQVGN---EAPVTGSSPLGATQLDTDGALWLGGLPELPVGPALPKAYGTGFVGCLRDVVVGRHPLHLLEDA 2056          

HSP 4 Score: 125.946 bits (315), Expect = 1.885e-27
Identity = 147/576 (25.52%), Postives = 211/576 (36.63%), Query Frame = 1
Query:  529 QNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTK---------IQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENN------PCSGVKCPD-PYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGICNEEPR------CKEQGK---DCPSYQ---ICKSDLVQAKC-ECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK 2136
            Q   PC  + C FGA C    G    A C C             VCGSDG+ Y S C ++   C L + IQV+    C R    + G        C+ ++              C CP++ C + +  +CG+D  TY + C +   +C     +     G C+ C    C F  +C   +      C CP     C      PVCGSD VTY S C L+  +C ++  +     G C+            +   C    C          +    C CD+  C++    PVCG+DG+ Y  +C L K  CE Q  ++V     C         P + + C   PY  C+  +N  +        CP   Q  C N   +Y   C+     C  +           +P +  + GI  +         C  QG    DC        CK  +   KC +CP      LG + C  D     +   MR   CE  +            +C  +  S + +C       P   CP         VCGSD  TY NEC LK  +C +   I+  S GPC+
Sbjct:  463 QAPSPCLGVQCAFGATCAVKNGQ---AACECLQA---CSSLYDPVCGSDGVTYGSACELEATACTLGREIQVARKGPCDRCGQCRFGA------LCEAETG------------RCVCPSE-CVALAQPVCGSDGHTYPSECMLHVHACTHQISLHVASAGPCETCGDAVCAFGAVCSAGQ------CVCPR----CEHPPPGPVCGSDGVTYGSACELREAACLQQTQIEEARAGPCEQAECGSGGSGSGEDGDCEQELCRQRGGIWDEDSEDGPCVCDF-SCQSVPGSPVCGSDGVTYSTECELKKARCESQRGLYVAAQGACRGPTFAPLPPVAPLHCAQTPYGCCQ--DNITAARGVGLAGCPSACQ--C-NPHGSYGGTCDPATGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGRSGCTPCSCDPQGAVRDDCEQMTGLCSCKPGVAGPKCGQCPD--GRALGPAGCEADASAPATCAEMR---CEFGA------------RCVEESGSAHCVC-------PMLTCPEANATK---VCGSDGVTYGNECQLKTIACRQGLQISIQSLGPCQ 970          
BLAST of Agrin, putative vs. UniProt/SwissProt
Match: sp|A2ASQ1|AGRIN_MOUSE (Agrin OS=Mus musculus OX=10090 GN=Agrn PE=1 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 2.263e-84
Identity = 234/780 (30.00%), Postives = 350/780 (44.87%), Query Frame = 1
Query:  514 TSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKN----IQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCEN--NPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGK-MCR-----------NGQCVCTDKCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRVA-------PSVI---------------GCISHNYIADEKN-----KRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFT------ENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKEN 2685
            T+      D C  + C FGA C+    +P  A C C    C A      VCGSD   Y + C ++R +C  Q+ I++     CG ++             C + +C   +TCV +       C CP     +    +CG+D + Y + C++ + +C     I +++ G CD C+    + N IC +         +  +P+ L           P+CG D VTY+++C +      + + L  +  G+CQT+   D C    C + + C+        CSCD + C   +R PVC  DG  YDN C+  +  C +Q  +   +   C+   +PC G +C   +       NGK+ CEC +  C     PVCG+D VTY S+C L   AC   + + +   G C+   RC +    C    +C+ +    +C CP+ C +S   + VCG+DG TY SEC + +HAC T+ I+L +A+ G C  C    C+F ++C        QC+CP        PVCGSD  TY + C L+  +C +   I     GPC+            ED    + +CR           +G CVC   C  V K  VCG+DG  Y  EC LK+  C   + + VA       P++                GC   N  A +         +C CN  GS +  CDP T QC C+ G+ G  CDRC  G+WNF        +GCT CSC+  G+    C   TG C+C+P   G  C  CP G ++ + GC+ +
Sbjct:   57 TAAPSMPPDVCRGMLCGFGAVCEPSVEDPGRASCVCKKNVCPA--MVAPVCGSDASTYSNECELQRAQCNQQRRIRLLRQGPCGSRDP------------CANVTCSFGSTCVPSADGQTASCLCPTTCFGAPDGTVCGSDGVDYPSECQLLRHACANQEHIFKKFDGPCDPCQGSMSDLNHICRVNP-------RTRHPEMLLRPENCPAQHTPICGDDGVTYENDCVMSRIGAARGLLLQKVRSGQCQTR---DQCPET-CQFNSVCLSRRGR-PHCSCDRVTCDGAYR-PVCAQDGHTYDNDCWRQQAECRQQQTIPPKHQGPCDQTPSPCRGAQCA--FGATCTVKNGKAVCEC-QRVCSGGYDPVCGSDGVTYGSVCELESMACTLGREIRVARRGPCD---RCGQ----CRFGSLCEVE--TGRCVCPSECVESA--QPVCGSDGHTYASECELHVHAC-THQISLYVASAGHCQTCGETVCTFGAVCSAG-----QCVCPRCEHPPPGPVCGSDGVTYLSACELREAACQQQVQIEEARAGPCEPAECGSGGSGSGEDNACEQELCRQHGGVWDEDSEDGPCVCDFSCQSVLKSPVCGSDGVTYSTECHLKKARCEARQELYVAAQGACRGPTLAPLLPMASPHCAQTPYGCCQDNVTAAQGVGLAGCPSTCHCNPHGSYSGTCDPVTGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGHSGCTPCSCDPRGAVRDDCEQMTGLCSCRPGVAGPKCGQCPDGQALGHLGCEAD 789          

HSP 2 Score: 147.902 bits (372), Expect = 4.022e-34
Identity = 166/741 (22.40%), Postives = 296/741 (39.95%), Query Frame = 1
Query: 2650 GYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNV--------KPNCPHID-----FKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV----SHIWKFKDNSFVIFPSESLQ-----LRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPI----KKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCG-PLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYA-AVKQKR------------------DKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK-PV-EGFPWEYNTKFKGCISELYVDEISYNLVLDA 4722
            G+S S    +  ++ E KV    +   K     ++ +  A + L + +      ++G++ Y+ +  R  D+L + L + +V++R D GSG   L S V +  GR H + + R  R   L +DG     G +P     L+      +G      + T+     V  G  GC+  L I      ++ L + Q + +++SS V         PN  H        +  V + + P         + K  + CQ + PC     C   S     C C  G  G  CE V+    S  +    N F     + L      L +++ LE+ FL    +GLL +     D    F+S+ L+  HLE       G   + S E   +G W  V + +  +   L +   P+ +    K R +P   LN+               +P++ GG     F+  +   ++   F GAIQ + +    +  Q   +   ++  + G PC   + +PC       G C+P      C C      L     +   +  +      + G++  +Y  AV +                    +K+   N+  +  +T +  G+ +L       +  ++ +AI +G ++++ +LG +  VLR T    ++ N+W  V+  R +R   L + +    A +  ++      L TDG +WLGG +K PV +  P  Y T F GC+ ++ V     +L+ DA
Sbjct: 1234 GFSCSCTAGRAGTVCE-KVQLPSVPAFKGHSFLAFPTLRAYHTLRLALEFRALETEGLLLYNGNA-RGKDFLALALLDGHVQFRFDTGSGPAVLTSLVPVEPGRWHRLELSRHWRQGTLSVDGEAPVVGESPSGTDGLNLDTKLYVGGLPEEQVATVLDRTSVGIGLKGCIRMLDIN---NQQLELSDWQRA-VVQSSGVGECGDHPCSPNPCHGGALCQALEAGVFLCQCPPGRFGPTCADEK--NPCQPN-PCHGSAPCHVLSRGGAKCACPLGRSGSFCETVLENAGSRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVFLARGPSGLLLYNGQKTDGKGDFVSLALHNRHLEFRYDLGKGAAIIRSKEPIALGTWVRVFLERNGRKGALQVGDGPRVLGESPKSRKVPHTMLNL--------------KEPLYVGGAP--DFSKLARGAAVASGFDGAIQLVSLRGHQLLTQEHVLRAVDVAPFAGHPCTQAVDNPCLN----GGSCIPREATYECLCPGGFSGLHCEKGIVEKSVGDLETL-AFDGRTYIEYLNAVTESELTNEIPAPETLDSRALFSEKALQSNHFELSLRTEATQGL-VLWIGKVGERADYMALAIVDGHLQLSYDLGSQPVVLRST--VKVNTNRWLRVRAHREHREGSLQVGN---EAPVTGSSPLGATQLDTDGALWLGGLQKLPVGQALPKAYGTGFVGCLRDVVVGHRQLHLLEDA 1938          

HSP 3 Score: 138.658 bits (348), Expect = 3.027e-31
Identity = 150/586 (25.60%), Postives = 217/586 (37.03%), Query Frame = 1
Query:  529 QNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTK---------IQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENN------PCSGVKCPD-PYQYCRIDNNGK---------STCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGI----------CNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCG--TDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPT-DCVYVRRP-VCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK 2136
            Q   PC    C FGA C    G    AVC C    C  G     VCGSDG+ Y S C ++   C L + I+V+    C R    + G        C+ ++              C CP++ C  S+  +CG+D  TY + CE+   +C     +     G C  C    C F  +C   +      C CP     C      PVCGSD VTY S C L+  +C++++ +     G C+            + + C    C          +    C CD+  C++  + PVCG+DG+ Y  +C L K  CE + E++V     C         P +   C   PY  C+ +             STC C              N   +Y   C+     C  +           +P +  + GI          C+ +PR   +  DC        + +   C C    + G+    CG   DG+      H+   A  T  +            C    C F + C        QC+CPT  C       VCGSD  TY NEC LK  +C +   I+  S GPC+
Sbjct:  358 QTPSPCRGAQCAFGATCTVKNGK---AVCECQRV-CSGGYD--PVCGSDGVTYGSVCELESMACTLGREIRVARRGPCDRCGQCRFG------SLCEVET------------GRCVCPSE-CVESAQPVCGSDGHTYASECELHVHACTHQISLYVASAGHCQTCGETVCTFGAVCSAGQ------CVCPR----CEHPPPGPVCGSDGVTYLSACELREAACQQQVQIEEARAGPCEPAECGSGGSGSGEDNACEQELCRQHGGVWDEDSEDGPCVCDF-SCQSVLKSPVCGSDGVTYSTECHLKKARCEARQELYVAAQGACRGPTLAPLLPMASPHCAQTPYGCCQDNVTAAQGVGLAGCPSTCHC--------------NPHGSYSGTCDPVTGQCSCRPGVGGLRCDRCEPGFWNFRGIVTDGHSGCTPCSCDPRGAVR-DDC--------EQMTGLCSC----RPGVAGPKCGQCPDGQALG---HLGCEADPTTPVT-----------CVEMHCEFGASCVEEAGFA-QCVCPTLTCPEANSTKVCGSDGVTYGNECQLKTIACRQRLDISIQSLGPCR 865          

HSP 4 Score: 75.8702 bits (185), Expect = 3.136e-12
Identity = 92/426 (21.60%), Postives = 163/426 (38.26%), Query Frame = 1
Query: 2593 GKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSY--------WSGNAENYLSINISLVPYSSDGIIFYHSD-TDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFL----TNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVS-------HIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIG-KWNHVVILKAAKYIYLNLNHSPQPIKKR 3807
            G   C  L+ G     CP+G S    G    ++ EN   A    FL D    SY        +  +    +++ +  +     G++ Y+   TD   D++++ L NR++E+R DLG GA  ++S+  + +G    + +ER  R   L +       G +P       T L+      +G A  P  + L+    V  GF G +  + +   +     L+ Q+   ++ + +V P   H     +VD                          PCLNGG C    E  Y C C  G+ G+ CE+ +            F   +++ +      L    + E+T    A   L        D    F    L  NH E++ RT    T+ + +    +G + +++ +     ++ L+ +   QP+  R
Sbjct: 1481 GSAPCHVLSRGGAKCACPLGRS----GSFCETVLEN---AGSRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVFLARGPSGLLLYNGQKTDGKGDFVSLALHNRHLEFRYDLGKGAAIIRSKEPIALGTWVRVFLERNGRKGALQVGDGPRVLGESPKSRKVPHTMLNLKEPLYVGGA--PDFSKLARGAAVASGFDGAIQLVSLRGHQ-----LLTQE--HVLRAVDVAPFAGH-PCTQAVD-------------------------NPCLNGGSC-IPREATYECLCPGGFSGLHCEKGIVEKSVGDLETLAFDGRTYIEY------LNAVTESELTNEIPAPETL--------DSRALFSEKALQSNHFELSLRTE--ATQGLVLWIGKVGERADYMALAIVDGHLQLSYDLGSQPVVLR 1847          

HSP 5 Score: 73.559 bits (179), Expect = 1.649e-11
Identity = 88/432 (20.37%), Postives = 167/432 (38.66%), Query Frame = 1
Query: 3367 KPCLNGGLCQ-TSSEEMYSCQCLPGYQGITCEEV-VSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIR---FQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPK-------------HENLCIRNSMQH------------------------DNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDD 4536
            +PCL+GG CQ   S + +SC C  G  G  CE+V +  +  FK +SF+ FP  +L+    L+L + F  L   GLL +  +G+ R   F+++ L   H++    T  G   L S+     G+W+ + + +  +   L+++     + +       LN+++               ++ GG+      +  +  S+     G I+ + IN++ +    +Q + +  + + +    PC P  +PC      +     E    +C C P                N C  ++  H                        +N  +  F   + G S  +   +         K  + + F      G+L+   +    K  F+ +A+ N  +E   +LG    ++R    + I+   W  V + RN R   L + D
Sbjct: 1218 QPCLHGGTCQDLDSGKGFSCSCTAGRAGTVCEKVQLPSVPAFKGHSFLAFP--TLRAYHTLRLALEFRALETEGLLLY--NGNARGKDFLALALLDGHVQFRFDTGSGPAVLTSLVPVEPGRWHRLELSRHWRQGTLSVDGEAPVVGESPSGTDGLNLDTK--------------LYVGGLPEEQVATVLDRTSVGIGLKGCIRMLDINNQQLELSDWQRAVVQSSGVGECGDHPCSP--NPCHGGALCQAL---EAGVFLCQCPPGRFGPTCADEKNPCQPNPCHGSAPCHVLSRGGAKCACPLGRSGSFCETVLENAGSRPFLADFNGFSYLELKGLHTFERDLGEKMALEMVFLARGPSGLLLYNGQKTDGKGDFVSLALHNRHLEFRYDLGKGAAIIR--SKEPIALGTWVRVFLERNGRKGALQVGD 1624          

HSP 6 Score: 59.3066 bits (142), Expect = 3.746e-7
Identity = 65/288 (22.57%), Postives = 110/288 (38.19%), Query Frame = 1
Query:  661 VCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTN-----PYPYCKCPND-KCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIES--CKKKISLTVMYKGKCQTKIQSDI-CSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGV 1497
            VCGSDG+ Y + C +K+  C  ++ + V+    C R       +  ++    Q     PY  C  N           CP+   C+   S         Y+  C+     C     +      RCD C+     F GI      G  T C C +P      + +        +T    C   +    C +      +    C+    + + C  + C +GA C++ +   AQC C  L C       VCG+DG+ Y N+C L  ++C +++++ + +   C  +   GV
Sbjct:  612 VCGSDGVTYSTECHLKKARCEARQELYVAAQGAC-RGPTLAPLLPMASPHCAQT----PYGCCQDNVTAAQGVGLAGCPSTCHCNPHGS---------YSGTCDPVTGQCSCRPGVGGL---RCDRCEPGFWNFRGIVTDGHSGC-TPCSC-DPRGAVRDDCE-------QMTGLCSCRPGVAGPKCGQCPDGQALGHLGCEADPTTPVTCVEMHCEFGASCVEEAG-FAQCVCPTLTCPEANSTKVCGSDGVTYGNECQLKTIACRQRLDISIQSLGPCRESVAPGV 872          
BLAST of Agrin, putative vs. UniProt/SwissProt
Match: sp|P31696|AGRIN_CHICK (Agrin OS=Gallus gallus OX=9031 GN=AGRN PE=1 SV=3)

HSP 1 Score: 299.671 bits (766), Expect = 1.222e-80
Identity = 260/914 (28.45%), Postives = 396/914 (43.33%), Query Frame = 1
Query:  202 SDLIIVGRVLNLANSEVI-------VSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDFIMYLKKTEQ------NNFFELNYA----------------KEFGNGLFEKRISVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEM-----MEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCE---NNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT--CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCR-----------NGQCVCTDKCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRV---------------------APSVIGCISHNY-----IADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF------TENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKEN 2685
            +++++ G V  + N + +       V V R LKG D++     +   N    +++      + C   + +G+  I ++    Q       N   LN +                +E    L +K  S F     + +    D C  + C FGA C++ P +P  A C C  T C        VCGSD   Y + C +++ +C  Q+ I+V     CG K+             C   +C   +TCV +       C CP      + S +CG+D   Y + C++ K +C     + +++ G CD CK +  + N +C +       + L     CP+  E        PVCG D VTY SEC +      + + +  +  G+CQ     D C + +C + A C+K  +  A+CSCD + C  T+R PVC  D   Y N C   K  C ++  + V +S  C+    +PC  V+C   +    +  N +  CEC ++ C     PVCG+D  TY + C L   AC+ K+ + + + G C+   RC +    C    IC+++    +C CPT   P S   + VCGTDG TY SEC + + AC T    + +A  G C  C    CSF S C     +  QC+CP         VCG+D  TY+N C L+  SC + + I     GPC+ +                  CR           + +CVC   C  V +  VCG+D   Y NECELK+  C   + + V                     + ++ GC   N      +       +C CN  GS    CDP+T QC CK G+ G  CDRC  G+WNF      +++GCT C+C+  GS    C   TG C+CK    G  C+ CP G  +   GC+++
Sbjct:   38 ANVVLTGTVEEIMNVDPVHHTYSCKVRVWRYLKGKDIVTHEILLDGGNK---VVIGGFGDPLICDNQVSTGDTRIFFVNPAPQYMWPAHRNELMLNSSLMRITLRNLEEVEHCVEEHRKLLADKPNSYFTQTPPTPR----DACRGMLCGFGAVCERSPTDPSQASCVCKKTACPV--VVAPVCGSDYSTYSNECELEKAQCNQQRRIKVISKGPCGSKDP------------CAEVTCSFGSTCVRSADGQTAGCVCPASCSGVAESIVCGSDGKDYRSECDLNKHACDKQENVFKKFDGACDPCKGILNDMNRVCRVNPRTRRVELLSRPENCPSKRE--------PVCGDDGVTYASECVMGRTGAIRGLEIQKVRSGQCQ---HQDKCKD-ECKFNAVCLKRWH--ARCSCDRITCDGTYR-PVCARDSRTYSNDCERQKAECHQKAAIPVKHSGPCDLGTPSPCLSVEC--TFGATCVVKNREPVCEC-QQVCQGRYDPVCGSDNRTYGNPCELNAMACVLKREIRVKHKGPCD---RCGK----CQFGAICEAET--GRCVCPTECVPSS---QPVCGTDGNTYGSECELHVRAC-TQQKNILVAAQGDCKSCGTTVCSFGSTC-----VGGQCVCPRCEQQPLAQVCGTDGLTYDNRCELRAASCQQQKSIEVAKMGPCEDECGSGGSGSGDGSECEQDRCRHYGGWWDEDAEDDRCVCDFTCLAVPRSPVCGSDDVTYANECELKKTRCEKRQNLYVTSQGACRALTTTPPPLPVVHCSQTIYGCCPDNMTLALGVGAAGCPSTCQCNPYGSYGGTCDPATGQCSCKPGVGGLKCDRCEPGFWNFRGIVTDSKSGCTPCNCDPVGSVRDDCEQMTGLCSCKTGITGMKCNQCPNGSKMGMAGCEKD 894          

HSP 2 Score: 145.976 bits (367), Expect = 1.932e-33
Identity = 167/726 (23.00%), Postives = 295/726 (40.63%), Query Frame = 1
Query: 2725 FLKDSFAKSYWSGNA-ENYLSINISLVPYSSD--GIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNV--------KPNCPHIDFKNSVDVIEDPDKE---EQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVS--HIWKF--KDNSFVIFPSESLQLR----QRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPI----KKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTC----SPKH-ENLCI--------------RNSMQHDNPANTNFFRKYL-GKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK--PVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 4752
            F+     KSY +    + Y ++ I++   +++  G++ Y+   +R  D++++ L   +VE R + GSG   + S+V++  G+ H ++V R  R   L +DG +   G +P     L+      +G A    +  ++     T G  G +  L +      ++Y + ++ S ++  S V         PN  H      V   E    E     +       ++ C    PC     C    E    C C  G +G  CE V    H   F  + N F       LQ      +++ +E+ FL  + +G++ +     D    F+S+ L+  +LE       G   L S E   +  W  V++ ++ +   + +N+  + +    K R +P  FLN+               +P + GG     F+  +   ++  +FYGA+Q+I I    +  +        I+ ++  PC    +PC       G C P +    C C    S  H E + I              R  M++ N    +     +    A  Y A  +  +K+   N+  +  KT +  G+ IL       +  ++ +AI +G +++  +LG K  VLR T    I+ N W  ++  R  R   L + +    A +  ++      L TDG +WLGG ++       P  Y+T F GCI ++ VD    +LV DA  N   IL C
Sbjct: 1389 FIPSFGGKSYLAFKMMKAYHTVRIAMEFRATELSGLLLYNGQ-NRGKDFISLALVGGFVELRFNTGSGTGVITSKVRVEPGKWHQLVVNRNRRSGMLAVDG-EHVSGESPTGTDGLNLDTDLFVGGAPEDQMAVVAERTAATVGLKGSIRLLDVN----NQMYDLREKGSDVLYGSGVGECGNDPCHPNPCHHGASCHVKEAEMFHCECLHSYTGPTCADERNPCDP-TPCHISATCLVLPEGGAMCACPMGREGEFCERVTEQDHTMPFLPEFNGFSYLELNGLQTLFLTCRQMSMEVVFLAKSPSGMIFYNGQKTDGKGDFVSLALHDGYLEYRYDLGKGAAVLRSKEPVPLNTWISVLLERSGRKGVMRINNGERVMGESPKSRKVPHAFLNL--------------KEPFYVGGAP--DFSKLARAAAISTSFYGAVQRISIKGVPLLKEQHIRSAVEISTFRAHPCTQKPNPCQN----GGTCSPRLESYECACQRGFSGAHCEKVIIEKAAGDAEAIAFDGRTYMEYHNAVTKSHLSNEIPAPDALDYPA--EPSEKALQSNHFELSIKTEATQGL-ILWSGKGLERSDYIALAIVDGFVQMMYDLGSKPVVLRST--VPINTNHWTHIKAYRVQREGSLQVGN---EAPITGSSPLGATQLDTDGALWLGGMERLSVAHKLPKAYSTGFIGCIRDVIVDRQELHLVEDALNNP-TILHC 2078          

HSP 3 Score: 124.02 bits (310), Expect = 7.537e-27
Identity = 154/587 (26.24%), Postives = 216/587 (36.80%), Query Frame = 1
Query:  541 PCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKI-------------QSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCEN-----NPCSGVKCPDPYQYCRIDNNG----------KSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGI----------CNEEP------RCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSIC-QMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPC 2133
            PC  + C FGA C      P   VC C    CQ   +   VCGSD   Y + C +    C L++ I+V     C R    Q G        C+ ++              C CP + C  SS  +CGTD  TY + CE+   +C   + I     G C  C    C F   C      +G  C CP     C +     VCG+D +TY + C L+  SC+++ S+ V   G C+ +              + D C     HYG    + +    +C CD+  C    R PVCG+D + Y N+C L K  CEK+  ++V +   C        P   V C      C  DN             STC+C              N   +Y   C+     C  K           +P +  + GI          CN +P       C++    C     CK+ +   KC    CP                     M M  CE +  A K         C+   C F + C ++N F   +C  P         VCGSD  TY ++C LK  +C + +LIT    G C
Sbjct:  469 PCLSVECTFGATCVVKNREP---VCECQQV-CQG--RYDPVCGSDNRTYGNPCELNAMACVLKREIRVKHKGPCDRCGKCQFGA------ICEAET------------GRCVCPTE-CVPSSQPVCGTDGNTYGSECELHVRACTQQKNILVAAQGDCKSCGTTVCSFGSTC------VGGQCVCPR----CEQQPLAQVCGTDGLTYDNRCELRAASCQQQKSIEVAKMGPCEDECGSGGSGSGDGSECEQDRCR----HYGGWWDEDAED-DRCVCDFT-CLAVPRSPVCGSDDVTYANECELKKTRCEKRQNLYVTSQGACRALTTTPPPLPVVHCSQTIYGCCPDNMTLALGVGAAGCPSTCQC--------------NPYGSYGGTCDPATGQCSCKPGVGGLKCDRCEPGFWNFRGIVTDSKSGCTPCNCDPVGSVRDDCEQMTGLCS----CKTGITGMKCN--QCPNGS-----------------KMGMAGCEKDPSAPK--------SCEEMSCEFGATCVEVNGFAHCECPSPLCSEANMTKVCGSDGVTYGDQCQLKTIACRQGQLITVKHVGQC 969          

HSP 4 Score: 105.145 bits (261), Expect = 4.314e-21
Identity = 107/391 (27.37%), Postives = 160/391 (40.92%), Query Frame = 1
Query: 1543 KSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECP-TCPQSGLGES-VCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMN-RFLEPQCIC-PTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCR---NGQCVCTD-KCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSI 2691
            +++C C K  CP +V PVCG+D  TY + C L +  C  ++ + +I  G C  +  C E      S  +  +D   A C CP +C  SG+ ES VCG+DGK Y+SEC +  HAC+      K  + G CD CK        +C++N R    + +  P +C   R PVCG D  TY +EC +          I  V  G C+ Q      ++C ++C    +C    + +C C    C      VC  D   Y N+C                              E+ K  C         H+          K  I  ++   C  G    T + C +  C  FG+  +V N E   C C+ +  G+Y  VC        + C+ N++
Sbjct:  194 QASCVCKKTACPVVVAPVCGSDYSTYSNECELEKAQCNQQRRIKVISKGPCGSKDPCAEVTCSFGSTCVRSADGQTAGCVCPASC--SGVAESIVCGSDGKDYRSECDLNKHACDKQENVFKKFD-GACDPCKGILNDMNRVCRVNPRTRRVELLSRPENCPSKREPVCGDDGVTYASECVMGRTGAIRGLEIQKVRSGQCQHQ------DKCKDECKFNAVCLKRWHARCSCDRITCDGTYRPVCARDSRTYSNDC------------------------------ERQKAEC---------HQ----------KAAIPVKHSGPCDLG----TPSPCLSVECT-FGATCVVKNREP-VCECQQVCQGRYDPVCGSDNRTYGNPCELNAM 520          

HSP 5 Score: 78.5666 bits (192), Expect = 6.093e-13
Identity = 93/432 (21.53%), Postives = 167/432 (38.66%), Query Frame = 1
Query: 2575 VCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVE--LGFLKDSFAKSYWSGNAENYL-------SINISLVPYSSDGIIFYHSD-TDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFI-----FTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFIS------DGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKR 3807
             C  E   C+  P  +   C V P G ++          +  +V   +  + FL +    SY   N    L       S+ +  +  S  G+IFY+   TD   D++++ L + Y+EYR DLG GA  L+S+  + +    S+L+ER  R   + I+  +   G +P     +   F+     F +G A  P  + L+    ++  F G +  + I       + L+ +Q               HI  +++V++               +     Q   PC NGG C +   E Y C C  G+ G  CE+V+  I K   +      +E++    R     T++   N    S +S      D  D         L  NH E++ +T      LI      + + +++ +     ++ +  +   +P+  R
Sbjct: 1599 TCADERNPCDPTPCHISATCLVLPEGGAMCACPMGREGEFCERVTEQDHTMPFLPEFNGFSYLELNGLQTLFLTCRQMSMEVVFLAKSPSGMIFYNGQKTDGKGDFVSLALHDGYLEYRYDLGKGAAVLRSKEPVPLNTWISVLLERSGRKGVMRINNGERVMGESPKS-RKVPHAFLNLKEPFYVGGA--PDFSKLARAAAISTSFYGAVQRISIKG-----VPLLKEQ---------------HI--RSAVEI------------STFRAHPCTQKPNPCQNGGTC-SPRLESYECACQRGFSGAHCEKVI--IEKAAGD------AEAIAFDGR-----TYMEYHNAVTKSHLSNEIPAPDALDYPAEPSEKALQSNHFELSIKTE-ATQGLILWSGKGLERSDYIALAIVDGFVQMMYDLGSKPVVLR 1978          

HSP 6 Score: 70.4774 bits (171), Expect = 1.607e-10
Identity = 91/435 (20.92%), Postives = 175/435 (40.23%), Query Frame = 1
Query: 3355 CQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSH-IWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDE--NIRFQNSDIILNN---------------------------------ITQWQGPPCGPLQSPCSKTD---PEKGFCVPEMNETICTCSPKHEN-LCIRNSMQ-HDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDD 4536
            C +H PCL+GG C+    E ++C+C  G  G  CE+ + + I  F   S++ F  + ++    +++ + F     +GLL +  +G +R   FIS+ L    +E+   T  G   + S      GKW+ +V+ +  +   L ++      +    P G   +N             +  +F GG   +     +   +      G+I+ + +N++  ++R + SD++  +                                 +  + GP C   ++PC  T          +PE    +C C    E   C R + Q H  P    F  ++ G S  +   + Q    +  + ++ + F   S  GM+    +    K  F+ +A+ +G +E   +LG    VLR    + +  N W +V + R+ R  V+ I++
Sbjct: 1351 CDSH-PCLHGGTCEDDGRE-FTCRCPAGKGGAVCEKPIRYFIPSFGGKSYLAF--KMMKAYHTVRIAMEFRATELSGLLLY--NGQNRGKDFISLALVGGFVELRFNTGSGTGVITSKVRVEPGKWHQLVVNRNRRSGMLAVDGEHVSGES---PTGTDGLN------------LDTDLFVGGAPEDQMAVVAERTAATVGLKGSIRLLDVNNQMYDLREKGSDVLYGSGVGECGNDPCHPNPCHHGASCHVKEAEMFHCECLHSYTGPTCADERNPCDPTPCHISATCLVLPE-GGAMCACPMGREGEFCERVTEQDHTMP----FLPEFNGFSYLELNGL-QTLFLTCRQMSMEVVFLAKSPSGMIFYNGQKTDGKGDFVSLALHDGYLEYRYDLGKGAAVLR--SKEPVPLNTWISVLLERSGRKGVMRINN 1756          
BLAST of Agrin, putative vs. UniProt/SwissProt
Match: sp|A3KN33|EGFLA_BOVIN (Pikachurin OS=Bos taurus OX=9913 GN=EGFLAM PE=2 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 4.615e-30
Identity = 146/661 (22.09%), Postives = 270/661 (40.85%), Query Frame = 1
Query: 2764 NAENYLSINISLVPYSSDGIIFYHSDTDRS-SDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVS-HIWKFKDN----SFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXV-IAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISELYVD-EISYNLVLDA 4722
            N+     I +     + DG++ Y  + +    D++++ +  R +++R + G+G   + S  ++ +G  H++ + R   +  L ++      G +    + +       +G A  P    L        GF GC+ +L +                                    +D+   P  +  S  +  +          C+NGG C  S  + Y C C  G++G  CE+  +  I +FK++    +   +P E       ++ E+TF P + +G+L +  D   ++  F+S+ +   H+E       G   L S E   +G W+ + + + AK   L ++      K++        V  +     TQ +  N  IF GGV  N  +   N   LKP F G+IQKI++ND  I  ++      N+     P  G   SPC+      G C P      C C    E L  + ++            +++G+S   Y      +  S +++N  ++FKT + DG+L+          S  + + +R+G +  + NLG  +GV  I  N + +D +WH V+ +R+ ++  + +DD   R           L  +G +++GG K+       +Y     GCIS   +  +   +LV DA
Sbjct:  413 NSYQAFQITLEFRAEAEDGLLLYCGENEHGRGDFMSLAVIRRSLQFRFNCGTGVAIIVSETKIKLGGWHTVTLYRDGLNGLLQLNNGTPVTGQSQGQYSKITFRTPLYLGGA--PSAYWLVRATGTNRGFQGCVQALTVNG--------------------------------KRLDLRPWPLGKALSGADVGECSSGICDEASCINGGTCMASKADSYICLCPLGFRGRHCEDAFTLTIPQFKESLRSYAATPWPLEPRHYLSFMEFEVTFRPDSEDGVLLYSYDTGSKD--FLSINMAGGHVEFRFDCGSGTGVLRSEEPLTLGHWHELCVSRTAKNGILQVD------KQKA-------VEGMAEGGFTQIKC-NSDIFIGGVP-NYDDVKKNSGILKP-FSGSIQKIILNDRTIHVKHDFTWGVNVENAAHPCVG---SPCA----HGGSCRPRKEGYECDCPLGFEGLHCQKAI-----TEAIEIPQFIGRSYLTYDNPDILKRVSGSRSNAFMRFKTTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLG--SGVASIMVNGSFNDGRWHRVKAVRDGQSGKITVDDYGARTGK-SPGMMRQLNINGALYVGGMKEIALHTNRQYMRGLVGCISHFTLSTDYHISLVEDA 1006          

HSP 2 Score: 85.8853 bits (211), Expect = 2.895e-15
Identity = 86/351 (24.50%), Postives = 143/351 (40.74%), Query Frame = 1
Query: 2737 SFAKSYWSGNAENYLSI---NISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVS---HIWKFKDNSFVIFPSESLQLR---QRLKLEITFLPLANNGLLSFISDGHDR-NPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAK 3759
            S+A + W     +YLS     ++  P S DG++ Y  DT  S D+L+I +   +VE+R D GSG   L+S   LT+G  H + V R  ++  L +D   +  GM     T +       IG    P  + +     +   F G +   KI   + T I++ +  T W +   N    C                                    PC +GG C+   +E Y C C  G++G+ C++ ++    I +F   S++ + +  +  R    R    + F   A +GLL +  D   R N  FIS+ L    L  +     GV  ++   S   G+W+ V  ++  +
Sbjct:  627 SYAATPWPLEPRHYLSFMEFEVTFRPDSEDGVLLYSYDTG-SKDFLSINMAGGHVEFRFDCGSGTGVLRSEEPLTLGHWHELCVSRTAKNGILQVDKQKAVEGMAEGGFTQIKCNSDIFIGGV--PNYDDVKKNSGILKPFSGSIQ--KIILNDRT-IHVKHDFT-WGVNVENAAHPC---------------------------------VGSPCAHGGSCR-PRKEGYECDCPLGFEGLHCQKAITEAIEIPQFIGRSYLTYDNPDILKRVSGSRSNAFMRFKTTAKDGLLLWRGDSPMRPNSDFISLGLRDGALVFSYNLGSGVASIMVNGSFNDGRWHRVKAVRDGQ 936          
BLAST of Agrin, putative vs. TrEMBL
Match: A0A4D6G2W8 (Agrin (Fragment) OS=Schmidtea mediterranea OX=79327 GN=agrin PE=2 SV=1)

HSP 1 Score: 627.091 bits (1616), Expect = 0.000e+0
Identity = 305/310 (98.39%), Postives = 309/310 (99.68%), Query Frame = 1
Query: 1177 HLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRL 2106
            HLKIESCKKKISLTVMYKG+CQTKIQSDI SNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICN++PRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHAC+TNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRL
Sbjct:    1 HLKIESCKKKISLTVMYKGRCQTKIQSDIXSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNDKPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACDTNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRL 310          

HSP 2 Score: 105.916 bits (263), Expect = 9.155e-21
Identity = 95/323 (29.41%), Postives = 144/323 (44.58%), Query Frame = 1
Query:  490 ISVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCP-PYATCV--TNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVK-----CEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESC-KKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSC 1431
            ++V   G    ++Q+D   S + C +GA+C K       A C C    C+   ++  VCG+DGI YD+ C + +  C  Q  + V  ++ C                 C    CP PY  C    N    C+CP + C      +CG D++TY +IC + + +C   + +   Y G C+     K     C    IC+   D +   C+CP   +     +   VCG+D  TY+SECH+++ +C    I+L +   G C      D C N +C + + C        QC C   DC    R PVCG+D   Y+N+CFL   SC
Sbjct:   13 LTVMYKGRCQTKIQSDIX-SNIQCHYGAKCIKTSNT--VAQCSCDYLDCKNTWRD-PVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNP-------------CSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNDKPRCKEQGKDCPSYQICK--SDLVQAKCECPTCPQ---SGLGESVCGTDGKTYKSECHMRMHACDTNSIALKIANIGTC------DKCKNKKCSFYSICQMNRFLEPQCICP-TDCVYV-RRPVCGSDDRTYENECFLKVKSC 305          

HSP 3 Score: 105.916 bits (263), Expect = 9.329e-21
Identity = 98/319 (30.72%), Postives = 155/319 (48.59%), Query Frame = 1
Query: 1426 SCEKQMEMHVINSNFCENNPCSGVKCPDPYQY---CRIDNNGKSTCECPKEPCPKIVQ-PVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPS-YQICKSDL-VQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCD---KCK--NKKCSFYSICQMNRFLEPQCICPTDCVY--VRRPVCGSDDRTYENECFLKVKSCAENRLITAVSE-GPCKLQFIKPDEERCP-EDCPLGKMCR-----NGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNK 2322
            SC+K++ + V+    C+    S +       Y   C   +N  + C C    C    + PVCGND + Y++ C L + +C  +  + +I +  C   P     G  CP  YQ C+ D   ++ CECP  P   + + VCG D  TY+S C++   AC T      I N G C+   +CK   K C  Y IC+ +  ++ +C CPT C    +   VCG+D +TY++EC +++ +C  N +   ++  G C         ++C  + C    +C+       QC+C   C  V+  VCG+D   YENEC LK K+C +N+
Sbjct:    6 SCKKKISLTVMYKGRCQTKIQSDIXSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPC---SGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYN-GICNDKPRCKEQGKDCPSYQICKSD-LVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACDTNSIALKIANIGTC---------DKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENR 309          
BLAST of Agrin, putative vs. TrEMBL
Match: A0A4S2KB71 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_011105 PE=4 SV=1)

HSP 1 Score: 591.267 bits (1523), Expect = 1.959e-178
Identity = 436/1482 (29.42%), Postives = 670/1482 (45.21%), Query Frame = 1
Query: 1135 PVCGSDDVTYQSECHLKIESC----------KKKISLTVMYKGKC-------QTKIQSDIC-SNIQCHYGAKC--IKTSNTVAQ--------CSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQIC----------------------KSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVR--RPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKC----SKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGC-----------ISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENG--CTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKS------------------------------YWSGNAENYLSINISLVPYSSDG-IIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAI---FLKSRV--QLTIGRS---------HSILVERLNRDSRLVIDGTDSQYGMNPPFL--------TNLDAGF-IFTIGQATGPIINTL--SHTGDVTDGFVGCLSSLKITAG---EETKIYLMN---QQTSWI-----IESSNVKPNC-PHIDFKNSVDVIEDPDKEEQSEKENLKIKDY------CQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSHIWKFKDNSFVIFP---SESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLN-KNHLEVTCRT---------PIGVTR-----LISMESAL-IGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLN-VNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRF-----QNSDIILN----------NITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHE----------------------------NLCIRNSMQHDNPANTNFFRK-------------------YLGKSASKYAAVKQKRD--------------------KSSTKNNIRIKFKTASNDGMXXX-------------XXXXXXXXXXXXVIAIRNGVIEVAINLGGK------------------NGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 4752
            PVCG+D V YQ+EC L+  SC           + + ++V Y  KC       QT+    +C  N  C+YGAKC  I  +N+           C C +++C N W DPVCG DG  Y N+C+L K  C  Q+   ++    C +NPC    C  P + C ID  G+  C CP + CPK++ PVCG+D  TYES C+L  TAC+  + +W++Y+G C++EP+C+  G  C  Y++C                      K   + A C CPTCP+ GLG+ VCGTDG+TY+SECH+R   C+     +K+ +IG CD C NK+C +Y+ICQ N   EPQCICPTDC YV+  + VCG+D  TYE+EC LKV+SCAE R I  + EGPCK          CP  CPLG  CRNGQCVC D C    S +   VCGTDG  Y +ECELKR+AC+  K I   PS   C           ++    AD      C CN +G+L+  CD    +C CK  + G  CD+C+ GYW   +NG  C ACSC+  GS S  C+  +G+C+C+P  +G+ CS+CP G  ++  GC   ++         L    ++ +KS                                  + E  ++I + +V    DG ++ Y          L   LK+   ++R+ +  G +   +L  R+  +L + ++         H I V   N    L +DG  +      P L        T    G+    IG+   P I       +    DGF GCL  + +  G   +   I L++    + +WI         +  P C  + +F +  +V+ + D+ +  + +   ++        C   +PC NGG+C ++    Y C C PG+QG  CE+VV+ I +F  +SF+  P          ++L++ +TFL     GLL F+       P F+ V ++ K ++ V CRT         P  V R     L+     L + +W+ + I K  + + L ++ + Q  + RL+P      +       L  F + + PI+ GG D    NS +  + ++    GAIQ++ IN  +I        N ++  N          N++QWQGPPCGP  SPC +    +  C P      C CS + +                            N    NS   DN      + +                    +G+    +AA  + R+                    KS T   +R++ +TAS DG++++             L+     ++   +IA+R G +E  I +  +                    +L+I     ++D K HTV V+R+ R   L++D +M   +   +    ++  D ++ +GGA   + G PWEY   F GCI +L+++E   +++  A +  GPI+ C
Sbjct:  220 PVCGTDGVMYQNECLLRKRSCAGGSWSPYSPSRPVMVSVDYTNKCLNQYHARQTRPSYALCDGNNVCNYGAKCPAINPANSWRHVAPAPFNGCDCQHINCLNEWPDPVCGTDGETYSNECYLRKSMCVAQLPKRILYRGNCASNPCLSHTCRWPGERCEIDETGQPKCVCP-DSCPKVMLPVCGSDGTTYESHCHLELTACMKMRQIWVVYSGQCSQEPQCQAIGLHCQGYEVCTRIKAPPVYQIHSQQYSGSQSSKFQPMVAHCVCPTCPEKGLGDQVCGTDGQTYRSECHLRASVCQRQLYGVKVRSIGPCDACNNKECKYYAICQKNADGEPQCICPTDCPYVQGGKTVCGNDGNTYEDECVLKVRSCAEQREIYVIHEGPCKA---------CPNGCPLGYQCRNGQCVCRDACPPTSSLLDAEVCGTDGLLYRSECELKRQACLQGKEINADPSGASCRKRLDSNSEDVVAVRPQADGVQVSQCTCNKVGALSEFCD-HRGRCRCKWYVQGDKCDQCVAGYWGL-QNGHECIACSCHPDGSVSTNCDQTSGQCDCRPGVVGRQCSICPDGGHVTKSGCNVENVTSGYRATESLSLKSEAKSKSDNNTPPPPDSLQTNEIITGRQFSPETTLLIPAPQSFEQPITIELDVVLSGQDGNLLQYRIAPTEQEQMLVKNLKDH--QFRLGISGGRVECSYLNGRIPDRLYVVQAPETIRPNTLHQIRVGVNNNKPWLQLDGVQTTLVTEAPILQPSTAENITQPVGGYKTIVIGRPLFPAIQKTWPPPSARENDGFGGCLLRVNLITGSNKQAQPIDLLSGAGTELAWIGIKRMTSGLSEAPLCSANEEFSSPPEVLHEDDRTKSIQSDGSTVEQLQAPATICTREEPCQNGGICVSTRPNEYDCICQPGWQGQRCEQVVTVIPQFGGDSFIRLPGPKGPQAMNGKKLRVGLTFLVTQVPGLLFFVPPKTRMGP-FLGVYIDPKGYVVVACRTELRALDAKFPDSVGRSSDTVLLQYRIPLQLRRWHVLTIDKRPRAMSLKIDEN-QSQRIRLVPAALRRYLKKWRGLSLPSFDLSSSPIYLGGYD--FHNSPTPPMDIRTGLVGAIQQMNINGADIFLVGPPSPNVEVTQNSLSDKSEYWLNVSQWQGPPCGPAYSPC-RIGELQSVCRPLGTTASCACSTQSQLIRFMREHGTNDANWAETLACQRKQAEINAMRENSQTSDNETPQKPWSQDDVQYDALPRTVESPGTDPKIGQGKDAFAATPETRNCAQLAVRFSGNTIFKYFNLLKSMTDYYMRLQLQTASQDGLILMIGDTLPETKRPGYLQSKLYDQRELTMIALRKGRVEFGIFIVSEITTAASDRRIALITGRTSTNLLQIQSKMELNDGKCHTVNVVRSGRRATLIVDHQMASGEF--SVPSQSMHQDNYVLMGGAMLNITGIPWEYQHNFTGCIGDLFLNEQKVHMLTSAFEIRGPIMSC 1680          

HSP 2 Score: 149.443 bits (376), Expect = 3.765e-32
Identity = 139/461 (30.15%), Postives = 205/461 (44.47%), Query Frame = 1
Query:  661 VCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTN----------------------PYPY--CKCPNDKC-DSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRC--DICKFVKCEFNG-ICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQ----------SDICSNI------QCH----YGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINS----NFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIV--QPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGES-VCGTDGKTYKSECHMRMHAC 1878
            VCG+DG+ Y + CL++++ C        SP+          D  +K   Q+   Q+ P YA C  N                      P P+  C C +  C +     +CGTD  TY+N C ++K  C A       Y G C  + C    C + G  CE+ E G    C CP+    C K + +PVCGSD  TY+S CHL++ +C K   + V+Y G+C  + Q           ++C+ I      Q H     G++  K    VA C C     K    D VCG DG  Y ++C L    C++Q+    + S    + C N  C        Y  C+ + +G+  C CP + CP +   + VCGND  TYE  C L   +C  ++ +++I+ G C   P        CP    C++     +  CP  P S L ++ VCGTDG  Y+SEC ++  AC
Sbjct:  221 VCGTDGVMYQNECLLRKRSCAGGSWSPYSPSRPV---MVSVDYTNKCLNQYHARQTRPSYALCDGNNVCNYGAKCPAINPANSWRHVAPAPFNGCDCQHINCLNEWPDPVCGTDGETYSNECYLRKSMCVAQLPKRILYRGNCASNPCLSHTCRWPGERCEIDETGQPK-CVCPDS---CPK-VMLPVCGSDGTTYESHCHLELTACMKMRQIWVVYSGQCSQEPQCQAIGLHCQGYEVCTRIKAPPVYQIHSQQYSGSQSSKFQPMVAHCVCPTCPEKGL-GDQVCGTDGQTYRSECHLRASVCQRQLYGVKVRSIGPCDACNNKECKY------YAICQKNADGEPQCICPTD-CPYVQGGKTVCGNDGNTYEDECVLKVRSCAEQREIYVIHEGPCKACP------NGCPLGYQCRNGQCVCRDACP--PTSSLLDAEVCGTDGLLYRSECELKRQAC 657          

HSP 3 Score: 97.4413 bits (241), Expect = 3.079e-16
Identity = 89/325 (27.38%), Postives = 143/325 (44.00%), Query Frame = 1
Query:  538 DPCSKLNCKF-GAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRK-EAQQDGISKSNEQFCQHQSCPPYATC------------VTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRF-IEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPN--PDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSC-DYLDCKNTWRDP-VCGNDGIIYDNKCFLMKMSCEKQMEMHV 1455
            +PC    C++ G +C+      P  VC  S  +       + VCGSDG  Y+SHC ++   C   + I V  +  C ++ + Q  G+     + C     PP                      +C CP         Q+CGTD  TY + C ++   C+   + ++ + +G CD C   +C++  IC+   DG    C CP   P     K     VCG+D  TY+ EC LK+ SC ++  + V+++G C+       C N  C  G +C        QC C D     ++  D  VCG DG++Y ++C L + +C +  E++ 
Sbjct:  363 NPCLSHTCRWPGERCEIDETGQPKCVCPDSCPKVM-----LPVCGSDGTTYESHCHLELTACMKMRQIWVVYSGQCSQEPQCQAIGLHCQGYEVCTRIKAPPVYQIHSQQYSGSQSSKFQPMVAHCVCPTCPEKGLGDQVCGTDGQTYRSECHLRASVCQRQLYGVKVRSIGPCDACNNKECKYYAICQKNADGEPQ-CICPTDCPYVQGGKT----VCGNDGNTYEDECVLKVRSCAEQREIYVIHEGPCKA------CPN-GCPLGYQCRN-----GQCVCRDACPPTSSLLDAEVCGTDGLLYRSECELKRQACLQGKEINA 665          

HSP 4 Score: 90.8929 bits (224), Expect = 2.562e-14
Identity = 99/369 (26.83%), Postives = 148/369 (40.11%), Query Frame = 1
Query: 1558 CPKEPCPKIVQPVCGNDKVTYESICNLTRTACL--------TKKPLWII--YNGICNEEPRCKEQGKDCPSYQICKSDLV---QAKC----------ECPTCPQSG-----------LGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTC--DKCKNKKCSFYS-ICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRN--------------------------GQCVCTDKCSKVKL--RVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKT 2469
            C   PC   ++PVCG D V Y++ C L + +C           +P+ +   Y   C  +   ++     PSY +C  + V    AKC               P +G             + VCGTDG+TY +EC++R   C    +  +I   G C  + C +  C +    C+++   +P+C+CP  C  V  PVCGSD  TYE+ C L++ +C + R I  V  G C  +   P  +     C   ++C                              CVC   C +  L  +VCGTDG  Y +EC L+   C          S+  C       D  N + C   +I   N + +P   QCIC T
Sbjct:  209 CDPIPCSLELRPVCGTDGVMYQNECLLRKRSCAGGSWSPYSPSRPVMVSVDYTNKCLNQYHARQTR---PSYALCDGNNVCNYGAKCPAINPANSWRHVAPAPFNGCDCQHINCLNEWPDPVCGTDGETYSNECYLRKSMC-VAQLPKRILYRGNCASNPCLSHTCRWPGERCEIDETGQPKCVCPDSCPKVMLPVCGSDGTTYESHCHLELTACMKMRQIWVVYSGQCSQE---PQCQAIGLHCQGYEVCTRIKAPPVYQIHSQQYSGSQSSKFQPMVAHCVCP-TCPEKGLGDQVCGTDGQTYRSECHLRASVCQRQLYGVKVRSIGPC-------DACNNKECKYYAICQKNADGEP---QCICPT 559          
BLAST of Agrin, putative vs. TrEMBL
Match: A0A4E0RI86 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_002192 PE=4 SV=1)

HSP 1 Score: 564.688 bits (1454), Expect = 7.908e-168
Identity = 418/1394 (29.99%), Postives = 625/1394 (44.84%), Query Frame = 1
Query:  532 NDDPCSKLNCKFGAQCQKWPG---NPPTAVCHCSNT---------QCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQ----------VSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESC----KKKISLTVMYKGKC-----QTKIQSD--IC-SNIQCHYGAKC-------------IKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICK------------------------SDLVQ--AKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSK---VKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCI---------------------SHNYI----ADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENG--CTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGC--KENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDG-IIFYHSDTDRSSDYLTIVLKNR-----YVEYRVDL------GSGAIF-LKSRVQLTIGRSHSI---------LVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTD---GFVGCLSSL-------------KITAGEETKIYLM--NQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTH-------KPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSHIWKFKDNSFVIFPSES---LQLRQRLKLEITFLPLANNGLLSFISD----GHDRNPAFISVTLN-KNHLEVTCR------------TPIGVTRLISMESALIG---KWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNI--------------TQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCS 4146
             + PC ++ C FGA C+ WP         VC C              Q+G     VC   G  YD+ C +    C  Q  ++          V+   +C +  A++  + K+ + F             T P      P  K   +       D      +                 +VG+ D              ++ED +     C   D L   N   PVCG+D VTY +E  L+  SC      K  + + Y   C     + K Q D  +C  N  C +G  C               +S    +CSC++++C     DPVC  DG  Y N+CFL +  CE Q+   V+    C +NPC G  C    + C++D  G+  C CP +PCP +V PVCG+D+VTY+S C+L RTAC+  + ++I+Y G C+EEP C+  G  C  Y+IC                         S  VQ  A+C CPTCP+ G+G+ VCGTDG+TY+SECH+R  AC+     LK+   G+CD CK K C +++IC++N   EP+CICPTDC+YVR+PVCG+D + YENECF+KV +CAE R I    EGPC           CP  CPLG  C  G+CVC D C K   ++  VCG+DG  Y +ECELKR+AC+    +RV PS   C                        NY+    ADE    SC CN++G+L+  CD    +C CK G+ G+ CD+C+  YW   +NG  C ACSC+  G+ S  C+  TG+C+C+P   G+ CS+CP    ++ +GC   E   Y++++      F  D+          +   ++ + L   + +G ++FY     R    L      R      V  R+DL       SG I  +++  QL +GR H++          ++        V D  + ++  +     +        IG+    +++T  +   +T    GF GCL  L              + +G+ T++  +  NQ  S + E+    P C   D  N V  I+  D++++ E   L      ++H       +PC NGG C+ +S   Y+C CLPG+QG  C++V + + +F   SFV  P  S      R+RL +EI FL     GL+  I          N  FIS+ ++ K  L   CR             P    RLI+   ++     +W+ +++ K  + + + L++ P+  + R +P  F  ++  + ++LT F +   PI+ GG      +     V ++    GA+QK+ IN   +      I  N I              TQWQG PCGP  SPC    PE   C P+     C CS
Sbjct:  175 TERPCDRVRCHFGAICETWPSPSNEKQVGVCVCPQIDVLHRRGLCHIQSG----PVCAHTGRLYDNDCALTLAICVQQSILEKIELPRTAAGVALRELCTQMAAERLKVQKTEKSFELENLATRGNVIATVPITTTARPTPKQKENFEDKPQQDAAVPYGL----------------PFVGQQDF-------------VLEDNVNAASDC---DGLPCPNTLKPVCGTDGVTYLNEYLLRERSCLVTSSGKPPIRIHYVSHCISQKLENKNQPDALLCPGNNVCQFGGLCSIRRTASSHEAISFTSSALFDRCSCEHINCLGRGSDPVCAADGQTYSNECFLRRRICETQIPRAVLYRGNCASNPCLGYTCRWAGEQCQVDETGQPKCVCP-QPCPNVVSPVCGSDRVTYDSHCHLERTACMKMRDIFILYAGQCSEEPHCELLGLQCQGYEICSRLPTPHVHVPMSRYSNPWSNVISSSQPVQLVARCLCPTCPERGIGDQVCGTDGQTYRSECHLRASACQRQIRQLKVRARGSCDACKTKDCPYHAICRLNSLGEPECICPTDCLYVRKPVCGTDGKMYENECFMKVAACAEQREIHVAQEGPCAT---------CPFGCPLGYQCLKGECVCRDACPKPTALEAEVCGSDGQIYPSECELKRQACLRQTNVRVDPSGARCRDLANRIQTNGTLSGQDGFQAGGQNYLVQPQADENVPASCSCNTVGALSEHCD-YRGRCHCKWGVRGERCDQCMPNYWGI-QNGHECIACSCHPDGALSTTCDAMTGQCHCRPGIFGRQCSICPNDGRLTKNGCVSPEGIPYDDRLRVSGRRFSADTTLLVRAPFPLKEPFAVQLILQATAPNGSLLFYQLAPSRQEQMLLENPTGRQFFLDIVNGRIDLRYVSNGPSGRILSVQTSQQLQLGRQHTVRAGVTHGRPWIKLDTGPETTVTDIEERKHEASLSSSLSSGGHGTIVIGRHV--LVSTAQYVQPITKGSVGFSGCLLQLVLRSESTMQEQNVDLISGDPTELAWIGVNQLPSGLAEA----PLCQSTD-NNPVSSIDQIDRDDKQETVQLDTVSQDKSHSKNPCDRQPCGNGGSCELTSNVGYTCICLPGWQGHHCDQVATIVPQFHRGSFVRLPGPSGRQAMQRKRLHIEIVFLLTDFEGLILLIPPSMRFAKSNNGPFISIYVDAKGFLFTHCRVGHPMEDGQDVLAPNSRARLITFRYSVPAQRNQWHTLIVEKRTRALIIQLDNGPKE-RVRTVPTNFRRLSRYIRQQLTAFDLSESPIYVGGFS--PTDQSVPPVPIRNGMMGAVQKLSINGAEVVLAGP-IASNTIGPSAAEPTELWFKVTQWQGKPCGPNYSPCLPDKPES-ICRPQGALATCACS 1508          
BLAST of Agrin, putative vs. TrEMBL
Match: A0A4S2KBC1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_011105 PE=4 SV=1)

HSP 1 Score: 548.125 bits (1411), Expect = 1.954e-164
Identity = 410/1418 (28.91%), Postives = 640/1418 (45.13%), Query Frame = 1
Query: 1258 DICSNIQCHYGAKCIKTSN-TVAQCSCDYLDC----KNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQIC----------------------KSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVR--RPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKC----SKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGC-----------ISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENG--CTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKS---------------YWSGNA---------------ENYLSINISLVPYSSDG-IIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAI---FLKSRV--QLTIGRS---------HSILVERLNRDSRLVIDGTDSQYGMNPPFL--------TNLDAGF-IFTIGQATGPIINTL--SHTGDVTDGFVGCLSSLKITAG---EETKIYLMN---QQTSWI-----IESSNVKPNC-PHIDFKNSVDVIEDPDKEEQSEKENLKIKDY------CQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSHIWKFKDNSFVIFP---SESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLN-KNHLEVTCRT---------PIGVTR-----LISMESAL-IGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLN-VNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRF-----QNSDIILN----------NITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHE----------------------------NLCIRNSMQHDNPANTNFFRK-------------------YLGKSASKYAAVKQKRD--------------------KSSTKNNIRIKFKTASNDGMXXX-------------XXXXXXXXXXXXVIAIRNGVIEVAINLGGK------------------NGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 4752
            D C+N +C + A C+ + +     C C Y  C     +T + P+CG+DG  Y + C L + +C   M++ +     C +NPC    C  P + C ID  G+  C CP + CPK++ PVCG+D  TYES C+L  TAC+  + +W++Y+G C++EP+C+  G  C  Y++C                      K   + A C CPTCP+ GLG+ VCGTDG+TY+SECH+R   C+     +K+ +IG CD C NK+C +Y+ICQ N   EPQCICPTDC YV+  + VCG+D  TYE+EC LKV+SCAE R I  + EGPCK          CP  CPLG  CRNGQCVC D C    S +   VCGTDG  Y +ECELKR+AC+  K I   PS   C           ++    AD      C CN +G+L+  CD    +C CK  + G  CD+C+ GYW   +NG  C ACSC+  GS S  C+  +G+C+C+P  +G+ CS+CP G  ++  GC   ++         L    ++ +KS                 +G                 E  ++I + +V    DG ++ Y          L   LK+   ++R+ +  G +   +L  R+  +L + ++         H I V   N    L +DG  +      P L        T    G+    IG+   P I       +    DGF GCL  + +  G   +   I L++    + +WI         +  P C  + +F +  +V+ + D+ +  + +   ++        C   +PC NGG+C ++    Y C C PG+QG  CE+VV+ I +F  +SF+  P          ++L++ +TFL     GLL F+       P F+ V ++ K ++ V CRT         P  V R     L+     L + +W+ + I K  + + L ++ + Q  + RL+P      +       L  F + + PI+ GG D    NS +  + ++    GAIQ++ IN  +I        N ++  N          N++QWQGPPCGP  SPC +    +  C P      C CS + +                            N    NS   DN      + +                    +G+    +AA  + R+                    KS T   +R++ +TAS DG++++             L+     ++   +IA+R G +E  I +  +                    +L+I     ++D K HTV V+R+ R   L++D +M   +   +    ++  D ++ +GGA   + G PWEY   F GCI +L+++E   +++  A +  GPI+ C
Sbjct:   66 DPCTNYRCAFQAWCVPSKDFKRPTCVC-YNTCYDVGDSTDKGPICGSDGREYSSVCQLRREACSMMMDIEIKYRGKCASNPCLSHTCRWPGERCEIDETGQPKCVCP-DSCPKVMLPVCGSDGTTYESHCHLELTACMKMRQIWVVYSGQCSQEPQCQAIGLHCQGYEVCTRIKAPPVYQIHSQQYSGSQSSKFQPMVAHCVCPTCPEKGLGDQVCGTDGQTYRSECHLRASVCQRQLYGVKVRSIGPCDACNNKECKYYAICQKNADGEPQCICPTDCPYVQGGKTVCGNDGNTYEDECVLKVRSCAEQREIYVIHEGPCKA---------CPNGCPLGYQCRNGQCVCRDACPPTSSLLDAEVCGTDGLLYRSECELKRQACLQGKEINADPSGASCRKRLDSNSEDVVAVRPQADGVQVSQCTCNKVGALSEFCD-HRGRCRCKWYVQGDKCDQCVAGYWGL-QNGHECIACSCHPDGSVSTNCDQTSGQCDCRPGVVGRQCSICPDGGHVTKSGCNVENVTSGYRATESLSLKSEAKSKSDNNTPPPPDSLQTNEIITGRQFSPETTLLIPAPQSFEQPITIELDVVLSGQDGNLLQYRIAPTEQEQMLVKNLKDH--QFRLGISGGRVECSYLNGRIPDRLYVVQAPETIRPNTLHQIRVGVNNNKPWLQLDGVQTTLVTEAPILQPSTAENITQPVGGYKTIVIGRPLFPAIQKTWPPPSARENDGFGGCLLRVNLITGSNKQAQPIDLLSGAGTELAWIGIKRMTSGLSEAPLCSANEEFSSPPEVLHEDDRTKSIQSDGSTVEQLQAPATICTREEPCQNGGICVSTRPNEYDCICQPGWQGQRCEQVVTVIPQFGGDSFIRLPGPKGPQAMNGKKLRVGLTFLVTQVPGLLFFVPPKTRMGP-FLGVYIDPKGYVVVACRTELRALDAKFPDSVGRSSDTVLLQYRIPLQLRRWHVLTIDKRPRAMSLKIDEN-QSQRIRLVPAALRRYLKKWRGLSLPSFDLSSSPIYLGGYD--FHNSPTPPMDIRTGLVGAIQQMNINGADIFLVGPPSPNVEVTQNSLSDKSEYWLNVSQWQGPPCGPAYSPC-RIGELQSVCRPLGTTASCACSTQSQLIRFMREHGTNDANWAETLACQRKQAEINAMRENSQTSDNETPQKPWSQDDVQYDALPRTVESPGTDPKIGQGKDAFAATPETRNCAQLAVRFSGNTIFKYFNLLKSMTDYYMRLQLQTASQDGLILMIGDTLPETKRPGYLQSKLYDQRELTMIALRKGRVEFGIFIVSEITTAASDRRIALITGRTSTNLLQIQSKMELNDGKCHTVNVVRSGRRATLIVDHQMASGEF--SVPSQSMHQDNYVLMGGAMLNITGIPWEYQHNFTGCIGDLFLNEQKVHMLTSAFEIRGPIMSC 1461          

HSP 2 Score: 137.117 bits (344), Expect = 2.059e-28
Identity = 119/372 (31.99%), Postives = 179/372 (48.12%), Query Frame = 1
Query:  865 PYCKCPN---DKCDSSS-SQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRC--DICKFVKCEFNG-ICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQ----------SDICSNI------QCH----YGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINS----NFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIV--QPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGES-VCGTDGKTYKSECHMRMHAC 1878
            P C C N   D  DS+    ICG+D   Y+++C++++ +C     IE +Y G+C  + C    C + G  CE+ E G    C CP+    C K + +PVCGSD  TY+S CHL++ +C K   + V+Y G+C  + Q           ++C+ I      Q H     G++  K    VA C C     K    D VCG DG  Y ++C L    C++Q+    + S    + C N  C        Y  C+ + +G+  C CP + CP +   + VCGND  TYE  C L   +C  ++ +++I+ G C   P        CP    C++     +  CP  P S L ++ VCGTDG  Y+SEC ++  AC
Sbjct:   88 PTCVCYNTCYDVGDSTDKGPICGSDGREYSSVCQLRREACSMMMDIEIKYRGKCASNPCLSHTCRWPGERCEIDETGQPK-CVCPDS---CPK-VMLPVCGSDGTTYESHCHLELTACMKMRQIWVVYSGQCSQEPQCQAIGLHCQGYEVCTRIKAPPVYQIHSQQYSGSQSSKFQPMVAHCVCPTCPEKGLG-DQVCGTDGQTYRSECHLRASVCQRQLYGVKVRSIGPCDACNNKECKY------YAICQKNADGEPQCICPTD-CPYVQGGKTVCGNDGNTYEDECVLKVRSCAEQREIYVIHEGPCKACP------NGCPLGYQCRNGQCVCRDACP--PTSSLLDAEVCGTDGLLYRSECELKRQAC 438          

HSP 3 Score: 126.716 bits (317), Expect = 3.043e-25
Identity = 121/413 (29.30%), Postives = 176/413 (42.62%), Query Frame = 1
Query:  538 DPCSKLNCKFGAQCQKWPG-NPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCP-PYATCVTNP--YPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCD---ICKFV--KCEFNGICEMME--------------------DGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQC----SCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPK----IVQPVCGNDKVTYESICNLTRTACLTKK 1665
            DPC+   C F A C        PT VC+ +         +  +CGSDG  Y S C ++R+ C +   I++     C                 C   +C  P   C  +    P C CP D C      +CG+D  TY + C ++  +C   R I   Y G+C     C+ +   C+   +C  ++                      +   C CP   E   K +   VCG+D  TY+SECHL+   C+++     +Y  K ++    D C+N +C Y A C K ++   QC     C Y+    T    VCGNDG  Y+++C L   SC +Q E++VI+   C+  P     CP  YQ CR   NG+  C   ++ CP     +   VCG D + Y S C L R ACL  K
Sbjct:   66 DPCTNYRCAFQAWCVPSKDFKRPTCVCYNTCYDVGDSTDKGPICGSDGREYSSVCQLRREACSMMMDIEIKYRGKCASNP-------------CLSHTCRWPGERCEIDETGQPKCVCP-DSCPKVMLPVCGSDGTTYESHCHLELTACMKMRQIWVVYSGQCSQEPQCQAIGLHCQGYEVCTRIKAPPVYQIHSQQYSGSQSSKFQPMVAHCVCPTCPE---KGLGDQVCGTDGQTYRSECHLRASVCQRQ-----LYGVKVRSIGPCDACNNKECKYYAICQKNADGEPQCICPTDCPYVQGGKT----VCGNDGNTYEDECVLKVRSCAEQREIYVIHEGPCKACPNG---CPLGYQ-CR---NGQCVC---RDACPPTSSLLDAEVCGTDGLLYRSECELKRQACLQGK 442          

HSP 4 Score: 97.0561 bits (240), Expect = 3.864e-16
Identity = 89/325 (27.38%), Postives = 143/325 (44.00%), Query Frame = 1
Query:  538 DPCSKLNCKF-GAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRK-EAQQDGISKSNEQFCQHQSCPPYATC------------VTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRF-IEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPN--PDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSC-DYLDCKNTWRDP-VCGNDGIIYDNKCFLMKMSCEKQMEMHV 1455
            +PC    C++ G +C+      P  VC  S  +       + VCGSDG  Y+SHC ++   C   + I V  +  C ++ + Q  G+     + C     PP                      +C CP         Q+CGTD  TY + C ++   C+   + ++ + +G CD C   +C++  IC+   DG    C CP   P     K     VCG+D  TY+ EC LK+ SC ++  + V+++G C+       C N  C  G +C        QC C D     ++  D  VCG DG++Y ++C L + +C +  E++ 
Sbjct:  144 NPCLSHTCRWPGERCEIDETGQPKCVCPDSCPKVM-----LPVCGSDGTTYESHCHLELTACMKMRQIWVVYSGQCSQEPQCQAIGLHCQGYEVCTRIKAPPVYQIHSQQYSGSQSSKFQPMVAHCVCPTCPEKGLGDQVCGTDGQTYRSECHLRASVCQRQLYGVKVRSIGPCDACNNKECKYYAICQKNADGEPQ-CICPTDCPYVQGGKT----VCGNDGNTYEDECVLKVRSCAEQREIYVIHEGPCKA------CPN-GCPLGYQCRN-----GQCVCRDACPPTSSLLDAEVCGTDGLLYRSECELKRQACLQGKEINA 446          

HSP 5 Score: 77.7962 bits (190), Expect = 2.875e-10
Identity = 53/154 (34.42%), Postives = 74/154 (48.05%), Query Frame = 1
Query: 1915 GTCDKCKNKKCSFYSICQMNR-FLEPQCICPTDCVYV-----RRPVCGSDDRTYENECFLKVKSCA-----ENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQ--CVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVA 2337
            G  D C N +C+F + C  ++ F  P C+C   C  V     + P+CGSD R Y + C L+ ++C+     E +     +  PC     +   ERC  D         GQ  CVC D C KV L VCG+DG  YE+ C L+  AC+  + I V 
Sbjct:   63 GIKDPCTNYRCAFQAWCVPSKDFKRPTCVCYNTCYDVGDSTDKGPICGSDGREYSSVCQLRREACSMMMDIEIKYRGKCASNPCLSHTCRWPGERCEID-------ETGQPKCVCPDSCPKVMLPVCGSDGTTYESHCHLELTACMKMRQIWVV 209          
BLAST of Agrin, putative vs. TrEMBL
Match: A0A5K4EU74 (Agrin, putative OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 545.428 bits (1404), Expect = 1.659e-160
Identity = 383/1188 (32.24%), Postives = 569/1188 (47.90%), Query Frame = 1
Query: 1135 PVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQ-----SDICSNIQ-CHYGAKCI--------------KTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQIC---KSDLVQA----------------------KCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKC---SKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGC--------------ISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENG-CTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCK-----------ENSIYENKVDAVELG----FLKDSFAKSYWSGNAE------NYLSINISLVPYSSD---------------GIIFYHS----------DTDRSSDYLTIVLKNRYVEYRVDLGS---GAIFLKSRVQLTIGRSHSIL-----------VERLNRDSR--LVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTD--GFVGCLSSLKITAGEETKIY------LMNQQTSWI-IE-------------SSNVKP-NCPHIDFKNSVDVIEDPD--KEEQSEKENLKIKDYCQT------HKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSHIWKFKDNSFVIFPSESLQL---RQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLN-KNHLEVTCRTPIG------VTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDI--ILN----------------NITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCS 4146
            P+C S+   Y ++C LK  SC+K  +  +     C + +Q     +++C N   C YG KC               K     + C C++++C N W DPVC +DG  Y N+CFL +  CE Q    ++    C +NPC   KC    + C++D NG++ C CP EPCP  V PVCG+D VTY+SIC+L RTAC   + + +IY+G C+E   C    + C  Y+IC   K+ +V                        +C CPTCP+ GLG  VCG+DG+TY+SECH+R  AC+ +S  L + + G CD C+ K+C +Y+ICQ++ F EPQCICPTDC+YVR+PVCG+D +TYENECFLKVKSCA+ R +    EG C+          C   CPLG  CRNGQCVC D C      +L VCGTDG  Y +ECELKR+ACI    I V  + + C               S N  AD     SC CN +G+L+ ECD     C CK G+ G  CD+C+  YW    N  C  CSC+  GS    CN  TG+CNC+   +G+ CS+CP G  ++ +GC            E++  +    A EL     F+     K     N E         +  +  +P+  D               G++ ++             D      ++ + N  V  +   GS     + + S+  LT    H+I            +++ +R +   ++    D+    N P   +L+   I    +  G  I+ +    D+ D  GF GCL+ + I AG  TK +       +N + +W+ IE             SS++K  + P  D  NS  +   P   + +Q ++ +  I    QT       K C N G+    S+  Y+C C PG+QG  CE+ V+ I +F  N F+     + +    R++L +E+ FL    +GLL FI      N  FI+  L+ +N+L V CRT  G      + +L   E   + +WN ++I K  K + + +N + +  +  LIP  FL++ + + ++LT F + + PI+ GG       S  N + ++  FYGAIQ+I IN+  +      +  ++N                N++QWQG PCGP  SPC    P    C P +    C C+
Sbjct:  402 PICDSEGTIYLNDCLLKKYSCRKIGTGELPRIISCNSTLQKYKPKAELCGNGNLCLYGGKCYDPLDHYYRSKMIMKKILPLYSNCICEHINCLNDWPDPVCADDGETYTNQCFLKRAICETQSLKRILYRGNCASNPCLHHKCRWQGEKCQVDVNGQAKCTCP-EPCPSAVSPVCGSDGVTYDSICHLERTACQKMREIRVIYSGECSEPKDCILLNQPCQGYEICSRIKNPMVYTSINRKLDASVYDLSNSFEDTIPECICPTCPEYGLGGQVCGSDGQTYRSECHLRSSACQRHSTDLTVKSRGKCDACQTKQCKYYAICQLSAFGEPQCICPTDCLYVRKPVCGTDGKTYENECFLKVKSCADQREVHVAQEGYCR---------PCTAGCPLGFQCRNGQCVCRDACPPKHPTELDVCGTDGKLYSSECELKRQACIHQTNIDVDLTGVRCRSKHPTVLQDTNMKTSGNIQADGVRLSSCTCNKLGALSEECD-YLGNCRCKWGVGGLKCDQCLANYWGIQNNHECIPCSCHPLGSTDTTCNQATGQCNCRTGVVGRQCSMCPDGSQVTENGCSVKRQSEADIKFESNEQQYSPGATELNKTNTFISQLPDKLTAENNKEEDGRLFTETTTLLVRIPFHIDQPTEIQMILGLDKGNGMLLHYRAPPSEQEQMISRDTQDHQFSMAISNWRVVLKYIDGSVPNRILLVYSKHNLTRNTKHNIQAGIISGTPWIKIDKFSRTTNQDVIEKWADTHQSDNQPTAGSLETIIIGRQIKIGGQSISDMKERADLHDDYGFSGCLNKMIINAGSPTKHFSLDLLEAINTKLAWLGIEPNPSTGHSEAPLCSSSIKALSSPTNDISNSNTIENIPPLLQSDQVQRHDNIINQNVQTLSSHIQTKKCENYGIESIGSDGKYTCICQPGWQGGVCEQAVTIIPQFSGNGFIRLAGPTGKYAIKRRKLHIELIFLVTQPSGLLFFIPPKSPHNGPFIAAYLDEQNYLNVVCRTGKGKLVNENLIQLRYNEPVQLNQWNTLLIDKLQKVLRVKVNGNKRQ-RVSLIPSRFLHIQNHLLKELTNFDLSSSPIYLGGYG-FYDQSILNYIPIRHGFYGAIQRININEAEVVLAGPSLADMMNTPEEQGKLPHLFEKWANVSQWQGLPCGPQYSPCQLNQP-YSICRPNIQHATCACT 1575          

HSP 2 Score: 131.339 bits (329), Expect = 1.510e-26
Identity = 119/377 (31.56%), Postives = 157/377 (41.64%), Query Frame = 1
Query:  661 VCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYA---TCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRC----------------DICKFVK-------------CEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKK-KISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGI 1692
            VC  DG  Y + C +KR  C  Q             K     G   SN   C H  C           N    C CP + C S+ S +CG+D +TY +IC +++ +C+  R I   Y G C                +IC  +K                  +    ED +   C CP   E     +   VCGSD  TY+SECHL+  +C++    LTV  +GKC      D C   QC Y A C  ++    QC C   DC    R PVCG DG  Y+N+CFL   SC  Q E+HV    +C   PC+   CP  +Q CR   NG+  C     P       VCG D   Y S C L R AC+ +  + +   G+
Sbjct:  501 VCADDGETYTNQCFLKRAICETQ-----------SLKRILYRGNCASNP--CLHHKCRWQGEKCQVDVNGQAKCTCP-EPCPSAVSPVCGSDGVTYDSICHLERTACQKMREIRVIYSGECSEPKDCILLNQPCQGYEICSRIKNPMVYTSINRKLDASVYDLSNSFEDTIPE-CICPTCPEY---GLGGQVCGSDGQTYRSECHLRSSACQRHSTDLTVKSRGKC------DACQTKQCKYYAICQLSAFGEPQCICP-TDCLYV-RKPVCGTDGKTYENECFLKVKSCADQREVHVAQEGYCR--PCTA-GCPLGFQ-CR---NGQCVCRDACPPKHPTELDVCGTDGKLYSSECELKRQACIHQTNIDVDLTGV 844          

HSP 3 Score: 68.5514 bits (166), Expect = 1.741e-7
Identity = 63/199 (31.66%), Postives = 82/199 (41.21%), Query Frame = 1
Query:  661 VCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPY--PYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKG-KCQTK 1248
            VCGSDG  Y       R EC L+ S        C R        S+     CQ + C  YA C  + +  P C CP D C      +CGTD  TY N C +K  SC   R +     G C  C    C     C   +      C   +P EL        VCG+D   Y SEC LK ++C  + ++ V   G +C++K
Sbjct:  674 VCGSDGQTY-------RSECHLRSS-------ACQRHSTDLTVKSRGKCDACQTKQCKYYAICQLSAFGEPQCICPTD-CLYVRKPVCGTDGKTYENECFLKVKSCADQREVHVAQEGYCRPCT-AGCPLGFQCRNGQCVCRDACPPKHPTEL-------DVCGTDGKLYSSECELKRQACIHQTNIDVDLTGVRCRSK 849          

HSP 4 Score: 65.4698 bits (158), Expect = 1.736e-6
Identity = 36/145 (24.83%), Postives = 65/145 (44.83%), Query Frame = 1
Query: 4378 VIAIRNGVIEVAINLGGK--------------------NGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 4752
            +I +RNG +E+ +NL                       N ++ I     ++D +WH +Q + N +   L +D+ M   +     DY+T      ++LGG    + G   +Y   F GCI+++ + E    ++ +A +  GPI RC
Sbjct: 1729 LIVLRNGRVELLLNLVTSRKKKDQSWDVNNNDNGNPEYNRLMPIQARHKVNDGEWHMIQAMGNKQRATLFVDNHMVSGEFAGVADYDTPPVRD-VYLGGTIFNIVGLSADYQQNFTGCIADMLIQEKIIPILSEATEIHGPIERC 1872          
BLAST of Agrin, putative vs. Ensembl Cavefish
Match: agrn (agrin [Source:ZFIN;Acc:ZDB-GENE-030131-1033])

HSP 1 Score: 254.218 bits (648), Expect = 1.318e-67
Identity = 249/892 (27.91%), Postives = 380/892 (42.60%), Query Frame = 1
Query:  202 SDLIIVGRVLNLANSEVI-------VSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDFIMYLKKTEQ------NNFFELNYA--KEFGNGLFEKRISVFLN-GATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQ-ICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENN---PCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQ---MNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAE------NRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKAC-------------IDNKTIRVAPSVIGCISHNYIADEKNKRS------------CLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF----TEN--GCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENS 2688
            +++++ G V  + N + +       V V R LKG  ++N    +   N    +++        C   + +G+  I ++    +       N   LN +  +     L E  + V    G  + Q    D C    C FGA C++ P +P    C C    C        VCGSD   Y + C +++ +C +Q+ I+V     C  K+             C   +C   +TC+ +       C CP   C+    Q +CG+D + Y + CE+   +C   + I  Q+ G CD C+ ++   N  C  + +      +   P + C    + P+C SD  +Y SEC ++  +  K+  L  ++ G CQ   Q   C   +C + A C+   N  A+CSCD + C  T++ P+CG DG  Y N C      C  Q  + V     C+ N   PC    C D    C +  NG++ CECP + CP+   PVCGND  TY S C++    C  +K + I + G C+      +   +C    IC  D    +C CPT    G  + VCG+DG TY +EC + + AC T  + L++   G C+K         +IC     N ++E  C+C  D V V   +C        N   + V   AE         + A  +  C+      DE+             + +CVC   C      VCG+DG  Y++ECELK+  C              ++K +    + + C    Y   E  K +            C CN  GS    CDP++ QC CK G+ G  CDRC  G+WNF    TEN  GCT C+C+  GS    C   TG C+CK    G  C VC  G  +  +GC + +
Sbjct:   37 ANIVLTGTVEEIMNMDPVHNTYSCKVRVWRYLKGKTMVNGEVLLDGGNK---VMIGGFGDPGICDNQVATGDTRIFFVNLAPEYMWPAHKNELMLNSSLMRITLRNLEEVELCVEDKPGHITHQPPPPDGCRGKLCGFGAVCERDPADPSKGDCLCKKVPCPL--VVAPVCGSDSSTYTNECELEKAQCSMQRRIKVMRKGPCALKDP------------CNDVTCSYGSTCIQSSDGLSAKCMCPL-SCERVPKQVVCGSDGLDYPSECELNMKACSTQKNIRLQHSGSCDPCRDIQSGLNFTC--LVNAQTRKMETSAPPDSCPPGAE-PLCASDGRSYSSECQMQRTAVLKERHLKKVHSGPCQP--QGKECKE-ECRFSAVCL-LENGRARCSCDPIHCDGTYK-PLCGKDGHTYPNDCERRNAECRTQTHIPVKQQGTCDLNAPSPCLKKIC-DFGGTCVV-KNGEAVCECP-DACPQSQDPVCGNDGHTYSSQCHMRAMGCALQKHISIQHKGPCD------KACTNCSFGAIC--DAQTGRCVCPT-ECVGSRQPVCGSDGTTYPNECMLNVKAC-TKQLELRVVAQGECNK--------ITICSKGCWNLYVE-MCVCVFDQVCVYMCIC--------NVLIVCVHVSAECGSGGSGSGVEACEQERCRKYGGSWDEDT-----------EDDRCVCDFTCQN----VCGSDGQTYDSECELKKTRCEKQVDLLLQSQGPCESKPVSGLITPLHCSETVYGCCEDGKTAALGVELAGCPSKCHCNHYGSYGGTCDPTSGQCSCKPGVGGLRCDRCEPGFWNFRGIVTENTSGCTPCNCDSVGSVRDDCEQMTGLCSCKTGVKGMKCDVCSDGSKMPANGCHKGA 857          

HSP 2 Score: 146.362 bits (368), Expect = 1.281e-34
Identity = 166/745 (22.28%), Postives = 300/745 (40.27%), Query Frame = 1
Query: 2590 TGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWS-GNAENYLSINISLVPYSSD--GIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKP----NCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYC-QTHKPC-----LNGGLCQTSSEEMYSCQCLPGYQGITCEEVV----SHIWKFKDNSFVIFPSESL---QLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK--PVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 4752
             G C+ +P   G  C      +S +    +  ++ E  ++     ++     KSY +      Y ++ I++   +SD  GI+ Y+S   +  D+L++ L    VE + D GSG   + SRVQ+  G+ H ++V R  R++ L +D      G +P     L+      IG     ++  +     V+ G VGC+  L +       +Y + +    ++  + V       C     KN         +    +  N      C  +H PC          C    E  Y C+C  G +G  C +V     ++I  F   S++      L    L+Q++ + +  L   +NG++ +     D    FIS+ L    LE       G   + S E   +  WN V + +A +   +N+N             G   V      +     +K + ++ GG    +  + +    LK  F GAIQKI +    I    + +  ++++ +   PC              G CVP ++   C C         +++  ++  A  +    + G++  +Y     K +K+   N   +  KT +  G+++   K          +AI +G +++  +LG K  VLR T    ++ N+W  ++  R  R+  L + +    A +  ++      L TDG +WLGG ++       P  Y+T F GC+ ++ VD +  +LV DA  N   IL C
Sbjct: 1290 AGPCDSQPCGHGGTCEEIRDDFSCTCPAGRGGAVCEKMINY----YIPSFGGKSYLAFPTMRAYHTVRIAMEFRASDMSGILLYNSQNGKK-DFLSLALVGGKVELKFDTGSGICSVVSRVQIKPGQWHHLVVNRNRRNAALSVDNEPPVEGQSPTGTDGLNLETHLYIGGVPEDMVQDVKERTSVSAGLVGCIRQLDVN----NMVYNLQENGGNVLFGTAVGECGNNPCSPNPCKNGASCHTKGAEMFHCKCVNAFSGPTCADSHNPCEPNPCHPSSQCAILPEGGYKCECPMGREGKHCRKVSEKKGAYIPYFDGESYLELKGLHLYNHDLKQKVSMTVVLLANDSNGMIFYNGQKTDGKGDFISLALIGGILEFRYDLGKGPAVIRSKEKIKLNVWNTVNLERAQRKGEINVN-------------GKDPVRGESPNQHNDLNLK-ESLYVGGAPDFSKVARAAS--LKSGFKGAIQKITVMGTQILKPENALHSSDVSMYSHHPCS------GDVCHNGGECVPMLDSYECVCPYGFTGAQCQHAT-YEKAAGESEAIAFDGRTFIEYHNGVTKSEKALLVNKFELSIKTEATHGLILWSGKGVERSDYI-ALAIVDGRVQMTYDLGSKPVVLRST--VRVNTNRWIRIKASRALRDGSLQVGNE---AAVTGSSPLAATQLDTDGALWLGGLEELSVARRLPKAYSTGFMGCVKDVIVDGVDLHLVEDAL-NSPKILHC 1995          

HSP 3 Score: 104.375 bits (259), Expect = 8.141e-22
Identity = 168/634 (26.50%), Postives = 227/634 (35.80%), Query Frame = 1
Query:  550 KLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVT-NPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKC-QTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEP--------RCKEQGKDCPSYQICKSDLVQA----------KCEC-------PTC-PQSGLGESVCGTDGKTYKSECHMRMHACET---NSIALKIANIGTCDKCK-NKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKV---KSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVC----TDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRV 2334
            K  C+F A C    G    A C C    C    K +  CG DG  Y + C  +  EC  Q  I V           QQ     +    C  + C    TCV  N    C+CP D C  S   +CG D  TY++ C M+ + C   + I  Q+ G CD      C F  IC    D     C CP     C  + Q PVCGSD  TY +EC L +++C K++ L V+ +G+C +  I S  C N+       C+     V  C C+ L               I+    C  +   C        + +  CE   C            +   +     E  +  C    Q VCG+D  TY+S C L +T C  +  L +   G C  +P         C E       Y  C+     A          KC C        TC P SG      G  G        +R   CE    N   +   N   C  C  +   S    C+    L   C C T    ++  VC    +   N C       KSC E + +   S               C E+        NGQ  C     D   K K +VCG+DG  Y ++C+L+  AC  +K I V
Sbjct:  389 KEECRFSAVCLLENGR---ARCSCDPIHCDGTYKPL--CGKDGHTYPNDCERRNAECRTQTHIPVK----------QQGTCDLNAPSPCLKKICDFGGTCVVKNGEAVCECP-DACPQSQDPVCGNDGHTYSSQCHMRAMGCALQKHISIQHKGPCDK-ACTNCSFGAIC----DAQTGRCVCPTE---CVGSRQ-PVCGSDGTTYPNECMLNVKACTKQLELRVVAQGECNKITICSKGCWNLYVEM-CVCVFDQVCVYMCICNVL---------------IV----CVHVSAECGSGGSGSGVEA--CEQERCR-----------KYGGSWDEDTEDDRCVCDFTCQNVCGSDGQTYDSECELKKTRCEKQVDLLLQSQGPCESKPVSGLITPLHCSET-----VYGCCEDGKTAALGVELAGCPSKCHCNHYGSYGGTCDPTSGQCSCKPGVGG--------LRCDRCEPGFWNFRGIVTENTSGCTPCNCDSVGSVRDDCEQMTGL---CSCKTGVKGMKCDVCSDGSKMPANGCHKGASAPKSCTELKCLFGAS---------------CVEE--------NGQAHCECPSPDCDQKNKTKVCGSDGVTYADQCQLRTIACRQDKEIIV 925          

HSP 4 Score: 80.4925 bits (197), Expect = 1.489e-14
Identity = 123/507 (24.26%), Postives = 173/507 (34.12%), Query Frame = 1
Query:  541 PCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKAN---RFIEQQYVGRCDIC---------KFVKCEFNGICEMM-----------------------------------------EDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQC------------------------------HYGAKCIKTSNTVAQCSC----DYLDCKN------TWRDPV-----------CGNDGIIYDN----------KCFLMKMSCEKQMEMHVINSNFCENNP-----CSGVKCPDPYQYCRIDNNGKSTCECPKEPC-PKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNE 1701
            PC K  C FG  C    G    AVC C +      Q +  VCG+DG  Y S C M+   C LQK I +     C              ++ C + S   +          C CP + C  S   +CG+D  TY N C +   +C      R + Q    +  IC         +   C F+ +C  M                                         ED     C C   D  C       VCGSD  TY SEC LK   C+K++ L +  +G C++K  S + + + C                              HYG+       T  QCSC      L C         +R  V           C + G + D+          K  +  M C+   +   + +N C         C+ +KC   +    ++ NG++ CECP   C  K    VCG+D VTY   C L   AC   K + + + G C E
Sbjct:  461 PCLKKICDFGGTCVVKNGE---AVCECPDA---CPQSQDPVCGNDGHTYSSQCHMRAMGCALQKHISIQHKGPC--------------DKACTNCS---FGAICDAQTGRCVCPTE-CVGSRQPVCGSDGTTYPNECMLNVKACTKQLELRVVAQGECNKITICSKGCWNLYVEMCVCVFDQVCVYMCICNVLIVCVHVSAECGSGGSGSGVEACEQERCRKYGGSWDEDTEDDRCVC---DFTCQN-----VCGSDGQTYDSECELKKTRCEKQVDLLLQSQGPCESKPVSGLITPLHCSETVYGCCEDGKTAALGVELAGCPSKCHCNHYGSYGGTCDPTSGQCSCKPGVGGLRCDRCEPGFWNFRGIVTENTSGCTPCNCDSVGSVRDDCEQMTGLCSCKTGVKGMKCDVCSDGSKMPANGCHKGASAPKSCTELKCL--FGASCVEENGQAHCECPSPDCDQKNKTKVCGSDGVTYADQCQLRTIACRQDKEIIVKHLGQCTE 933          
BLAST of Agrin, putative vs. Ensembl Cavefish
Match: agrn (agrin [Source:ZFIN;Acc:ZDB-GENE-030131-1033])

HSP 1 Score: 251.136 bits (640), Expect = 1.264e-66
Identity = 225/757 (29.72%), Postives = 332/757 (43.86%), Query Frame = 1
Query:  559 CKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQ-ICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENN---PCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQ---MNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAE------NRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKAC-------------IDNKTIRVAPSVIGCISHNYIADEKNKRS------------CLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF----TEN--GCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENS 2688
            C FGA C++ P +P    C C    C        VCGSD   Y + C +++ +C +Q+ I+V     C  K+             C   +C   +TC+ +       C CP   C+    Q +CG+D + Y + CE+   +C   + I  Q+ G CD C+ ++   N  C  + +      +   P + C    + P+C SD  +Y SEC ++  +  K+  L  ++ G CQ   Q   C   +C + A C+   N  A+CSCD + C  T++ P+CG DG  Y N C      C  Q  + V     C+ N   PC    C D    C +  NG++ CECP + CP+   PVCGND  TY S C++    C  +K + I + G C+      +   +C    IC  D    +C CPT    G  + VCG+DG TY +EC + + AC T  + L++   G C+K         +IC     N ++E  C+C  D V V   +C        N   + V   AE         + A  +  C+      DE+             + +CVC   C      VCG+DG  Y++ECELK+  C              ++K +    + + C    Y   E  K +            C CN  GS    CDP++ QC CK G+ G  CDRC  G+WNF    TEN  GCT C+C+  GS    C   TG C+CK    G  C VC  G  +  +GC + +
Sbjct:   60 CGFGAVCERDPADPSKGDCLCKKVPCPL--VVAPVCGSDSSTYTNECELEKAQCSMQRRIKVMRKGPCALKDP------------CNDVTCSYGSTCIQSSDGLSAKCMCPL-SCERVPKQVVCGSDGLDYPSECELNMKACSTQKNIRLQHSGSCDPCRDIQSGLNFTC--LVNAQTRKMETSAPPDSCPPGAE-PLCASDGRSYSSECQMQRTAVLKERHLKKVHSGPCQP--QGKECKE-ECRFSAVCL-LENGRARCSCDPIHCDGTYK-PLCGKDGHTYPNDCERRNAECRTQTHIPVKQQGTCDLNAPSPCLKKIC-DFGGTCVV-KNGEAVCECP-DACPQSQDPVCGNDGHTYSSQCHMRAMGCALQKHISIQHKGPCD------KACTNCSFGAIC--DAQTGRCVCPT-ECVGSRQPVCGSDGTTYPNECMLNVKAC-TKQLELRVVAQGECNK--------ITICSKGCWNLYVE-MCVCVFDQVCVYMCIC--------NVLIVCVHVSAECGSGGSGSGVEACEQERCRKYGGSWDEDT-----------EDDRCVCDFTCQN----VCGSDGQTYDSECELKKTRCEKQVDLLLQSQGPCESKPVSGLITPLHCSETVYGCCEDGKTAALGVELAGCPSKCHCNHYGSYGGTCDPTSGQCSCKPGVGGLRCDRCEPGFWNFRGIVTENTSGCTPCNCDSVGSVRDDCEQMTGLCSCKTGVKGMKCDVCSDGSKMPANGCHKGA 748          

HSP 2 Score: 147.132 bits (370), Expect = 8.160e-35
Identity = 166/745 (22.28%), Postives = 300/745 (40.27%), Query Frame = 1
Query: 2590 TGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWS-GNAENYLSINISLVPYSSD--GIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKP----NCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYC-QTHKPC-----LNGGLCQTSSEEMYSCQCLPGYQGITCEEVV----SHIWKFKDNSFVIFPSESL---QLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK--PVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 4752
             G C+ +P   G  C      +S +    +  ++ E  ++     ++     KSY +      Y ++ I++   +SD  GI+ Y+S   +  D+L++ L    VE + D GSG   + SRVQ+  G+ H ++V R  R++ L +D      G +P     L+      IG     ++  +     V+ G VGC+  L +       +Y + +    ++  + V       C     KN         +    +  N      C  +H PC          C    E  Y C+C  G +G  C +V     ++I  F   S++      L    L+Q++ + +  L   +NG++ +     D    FIS+ L    LE       G   + S E   +  WN V + +A +   +N+N             G   V      +     +K + ++ GG    +  + +    LK  F GAIQKI +    I    + +  ++++ +   PC              G CVP ++   C C         +++  ++  A  +    + G++  +Y     K +K+   N   +  KT +  G+++   K          +AI +G +++  +LG K  VLR T    ++ N+W  ++  R  R+  L + +    A +  ++      L TDG +WLGG ++       P  Y+T F GC+ ++ VD +  +LV DA  N   IL C
Sbjct: 1181 AGPCDSQPCGHGGTCEEIRDDFSCTCPAGRGGAVCEKMINY----YIPSFGGKSYLAFPTMRAYHTVRIAMEFRASDMSGILLYNSQNGKK-DFLSLALVGGKVELKFDTGSGICSVVSRVQIKPGQWHHLVVNRNRRNAALSVDNEPPVEGQSPTGTDGLNLETHLYIGGVPEDMVQDVKERTSVSAGLVGCIRQLDVN----NMVYNLQENGGNVLFGTAVGECGNNPCSPNPCKNGASCHTKGAEMFHCKCVNAFSGPTCADSHNPCEPNPCHPSSQCAILPEGGYKCECPMGREGKHCRKVSEKKGAYIPYFDGESYLELKGLHLYNHDLKQKVSMTVVLLANDSNGMIFYNGQKTDGKGDFISLALIGGILEFRYDLGKGPAVIRSKEKIKLNVWNTVNLERAQRKGEINVN-------------GKDPVRGESPNQHNDLNLK-ESLYVGGAPDFSKVARAAS--LKSGFKGAIQKITVMGTQILKPENALHSSDVSMYSHHPCS------GDVCHNGGECVPMLDSYECVCPYGFTGAQCQHAT-YEKAAGESEAIAFDGRTFIEYHNGVTKSEKALLVNKFELSIKTEATHGLILWSGKGVERSDYI-ALAIVDGRVQMTYDLGSKPVVLRST--VRVNTNRWIRIKASRALRDGSLQVGNE---AAVTGSSPLAATQLDTDGALWLGGLEELSVARRLPKAYSTGFMGCVKDVIVDGVDLHLVEDAL-NSPKILHC 1886          

HSP 3 Score: 103.99 bits (258), Expect = 1.241e-21
Identity = 168/634 (26.50%), Postives = 227/634 (35.80%), Query Frame = 1
Query:  550 KLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVT-NPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKC-QTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEP--------RCKEQGKDCPSYQICKSDLVQA----------KCEC-------PTC-PQSGLGESVCGTDGKTYKSECHMRMHACET---NSIALKIANIGTCDKCK-NKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKV---KSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVC----TDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRV 2334
            K  C+F A C    G    A C C    C    K +  CG DG  Y + C  +  EC  Q  I V           QQ     +    C  + C    TCV  N    C+CP D C  S   +CG D  TY++ C M+ + C   + I  Q+ G CD      C F  IC    D     C CP     C  + Q PVCGSD  TY +EC L +++C K++ L V+ +G+C +  I S  C N+       C+     V  C C+ L               I+    C  +   C        + +  CE   C            +   +     E  +  C    Q VCG+D  TY+S C L +T C  +  L +   G C  +P         C E       Y  C+     A          KC C        TC P SG      G  G        +R   CE    N   +   N   C  C  +   S    C+    L   C C T    ++  VC    +   N C       KSC E + +   S               C E+        NGQ  C     D   K K +VCG+DG  Y ++C+L+  AC  +K I V
Sbjct:  280 KEECRFSAVCLLENGR---ARCSCDPIHCDGTYKPL--CGKDGHTYPNDCERRNAECRTQTHIPVK----------QQGTCDLNAPSPCLKKICDFGGTCVVKNGEAVCECP-DACPQSQDPVCGNDGHTYSSQCHMRAMGCALQKHISIQHKGPCDK-ACTNCSFGAIC----DAQTGRCVCPTE---CVGSRQ-PVCGSDGTTYPNECMLNVKACTKQLELRVVAQGECNKITICSKGCWNLYVEM-CVCVFDQVCVYMCICNVL---------------IV----CVHVSAECGSGGSGSGVEA--CEQERCR-----------KYGGSWDEDTEDDRCVCDFTCQNVCGSDGQTYDSECELKKTRCEKQVDLLLQSQGPCESKPVSGLITPLHCSET-----VYGCCEDGKTAALGVELAGCPSKCHCNHYGSYGGTCDPTSGQCSCKPGVGG--------LRCDRCEPGFWNFRGIVTENTSGCTPCNCDSVGSVRDDCEQMTGL---CSCKTGVKGMKCDVCSDGSKMPANGCHKGASAPKSCTELKCLFGAS---------------CVEE--------NGQAHCECPSPDCDQKNKTKVCGSDGVTYADQCQLRTIACRQDKEIIV 816          

HSP 4 Score: 80.4925 bits (197), Expect = 1.771e-14
Identity = 124/507 (24.46%), Postives = 173/507 (34.12%), Query Frame = 1
Query:  541 PCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKAN---RFIEQQYVGRCDIC---------KFVKCEFNGICEMM-----------------------------------------EDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQC------------------------------HYGAKCIKTSNTVAQCSC----DYLDCKN------TWRDPV-----------CGNDGIIYDN----------KCFLMKMSCEKQMEMHVINSNFCENNP-----CSGVKCPDPYQYCRIDNNGKSTCECPKEPC-PKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNE 1701
            PC K  C FG  C    G    AVC C +      Q +  VCG+DG  Y S C M+   C LQK I +     C +        + S    C  Q+              C CP + C  S   +CG+D  TY N C +   +C      R + Q    +  IC         +   C F+ +C  M                                         ED     C C   D  C       VCGSD  TY SEC LK   C+K++ L +  +G C++K  S + + + C                              HYG+       T  QCSC      L C         +R  V           C + G + D+          K  +  M C+   +   + +N C         C+ +KC   +    ++ NG++ CECP   C  K    VCG+D VTY   C L   AC   K + + + G C E
Sbjct:  352 PCLKKICDFGGTCVVKNGE---AVCECPDA---CPQSQDPVCGNDGHTYSSQCHMRAMGCALQKHISIQHKGPCDKA-----CTNCSFGAICDAQT------------GRCVCPTE-CVGSRQPVCGSDGTTYPNECMLNVKACTKQLELRVVAQGECNKITICSKGCWNLYVEMCVCVFDQVCVYMCICNVLIVCVHVSAECGSGGSGSGVEACEQERCRKYGGSWDEDTEDDRCVC---DFTCQN-----VCGSDGQTYDSECELKKTRCEKQVDLLLQSQGPCESKPVSGLITPLHCSETVYGCCEDGKTAALGVELAGCPSKCHCNHYGSYGGTCDPTSGQCSCKPGVGGLRCDRCEPGFWNFRGIVTENTSGCTPCNCDSVGSVRDDCEQMTGLCSCKTGVKGMKCDVCSDGSKMPANGCHKGASAPKSCTELKCL--FGASCVEENGQAHCECPSPDCDQKNKTKVCGSDGVTYADQCQLRTIACRQDKEIIVKHLGQCTE 824          
BLAST of Agrin, putative vs. Ensembl Cavefish
Match: agrn (agrin [Source:ZFIN;Acc:ZDB-GENE-030131-1033])

HSP 1 Score: 250.366 bits (638), Expect = 1.851e-66
Identity = 225/757 (29.72%), Postives = 332/757 (43.86%), Query Frame = 1
Query:  559 CKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQ-ICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENN---PCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQ---MNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAE------NRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKAC-------------IDNKTIRVAPSVIGCISHNYIADEKNKRS------------CLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF----TEN--GCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENS 2688
            C FGA C++ P +P    C C    C        VCGSD   Y + C +++ +C +Q+ I+V     C  K+             C   +C   +TC+ +       C CP   C+    Q +CG+D + Y + CE+   +C   + I  Q+ G CD C+ ++   N  C  + +      +   P + C    + P+C SD  +Y SEC ++  +  K+  L  ++ G CQ   Q   C   +C + A C+   N  A+CSCD + C  T++ P+CG DG  Y N C      C  Q  + V     C+ N   PC    C D    C +  NG++ CECP + CP+   PVCGND  TY S C++    C  +K + I + G C+      +   +C    IC  D    +C CPT    G  + VCG+DG TY +EC + + AC T  + L++   G C+K         +IC     N ++E  C+C  D V V   +C        N   + V   AE         + A  +  C+      DE+             + +CVC   C      VCG+DG  Y++ECELK+  C              ++K +    + + C    Y   E  K +            C CN  GS    CDP++ QC CK G+ G  CDRC  G+WNF    TEN  GCT C+C+  GS    C   TG C+CK    G  C VC  G  +  +GC + +
Sbjct:   35 CGFGAVCERDPADPSKGDCLCKKVPCPL--VVAPVCGSDSSTYTNECELEKAQCSMQRRIKVMRKGPCALKDP------------CNDVTCSYGSTCIQSSDGLSAKCMCPL-SCERVPKQVVCGSDGLDYPSECELNMKACSTQKNIRLQHSGSCDPCRDIQSGLNFTC--LVNAQTRKMETSAPPDSCPPGAE-PLCASDGRSYSSECQMQRTAVLKERHLKKVHSGPCQP--QGKECKE-ECRFSAVCL-LENGRARCSCDPIHCDGTYK-PLCGKDGHTYPNDCERRNAECRTQTHIPVKQQGTCDLNAPSPCLKKIC-DFGGTCVV-KNGEAVCECP-DACPQSQDPVCGNDGHTYSSQCHMRAMGCALQKHISIQHKGPCD------KACTNCSFGAIC--DAQTGRCVCPT-ECVGSRQPVCGSDGTTYPNECMLNVKAC-TKQLELRVVAQGECNK--------ITICSKGCWNLYVE-MCVCVFDQVCVYMCIC--------NVLIVCVHVSAECGSGGSGSGVEACEQERCRKYGGSWDEDT-----------EDDRCVCDFTCQN----VCGSDGQTYDSECELKKTRCEKQVDLLLQSQGPCESKPVSGLITPLHCSETVYGCCEDGKTAALGVELAGCPSKCHCNHYGSYGGTCDPTSGQCSCKPGVGGLRCDRCEPGFWNFRGIVTENTSGCTPCNCDSVGSVRDDCEQMTGLCSCKTGVKGMKCDVCSDGSKMPANGCHKGA 723          

HSP 2 Score: 147.132 bits (370), Expect = 7.382e-35
Identity = 166/745 (22.28%), Postives = 300/745 (40.27%), Query Frame = 1
Query: 2590 TGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWS-GNAENYLSINISLVPYSSD--GIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKP----NCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYC-QTHKPC-----LNGGLCQTSSEEMYSCQCLPGYQGITCEEVV----SHIWKFKDNSFVIFPSESL---QLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK--PVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 4752
             G C+ +P   G  C      +S +    +  ++ E  ++     ++     KSY +      Y ++ I++   +SD  GI+ Y+S   +  D+L++ L    VE + D GSG   + SRVQ+  G+ H ++V R  R++ L +D      G +P     L+      IG     ++  +     V+ G VGC+  L +       +Y + +    ++  + V       C     KN         +    +  N      C  +H PC          C    E  Y C+C  G +G  C +V     ++I  F   S++      L    L+Q++ + +  L   +NG++ +     D    FIS+ L    LE       G   + S E   +  WN V + +A +   +N+N             G   V      +     +K + ++ GG    +  + +    LK  F GAIQKI +    I    + +  ++++ +   PC              G CVP ++   C C         +++  ++  A  +    + G++  +Y     K +K+   N   +  KT +  G+++   K          +AI +G +++  +LG K  VLR T    ++ N+W  ++  R  R+  L + +    A +  ++      L TDG +WLGG ++       P  Y+T F GC+ ++ VD +  +LV DA  N   IL C
Sbjct: 1156 AGPCDSQPCGHGGTCEEIRDDFSCTCPAGRGGAVCEKMINY----YIPSFGGKSYLAFPTMRAYHTVRIAMEFRASDMSGILLYNSQNGKK-DFLSLALVGGKVELKFDTGSGICSVVSRVQIKPGQWHHLVVNRNRRNAALSVDNEPPVEGQSPTGTDGLNLETHLYIGGVPEDMVQDVKERTSVSAGLVGCIRQLDVN----NMVYNLQENGGNVLFGTAVGECGNNPCSPNPCKNGASCHTKGAEMFHCKCVNAFSGPTCADSHNPCEPNPCHPSSQCAILPEGGYKCECPMGREGKHCRKVSEKKGAYIPYFDGESYLELKGLHLYNHDLKQKVSMTVVLLANDSNGMIFYNGQKTDGKGDFISLALIGGILEFRYDLGKGPAVIRSKEKIKLNVWNTVNLERAQRKGEINVN-------------GKDPVRGESPNQHNDLNLK-ESLYVGGAPDFSKVARAAS--LKSGFKGAIQKITVMGTQILKPENALHSSDVSMYSHHPCS------GDVCHNGGECVPMLDSYECVCPYGFTGAQCQHAT-YEKAAGESEAIAFDGRTFIEYHNGVTKSEKALLVNKFELSIKTEATHGLILWSGKGVERSDYI-ALAIVDGRVQMTYDLGSKPVVLRST--VRVNTNRWIRIKASRALRDGSLQVGNE---AAVTGSSPLAATQLDTDGALWLGGLEELSVARRLPKAYSTGFMGCVKDVIVDGVDLHLVEDAL-NSPKILHC 1861          

HSP 3 Score: 103.605 bits (257), Expect = 1.578e-21
Identity = 168/634 (26.50%), Postives = 227/634 (35.80%), Query Frame = 1
Query:  550 KLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVT-NPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKC-QTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEP--------RCKEQGKDCPSYQICKSDLVQA----------KCEC-------PTC-PQSGLGESVCGTDGKTYKSECHMRMHACET---NSIALKIANIGTCDKCK-NKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKV---KSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVC----TDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRV 2334
            K  C+F A C    G    A C C    C    K +  CG DG  Y + C  +  EC  Q  I V           QQ     +    C  + C    TCV  N    C+CP D C  S   +CG D  TY++ C M+ + C   + I  Q+ G CD      C F  IC    D     C CP     C  + Q PVCGSD  TY +EC L +++C K++ L V+ +G+C +  I S  C N+       C+     V  C C+ L               I+    C  +   C        + +  CE   C            +   +     E  +  C    Q VCG+D  TY+S C L +T C  +  L +   G C  +P         C E       Y  C+     A          KC C        TC P SG      G  G        +R   CE    N   +   N   C  C  +   S    C+    L   C C T    ++  VC    +   N C       KSC E + +   S               C E+        NGQ  C     D   K K +VCG+DG  Y ++C+L+  AC  +K I V
Sbjct:  255 KEECRFSAVCLLENGR---ARCSCDPIHCDGTYKPL--CGKDGHTYPNDCERRNAECRTQTHIPVK----------QQGTCDLNAPSPCLKKICDFGGTCVVKNGEAVCECP-DACPQSQDPVCGNDGHTYSSQCHMRAMGCALQKHISIQHKGPCDK-ACTNCSFGAIC----DAQTGRCVCPTE---CVGSRQ-PVCGSDGTTYPNECMLNVKACTKQLELRVVAQGECNKITICSKGCWNLYVEM-CVCVFDQVCVYMCICNVL---------------IV----CVHVSAECGSGGSGSGVEA--CEQERCR-----------KYGGSWDEDTEDDRCVCDFTCQNVCGSDGQTYDSECELKKTRCEKQVDLLLQSQGPCESKPVSGLITPLHCSET-----VYGCCEDGKTAALGVELAGCPSKCHCNHYGSYGGTCDPTSGQCSCKPGVGG--------LRCDRCEPGFWNFRGIVTENTSGCTPCNCDSVGSVRDDCEQMTGL---CSCKTGVKGMKCDVCSDGSKMPANGCHKGASAPKSCTELKCLFGAS---------------CVEE--------NGQAHCECPSPDCDQKNKTKVCGSDGVTYADQCQLRTIACRQDKEIIV 791          

HSP 4 Score: 80.1073 bits (196), Expect = 2.038e-14
Identity = 123/507 (24.26%), Postives = 173/507 (34.12%), Query Frame = 1
Query:  541 PCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKAN---RFIEQQYVGRCDIC---------KFVKCEFNGICEMM-----------------------------------------EDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQC------------------------------HYGAKCIKTSNTVAQCSC----DYLDCKN------TWRDPV-----------CGNDGIIYDN----------KCFLMKMSCEKQMEMHVINSNFCENNP-----CSGVKCPDPYQYCRIDNNGKSTCECPKEPC-PKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNE 1701
            PC K  C FG  C    G    AVC C +      Q +  VCG+DG  Y S C M+   C LQK I +     C              ++ C + S   +          C CP + C  S   +CG+D  TY N C +   +C      R + Q    +  IC         +   C F+ +C  M                                         ED     C C   D  C       VCGSD  TY SEC LK   C+K++ L +  +G C++K  S + + + C                              HYG+       T  QCSC      L C         +R  V           C + G + D+          K  +  M C+   +   + +N C         C+ +KC   +    ++ NG++ CECP   C  K    VCG+D VTY   C L   AC   K + + + G C E
Sbjct:  327 PCLKKICDFGGTCVVKNGE---AVCECPDA---CPQSQDPVCGNDGHTYSSQCHMRAMGCALQKHISIQHKGPC--------------DKACTNCS---FGAICDAQTGRCVCPTE-CVGSRQPVCGSDGTTYPNECMLNVKACTKQLELRVVAQGECNKITICSKGCWNLYVEMCVCVFDQVCVYMCICNVLIVCVHVSAECGSGGSGSGVEACEQERCRKYGGSWDEDTEDDRCVC---DFTCQN-----VCGSDGQTYDSECELKKTRCEKQVDLLLQSQGPCESKPVSGLITPLHCSETVYGCCEDGKTAALGVELAGCPSKCHCNHYGSYGGTCDPTSGQCSCKPGVGGLRCDRCEPGFWNFRGIVTENTSGCTPCNCDSVGSVRDDCEQMTGLCSCKTGVKGMKCDVCSDGSKMPANGCHKGASAPKSCTELKCL--FGASCVEENGQAHCECPSPDCDQKNKTKVCGSDGVTYADQCQLRTIACRQDKEIIVKHLGQCTE 799          

HSP 5 Score: 73.559 bits (179), Expect = 2.065e-12
Identity = 54/149 (36.24%), Postives = 75/149 (50.34%), Query Frame = 1
Query: 1933 KNKKCSFYSICQMNRFLEPQ---CIC-PTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPE-DCPLGKMC------RNGQCVCTDKCSKV-KLRVCGTDGNYYENECELKRKACIDNKTIRVAPS 2343
            + K C F ++C+ +   +P    C+C    C  V  PVCGSD  TY NEC L+   C+  R I  + +GPC L+      + C +  C  G  C       + +C+C   C +V K  VCG+DG  Y +ECEL  KAC   K IR+  S
Sbjct:   31 RGKLCGFGAVCERDP-ADPSKGDCLCKKVPCPLVVAPVCGSDSSTYTNECELEKAQCSMQRRIKVMRKGPCALK------DPCNDVTCSYGSTCIQSSDGLSAKCMCPLSCERVPKQVVCGSDGLDYPSECELNMKACSTQKNIRLQHS 172          
BLAST of Agrin, putative vs. Ensembl Cavefish
Match: EGFLAM (EGF like, fibronectin type III and laminin G domains [Source:HGNC Symbol;Acc:HGNC:26810])

HSP 1 Score: 130.183 bits (326), Expect = 6.500e-30
Identity = 138/633 (21.80%), Postives = 252/633 (39.81%), Query Frame = 1
Query: 2809 SSDGIIFYHSDTDRS-SDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSHIWKFKDNSFVIF-----PSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTD-PEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXV-IAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISEL 4683
            S DG++ Y  + D+   D+ ++ L    + +R + G+GA  + ++  + +G  +++ V R      L +D      G +    T +       +G +  P +  L+     + GF GC+ SL +                                    +D+   P     S  +  +  D   T   C NGG+C  +  + Y C C  GY+G  C+E  S      + + + +     P  +       + E+TFLP A +G L +  D   R+  F+SV + + H+E       G   + S E   + +W+ + + + A+   L L++        L P     V  +     TQ R  + P++ GGV +      S  V L   F G+IQK+ +ND  +R   + +   N+        G    PC+ +     G C P+ +   C C      L  R        +      ++ G+S   Y +    +  S  + +++++F++++ DG+L+ +        S  + +A+  G +  + NLG     LR+ G     D +WHTV+ +R+ +   L +     R           L T G +++GG K+    F   Y     GC+S L
Sbjct:  295 SEDGLLLYCGENDQGEGDFASLALIRGKLHFRYNCGTGAAQIAAQSPVKLGVWYTVTVYREGLSGWLRVDNDTPVTGRSQGEFTKITFRTPLYLGGS--PAVYWLARAAGTSRGFQGCVQSLAVNG--------------------------------RMIDMRPWPLGRALSGADVGECSDGVCTDVSCENGGVCYANRADGYICLCPLGYRGPLCQETFSLFLPHFNAALMPYLSAPWPRPAQYYLSFTEFEMTFLPEAFDGTLLYSEDLDSRD--FLSVVMVEGHVEFRFDCGSGTATIKSEEPVSLFRWHELRVSRTARRGILQLDN--------LRP-----VEGMAEGAFTQIRCSS-PLYIGGVPNYNLVKNSASVLLP--FTGSIQKVTVNDRVVRLTAASVKGVNV--------GNAVHPCADSLCANAGVCRPKHDGYECDCP-----LGYRGKHCQSADSGAVEIPQFTGRSYLMYDSKDILKRISGPRTHVQLRFRSSAQDGLLMWIGDTNMRHNSDYMFLALHGGTVVFSYNLGSGTNTLRVNG--TFIDGRWHTVRAVRDGQMGKLSVGSSTTRVGK-SPGRMRQLNTSGALYIGGIKE--ASFHIPYLRGLVGCMSHL 857          

HSP 2 Score: 85.1149 bits (209), Expect = 4.170e-16
Identity = 94/403 (23.33%), Postives = 169/403 (41.94%), Query Frame = 1
Query: 2629 YCSVCPIGYSISNHGCKEN-SIYENKVDAVELGFLKDSFAKSYWSGNAENYLSIN---ISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVS---HIWKFKDNSFVIFPSESLQLR---QRLKLEITFLPLANNGLLSFISDGHDR-NPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKK 3804
            Y  +CP+GY      C+E  S++    +A  + +L      + W   A+ YLS     ++ +P + DG + Y  D D S D+L++V+   +VE+R D GSG   +KS   +++ R H + V R  R   L +D      GM     T +       IG    P  N + ++  V   F G +   K+T  +              + +++VK     ++  N+V    D                       C N G+C+    + Y C C  GY+G  C+   S    I +F   S++++ S+ +  R    R  +++ F   A +GLL +I D + R N  ++ + L+   +  +     G   L    + + G+W+ V  ++  +   L++  S   + K
Sbjct:  464 YICLCPLGYR--GPLCQETFSLFLPHFNAALMPYLS-----APWPRPAQYYLSFTEFEMTFLPEAFDGTLLYSEDLD-SRDFLSVVMVEGHVEFRFDCGSGTATIKSEEPVSLFRWHELRVSRTARRGILQLDNLRPVEGMAEGAFTQIRCSSPLYIGGV--PNYNLVKNSASVLLPFTGSIQ--KVTVNDRVV----------RLTAASVK----GVNVGNAVHPCAD---------------------SLCANAGVCR-PKHDGYECDCPLGYRGKHCQSADSGAVEIPQFTGRSYLMYDSKDILKRISGPRTHVQLRFRSSAQDGLLMWIGDTNMRHNSDYMFLALHGGTVVFSYNLGSGTNTLRVNGTFIDGRWHTVRAVRDGQMGKLSVGSSTTRVGK 818          
BLAST of Agrin, putative vs. Ensembl Cavefish
Match: EGFLAM (EGF like, fibronectin type III and laminin G domains [Source:HGNC Symbol;Acc:HGNC:26810])

HSP 1 Score: 130.183 bits (326), Expect = 7.824e-30
Identity = 138/633 (21.80%), Postives = 252/633 (39.81%), Query Frame = 1
Query: 2809 SSDGIIFYHSDTDRS-SDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSHIWKFKDNSFVIF-----PSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTD-PEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXV-IAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISEL 4683
            S DG++ Y  + D+   D+ ++ L    + +R + G+GA  + ++  + +G  +++ V R      L +D      G +    T +       +G +  P +  L+     + GF GC+ SL +                                    +D+   P     S  +  +  D   T   C NGG+C  +  + Y C C  GY+G  C+E  S      + + + +     P  +       + E+TFLP A +G L +  D   R+  F+SV + + H+E       G   + S E   + +W+ + + + A+   L L++        L P     V  +     TQ R  + P++ GGV +      S  V L   F G+IQK+ +ND  +R   + +   N+        G    PC+ +     G C P+ +   C C      L  R        +      ++ G+S   Y +    +  S  + +++++F++++ DG+L+ +        S  + +A+  G +  + NLG     LR+ G     D +WHTV+ +R+ +   L +     R           L T G +++GG K+     P  Y     GC+S L
Sbjct:  383 SEDGLLLYCGENDQGEGDFASLALIRGKLHFRYNCGTGAAQIAAQSPVKLGVWYTVTVYREGLSGWLRVDNDTPVTGRSQGEFTKITFRTPLYLGGS--PAVYWLARAAGTSRGFQGCVQSLAVNG--------------------------------RMIDMRPWPLGRALSGADVGECSDGVCTDVSCENGGVCYANRADGYICLCPLGYRGPLCQETFSLFLPHFNAALMPYLSAPWPRPAQYYLSFTEFEMTFLPEAFDGTLLYSEDLDSRD--FLSVVMVEGHVEFRFDCGSGTATIKSEEPVSLFRWHELRVSRTARRGILQLDN--------LRP-----VEGMAEGAFTQIRCSS-PLYIGGVPNYNLVKNSASVLLP--FTGSIQKVTVNDRVVRLTAASVKGVNV--------GNAVHPCADSLCANAGVCRPKHDGYECDCP-----LGYRGKHCQSADSGAVEIPQFTGRSYLMYDSKDILKRISGPRTHVQLRFRSSAQDGLLMWIGDTNMRHNSDYMFLALHGGTVVFSYNLGSGTNTLRVNG--TFIDGRWHTVRAVRDGQMGKLSVGSSTTRVGK-SPGRMRQLNTSGALYIGGIKEASFHIP--YLRGLVGCMSHL 945          

HSP 2 Score: 85.1149 bits (209), Expect = 5.039e-16
Identity = 94/403 (23.33%), Postives = 169/403 (41.94%), Query Frame = 1
Query: 2629 YCSVCPIGYSISNHGCKEN-SIYENKVDAVELGFLKDSFAKSYWSGNAENYLSIN---ISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVS---HIWKFKDNSFVIFPSESLQLR---QRLKLEITFLPLANNGLLSFISDGHDR-NPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKK 3804
            Y  +CP+GY      C+E  S++    +A  + +L      + W   A+ YLS     ++ +P + DG + Y  D D S D+L++V+   +VE+R D GSG   +KS   +++ R H + V R  R   L +D      GM     T +       IG    P  N + ++  V   F G +   K+T  +              + +++VK     ++  N+V    D                       C N G+C+    + Y C C  GY+G  C+   S    I +F   S++++ S+ +  R    R  +++ F   A +GLL +I D + R N  ++ + L+   +  +     G   L    + + G+W+ V  ++  +   L++  S   + K
Sbjct:  552 YICLCPLGYR--GPLCQETFSLFLPHFNAALMPYLS-----APWPRPAQYYLSFTEFEMTFLPEAFDGTLLYSEDLD-SRDFLSVVMVEGHVEFRFDCGSGTATIKSEEPVSLFRWHELRVSRTARRGILQLDNLRPVEGMAEGAFTQIRCSSPLYIGGV--PNYNLVKNSASVLLPFTGSIQ--KVTVNDRVV----------RLTAASVK----GVNVGNAVHPCAD---------------------SLCANAGVCR-PKHDGYECDCPLGYRGKHCQSADSGAVEIPQFTGRSYLMYDSKDILKRISGPRTHVQLRFRSSAQDGLLMWIGDTNMRHNSDYMFLALHGGTVVFSYNLGSGTNTLRVNGTFIDGRWHTVRAVRDGQMGKLSVGSSTTRVGK 906          
BLAST of Agrin, putative vs. Ensembl Sea Lamprey
Match: FST (follistatin [Source:HGNC Symbol;Acc:HGNC:3971])

HSP 1 Score: 93.9745 bits (232), Expect = 1.423e-21
Identity = 74/236 (31.36%), Postives = 107/236 (45.34%), Query Frame = 1
Query: 1258 DICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCE-CPKEPCPK---------IVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECP----TCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTC 1923
            + C N+ C  G +C  +     +C C   DC N  R  VCG DG  Y + C L+K  C+ Q  + +     C+ N C  V+CP    +C +D N  + C  C   PCP            Q VCG D VTY S+C+L R  CL  K + + Y G C++   C +    C S + C  D  +    C      C  +   E VC T+  TY + C M   AC ++ + L++ + G C
Sbjct:    1 ETCDNVDCGPGKQCRMSRRNKPRCVC-APDCSNASRASVCGTDGKTYRDGCALLKARCKGQPNLEMQYHGPCQKN-CKDVQCPS-GTFCVVDQNNNAHCVLCNLRPCPAESGQGEQQQQQQHVCGKDGVTYASVCHLRRATCLLGKSIGVAYQGRCSKSKSCDDV--LCGSGKKCLWDPAEGGPHCAQCNDICRDAKRMEPVCATNNNTYPNACAMGNAAC-SSGVYLEVKHTGYC 230          

HSP 2 Score: 83.5741 bits (205), Expect = 5.959e-18
Identity = 67/215 (31.16%), Postives = 99/215 (46.05%), Query Frame = 1
Query:  865 PYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDI-CKFVKCEFNGICEMMEDGLGTICKC---PNPDE---LCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCI----KTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCE 1476
            P C C  D  ++S + +CGTD  TY + C + K  CK    +E QY G C   CK V+C     C + ++       C   P P E      +  Q  VCG D VTY S CHL+  +C    S+ V Y+G+C    +S  C ++ C  G KC+    +     AQC+    D K    +PVC  +   Y N C +   +C   + + V ++ +C 
Sbjct:   22 PRCVCAPDCSNASRASVCGTDGKTYRDGCALLKARCKGQPNLEMQYHGPCQKNCKDVQCPSGTFCVVDQNNNAHCVLCNLRPCPAESGQGEQQQQQQHVCGKDGVTYASVCHLRRATCLLGKSIGVAYQGRCS---KSKSCDDVLCGSGKKCLWDPAEGGPHCAQCNDICRDAKRM--EPVCATNNNTYPNACAMGNAACSSGVYLEVKHTGYCS 231          

HSP 3 Score: 62.003 bits (149), Expect = 1.277e-10
Identity = 65/250 (26.00%), Postives = 100/250 (40.00%), Query Frame = 1
Query:  544 CSKLNCKFGAQCQKWPGNPPTAVC--HCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVT--NPYPYC------KCPNDK----CDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCD---ICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQV-PVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKC 1239
            C  ++C  G QC+    N P  VC   CSN          SVCG+DG  Y   C + +  C  Q ++           E Q  G  + N   C+   CP    CV   N   +C       CP +            +CG D +TY ++C +++ +C   + I   Y GRC     C  V C     C  + D       C   +++C    ++ PVC +++ TY + C +   +C   + L V + G C
Sbjct:    3 CDNVDCGPGKQCRMSRRNKPRCVCAPDCSNAS------RASVCGTDGKTYRDGCALLKARCKGQPNL-----------EMQYHGPCQKN---CKDVQCPSGTFCVVDQNNNAHCVLCNLRPCPAESGQGEQQQQQQHVCGKDGVTYASVCHLRRATCLLGKSIGVAYQGRCSKSKSCDDVLCGSGKKC--LWDPAEGGPHCAQCNDICRDAKRMEPVCATNNNTYPNACAMGNAACSSGVYLEVKHTGYC 230          

HSP 4 Score: 61.2326 bits (147), Expect = 2.572e-10
Identity = 57/211 (27.01%), Postives = 87/211 (41.23%), Query Frame = 1
Query: 1102 PDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCS-CDYLDCK--------NTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFC-ENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPC--PKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICN 1698
            PD  C+   +  VCG+D  TY+  C L    CK + +L + Y G CQ       C ++QC  G  C+   N  A C  C+   C            +  VCG DG+ Y + C L + +C     + V     C ++  C  V C    +       G   C    + C   K ++PVC  +  TY + C +   AC +   L + + G C+
Sbjct:   28 PD--CSNASRASVCGTDGKTYRDGCALLKARCKGQPNLEMQYHGPCQKN-----CKDVQCPSGTFCVVDQNNNAHCVLCNLRPCPAESGQGEQQQQQQHVCGKDGVTYASVCHLRRATCLLGKSIGVAYQGRCSKSKSCDDVLCGSGKKCLWDPAEGGPHCAQCNDICRDAKRMEPVCATNNNTYPNACAMGNAACSSGVYLEVKHTGYCS 231          

HSP 5 Score: 56.225 bits (134), Expect = 1.145e-8
Identity = 66/234 (28.21%), Postives = 89/234 (38.03%), Query Frame = 1
Query: 1486 CSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAK----CECPTCPQSGLGES-------VCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDK---CKNKKCSFYSICQMNRFLE-PQCI-CPTDCVYVRR--PVCGSDDRTYENECFLKVKSCAENRLITAVSEGPC 2133
            C  V C  P + CR+    K  C C  +        VCG D  TY   C L +  C  +  L + Y+G C +   CK+    CPS   C  D         C    CP              VCG DG TY S CH+R   C     ++ +A  G C K   C +  C     C  +     P C  C   C   +R  PVC +++ TY N C +   +C+    +     G C
Sbjct:    3 CDNVDC-GPGKQCRMSRRNKPRCVCAPDCSNASRASVCGTDGKTYRDGCALLKARCKGQPNLEMQYHGPCQKN--CKDV--QCPSGTFCVVDQNNNAHCVLCNLRPCPAESGQGEQQQQQQHVCGKDGVTYASVCHLRRATCLLGK-SIGVAYQGRCSKSKSCDDVLCGSGKKCLWDPAEGGPHCAQCNDICRDAKRMEPVCATNNNTYPNACAMGNAACSSGVYLEVKHTGYC 230          

HSP 6 Score: 56.225 bits (134), Expect = 1.200e-8
Identity = 46/156 (29.49%), Postives = 67/156 (42.95%), Query Frame = 1
Query: 1924 DKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRP-VCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPE-DCPLGKMC-----RNGQCVCTD-----------KCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVA 2337
            + C N  C     C+M+R  +P+C+C  DC    R  VCG+D +TY + C L    C     +     GPC        ++ C +  CP G  C      N  CV  +           +  + +  VCG DG  Y + C L+R  C+  K+I VA
Sbjct:    1 ETCDNVDCGPGKQCRMSRRNKPRCVCAPDCSNASRASVCGTDGKTYRDGCALLKARCKGQPNLEMQYHGPC--------QKNCKDVQCPSGTFCVVDQNNNAHCVLCNLRPCPAESGQGEQQQQQQHVCGKDGVTYASVCHLRRATCLLGKSIGVA 148          

HSP 7 Score: 48.521 bits (114), Expect = 3.677e-6
Identity = 53/192 (27.60%), Postives = 80/192 (41.67%), Query Frame = 1
Query: 1816 SVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDK-CKNKKCSFYSICQMNRFLEPQCI------CPTDCVYVRRP-----VCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQ-----FIKPDEERCPEDCPL--GKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRV 2334
            SVCGTDGKTY+  C +    C+     L++   G C K CK+ +C   + C +++     C+      CP +     +      VCG D  TY + C L+  +C   + I    +G C         +    ++C  D P   G  C     +C D  +K    VC T+ N Y N C +   AC     + V
Sbjct:   37 SVCGTDGKTYRDGCALLKARCKGQP-NLEMQYHGPCQKNCKDVQCPSGTFCVVDQNNNAHCVLCNLRPCPAESGQGEQQQQQQHVCGKDGVTYASVCHLRRATCLLGKSIGVAYQGRCSKSKSCDDVLCGSGKKCLWD-PAEGGPHCAQCNDICRD--AKRMEPVCATNNNTYPNACAMGNAACSSGVYLEV 224          
BLAST of Agrin, putative vs. Ensembl Sea Lamprey
Match: tmeff2a (transmembrane protein with EGF-like and two follistatin-like domains 2a [Source:ZFIN;Acc:ZDB-GENE-070912-622])

HSP 1 Score: 67.3958 bits (163), Expect = 4.798e-12
Identity = 40/125 (32.00%), Postives = 65/125 (52.00%), Query Frame = 1
Query: 1132 VPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQ-----------------CHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHV 1455
            VPVCGSD ++YQ+ECHL+  +C+ +  +T    G C T++ S   +                    C YG++C + +  +  C C+ +DC     +PVC +DG+ Y+N C + + SC KQ  + V
Sbjct:    7 VPVCGSDGLSYQNECHLRQTACRLQRIITQAAPGPCYTELGSGSSNGADYEGSGSEHYRKSTKCGICLYGSECDEDAEDIG-CVCN-IDCTGHNSNPVCASDGVSYENPCLVKEASCMKQQLIEV 129          

HSP 2 Score: 54.6842 bits (130), Expect = 6.069e-8
Identity = 56/202 (27.72%), Postives = 80/202 (39.60%), Query Frame = 1
Query: 2029 PVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIK-----PDEERCPED----------CPLGKMCRNGQ----CVCTDKCSKVKLR-VCGTDGNYYENECELKRKACIDNKTIRVA------PSVIGCISHNYIA-------DEKNKRSCLCNSIGSL----------NHECDPSTTQ----CICKTGITGQYCD 2493
            PVCGSD  +Y+NEC L+  +C   R+IT  + GPC  +         D E    +          C  G  C        CVC   C+      VC +DG  YEN C +K  +C+  + I V       P++  C   ++I          +++   +    G L          N +C  S TQ    CIC  G  GQ C+
Sbjct:    8 PVCGSDGLSYQNECHLRQTACRLQRIITQAAPGPCYTELGSGSSNGADYEGSGSEHYRKSTKCGICLYGSECDEDAEDIGCVCNIDCTGHNSNPVCASDGVSYENPCLVKEASCMKQQLIEVRFLGKCNPALCVCTVWDHIYLMSTDYNSTRDQEEPVVRDRGELCPESLQNYCRNGQCHYSHTQRHASCICDPGFLGQQCE 209          

HSP 3 Score: 51.2174 bits (121), Expect = 9.703e-7
Identity = 43/137 (31.39%), Postives = 61/137 (44.53%), Query Frame = 1
Query:  913 ICGTDEITYTNICEMKKVSCKANRFIEQQYVGRC--------------------DICKFVKCEFNGIC----EMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKI 1251
            +CG+D ++Y N C +++ +C+  R I Q   G C                       K  KC   GIC    E  ED     C C N D  CT +   PVC SD V+Y++ C +K  SC K+  + V + GKC   +
Sbjct:    9 VCGSDGLSYQNECHLRQTACRLQRIITQAAPGPCYTELGSGSSNGADYEGSGSEHYRKSTKC---GICLYGSECDEDAEDIGCVC-NID--CTGHNSNPVCASDGVSYENPCLVKEASCMKQQLIEVRFLGKCNPAL 139          
BLAST of Agrin, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007784.1 (pep scaffold:Pmarinus_7.0:GL477336:382472:417638:1 gene:ENSPMAG00000007035.1 transcript:ENSPMAT00000007784.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 5.766e-11
Identity = 50/163 (30.67%), Postives = 77/163 (47.24%), Query Frame = 1
Query: 2374 ADEKNKRSCLCNSIGSLNHECDPSTTQCICKTG-ITGQYCDRCIDGYWNFTE--NGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYS---ISN-HGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSD 2841
             D    R C C+  GS +  CD ++ QC C +  + G+ C RC   Y+ F +    C  C+C+  GS    C+ +TG+C+CK LAMG+ C  C  G S    SN  GC +    +    A  LG    +   ++   +A N  S  ++ + Y +D  I+   D
Sbjct:  681 GDASGCRPCDCHERGSAHAACDGNSGQCACTSHTVGGRRCHRCAHSYYGFAQELGRCRECACSTAGSLDTSCHPDTGQCSCKALAMGRRCDACTHGASHLRASNPFGCSKTPSQQPPPVARALG--SSAIGLAWSPPDAPN--SDLLTYILYRNDSQIYSARD 839          
BLAST of Agrin, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000128.1 (pep scaffold:Pmarinus_7.0:GL482156:314:14887:1 gene:ENSPMAG00000000114.1 transcript:ENSPMAT00000000128.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 3.957e-9
Identity = 27/78 (34.62%), Postives = 43/78 (55.13%), Query Frame = 1
Query: 2410 SIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVC 2643
            ++ +L  +CDP + +C C   +TG+ C+ C  GYWN+  NGC  C C      +  C+  +G+C+CK    G+ C  C
Sbjct:  547 AVAALGSQCDPRSGRCRCPPSVTGRRCELCQPGYWNYGPNGCQRCECT-----TGSCDPHSGRCSCKGGVSGEQCDQC 619          

HSP 2 Score: 53.5286 bits (127), Expect = 3.870e-7
Identity = 32/90 (35.56%), Postives = 44/90 (48.89%), Query Frame = 1
Query: 2395 SCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTE-NGCTACSCN--RFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGY 2655
            +C C+  G     CD  + +CICK G+ G  C  C  GY+ F    GC  C C     GS+   C+  +G+C C P   G+ C +C  GY
Sbjct:  496 ACRCDKCGMKG--CDGRSGKCICKLGVMGHSCSTCEPGYYGFDSCKGCEPCECAVAALGSQ---CDPRSGRCRCPPSVTGRRCELCQPGY 580          
BLAST of Agrin, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009682.1 (pep scaffold:Pmarinus_7.0:GL479835:738:11671:-1 gene:ENSPMAG00000008750.1 transcript:ENSPMAT00000009682.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 6.619e-9
Identity = 31/79 (39.24%), Postives = 45/79 (56.96%), Query Frame = 1
Query: 2398 CLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYC 2634
            C CN +GS + +CD    +C CK G+ G+ CD+C+ G+ +  E GC  C+CN  G+    C  +TG+C CK    G  C
Sbjct:  259 CNCNPVGSYSRQCD-EQGRCSCKQGVMGERCDQCLPGFHSMDEAGCRPCTCNPAGTLED-CQPDTGRCVCKDNVEGYNC 335          
BLAST of Agrin, putative vs. Ensembl Nematostella
Match: EDO40386 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7E5])

HSP 1 Score: 207.994 bits (528), Expect = 2.950e-56
Identity = 189/606 (31.19%), Postives = 268/606 (44.22%), Query Frame = 1
Query:  538 DPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATC-VTNPYPYCKCPNDK-CDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQ-CHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPK-EPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTD-CVYVRRPVCGSDDRTYENECFLKVKSCAEN---RLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIR 2331
            DPC  + C   AQC        T VC  S   C        VCG+DG  Y++ CL++   C    +IQV+    CG   A+  G S      C    C   + C V    P C C + + C SS   +C T   T+   C M+  +C  +R +     G CD C  VKC+ +  C +  D +   C CP+  E C   +   VCG+D  +Y +EC +K  +C+K+ S+TV ++G C        CS  + C + AKCI  ++    C+C   +      D VCG+DG  Y  +C +   +C +  ++ V +   C     S  +    Y  C    +G   C CPK E CP +  PVCG D  TY S C +  +AC  KK + + + G C      ++    CP ++ C  D                   VCG+D +TY + C +++  C+T   A+ +   G CD C   KC + S C         C CPTD C     PVCGSD +TYENEC L+V+SC  N   R+I+      C L         C           N  C+C   C      VCG DG  Y+N C L R+AC   + IR
Sbjct:   11 DPCFAVVCANHAQCVTLSDGRTTCVCP-SAIDCPGVPSP--VCGTDGKTYNNDCLLRATACHNGSNIQVAGLGQCG--TAKFLGFSSLGP--CASLRCKSPSRCQVIKGKPQCVCRDVRECPSSMDPVCSTTGETFITKCHMEVEACTESRSMMVARRGECDPCSRVKCKEDRHCVVDMD-MKPKCICPSESE-CPLTVDT-VCGTDKSSYLNECVMKARACRKEKSVTVAHRGFC------GACSLAKPCEHRAKCISNTDGTLTCTCRKEENCPGRADYVCGSDGNSYFTECHMDATACRESRDITVKHKGPCGKTTHSTQQIRTFYGVCVGVEDGSMKCVCPKPEECPYVNAPVCGTDDRTYPSECIMKTSACADKKAVRVKHAGECGLT---RQAVCACPRFEDCPRDF----------------RPVCGSDLRTYVNLCRLQVEVCQTGR-AVTVLRQGACDPCSVSKCKYNSECVKRADGSTTCQCPTDRCPKEASPVCGSDGKTYENECKLRVESCKANQNVRIISRTKCNACTLSTCNLVYGTC------SASSANASCICPTNCPSDWDPVCGDDGVTYQNLCHLLREACTSGRIIR 574          

HSP 2 Score: 201.06 bits (510), Expect = 6.929e-54
Identity = 170/542 (31.37%), Postives = 246/542 (45.39%), Query Frame = 1
Query:  538 DPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCP---NDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCE---FNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCD-YLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTC---------DKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLIT 2112
            DPCS++ CK    C       P  +C  S ++C       +VCG+D   Y + C+MK + C  +KS+ V+    CG         + S  + C+H+     A C++N      C     + C   +  +CG+D  +Y   C M   +C+ +R I  ++ G C        +   F G+C  +EDG    C CP P+E     +  PVCG+DD TY SEC +K  +C  K ++ V + G+C    Q                      A C+C  + DC   +R PVCG+D   Y N C L    C+    + V+    C+  PCS  KC    + C    +G +TC+CP + CPK   PVCG+D  TYE+ C L   +C   + + II    CN    C     +   Y  C +    A C CPT CP     + VCG DG TY++ CH+   AC +  I  ++   G C         D C  KKC +Y  C++      +C CP  C     PVC SD RTY+NEC  K  +C + R +T
Sbjct:  165 DPCSRVKCKEDRHCVVDMDMKPKCICP-SESECPLTVD--TVCGTDKSSYLNECVMKARACRKEKSVTVAHRGFCG---------ACSLAKPCEHR-----AKCISNTDGTLTCTCRKEENCPGRADYVCGSDGNSYFTECHMDATACRESRDITVKHKGPCGKTTHSTQQIRTFYGVCVGVEDG-SMKCVCPKPEEC--PYVNAPVCGTDDRTYPSECIMKTSACADKKAVRVKHAGECGLTRQ----------------------AVCACPRFEDCPRDFR-PVCGSDLRTYVNLCRLQVEVCQTGRAVTVLRQGACD--PCSVSKCKYNSE-CVKRADGSTTCQCPTDRCPKEASPVCGSDGKTYENECKLRVESCKANQNVRIISRTKCNA---CTLSTCN-LVYGTCSASSANASCICPTNCPSDW--DPVCGDDGVTYQNLCHLLREACTSGRIIRRLYR-GVCGKAVVSPRPDACAAKKCRYYGQCRVGSDGIAECACPLSCPSTADPVCASDGRTYQNECLAKKYACEKKRDLT 653          

HSP 3 Score: 167.162 bits (422), Expect = 9.321e-43
Identity = 151/510 (29.61%), Postives = 223/510 (43.73%), Query Frame = 1
Query: 1015 DICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTK-----IQSDICSNIQCHYGAKCIKTSNTVAQCSC-DYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEP-CPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDL-VQAKCEC---PTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKC---SFYSICQMNRFLEPQCICPT--DCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIK----PDEERCPED---------------------------------------CPLGKMCRNGQCV-----------CTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRV 2334
            D C  V C  +  C  + DG  T C CP+  +     +  PVCG+D  TY ++C L+  +C    ++ V   G+C T           C++++C   ++C +      QC C D  +C ++  DPVC   G  +  KC +   +C +   M V     C+  PCS VKC +  ++C +D + K  C CP E  CP  V  VCG DK +Y + C +   AC  +K + + + G C          K C     C S+      C C     CP  G  + VCG+DG +Y +ECHM   AC   S  + + + G C K  +      +FY +C        +C+CP   +C YV  PVCG+DDRTY +EC +K  +CA+ + +     G C L        P  E CP D                                       C + K   N +CV            TD+C K    VCG+DG  YENEC+L+ ++C  N+ +R+
Sbjct:   11 DPCFAVVCANHAQCVTLSDGR-TTCVCPSAIDC--PGVPSPVCGTDGKTYNNDCLLRATACHNGSNIQVAGLGQCGTAKFLGFSSLGPCASLRCKSPSRC-QVIKGKPQCVCRDVRECPSSM-DPVCSTTGETFITKCHMEVEACTESRSMMVARRGECD--PCSRVKCKED-RHCVVDMDMKPKCICPSESECPLTVDTVCGTDKSSYLNECVMKARACRKEKSVTVAHRGFCGA----CSLAKPCEHRAKCISNTDGTLTCTCRKEENCP--GRADYVCGSDGNSYFTECHMDATACR-ESRDITVKHKGPCGKTTHSTQQIRTFYGVCVGVEDGSMKCVCPKPEECPYVNAPVCGTDDRTYPSECIMKTSACADKKAVRVKHAGECGLTRQAVCACPRFEDCPRDFRPVCGSDLRTYVNLCRLQVEVCQTGRAVTVLRQGACDPCSVSKCKYNSECVKRADGSTTCQCPTDRCPKEASPVCGSDGKTYENECKLRVESCKANQNVRI 505          

HSP 4 Score: 125.176 bits (313), Expect = 3.513e-29
Identity = 117/391 (29.92%), Postives = 173/391 (44.25%), Query Frame = 1
Query: 1222 MYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSC-DYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCEN---------NPCSGVKCPDPYQYCRIDNNGKSTCECPK-EPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDL-VQAKCECPT---CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCK-NKKCSFYSICQMNRFLEPQCICPTD--CVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVC--TDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRV 2334
            M+  +C   I  D C  + C   A+C+  S+    C C   +DC      PVCG DG  Y+N C L   +C     + V     C            PC+ ++C  P + C++   GK  C C     CP  + PVC     T+ + C++   AC   + + +   G C+   R K     C   + C  D+ ++ KC CP+   CP +   ++VCGTD  +Y +EC M+  AC     ++ +A+ G C  C   K C   + C  N      C C  +  C      VCGSD  +Y  EC +   +C E+R IT   +GPC        + R      +G    + +CVC   ++C  V   VCGTD   Y +EC +K  AC D K +RV
Sbjct:    1 MFYAQCVLPI--DPCFAVVCANHAQCVTLSDGRTTCVCPSAIDCPGVP-SPVCGTDGKTYNNDCLLRATACHNGSNIQVAGLGQCGTAKFLGFSSLGPCASLRCKSPSR-CQV-IKGKPQCVCRDVRECPSSMDPVCSTTGETFITKCHMEVEACTESRSMMVARRGECDPCSRVK-----CKEDRHCVVDMDMKPKCICPSESECPLT--VDTVCGTDKSSYLNECVMKARACRKEK-SVTVAHRGFCGACSLAKPCEHRAKCISNTDGTLTCTCRKEENCPGRADYVCGSDGNSYFTECHMDATACRESRDITVKHKGPCGKTTHSTQQIRTFYGVCVGVEDGSMKCVCPKPEECPYVNAPVCGTDDRTYPSECIMKTSACADKKAVRV 378          
BLAST of Agrin, putative vs. Ensembl Nematostella
Match: EDO40367 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7B8])

HSP 1 Score: 137.887 bits (346), Expect = 2.575e-34
Identity = 144/545 (26.42%), Postives = 211/545 (38.72%), Query Frame = 1
Query:  649 KEISVCGSDGIFYDSHCLMKRQECFLQKSIQVS------------------PNHICGRKEAQQDGISKSNEQFCQHQSC----PPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFI---EQQYVGR-------CD-----ICKFVKCEFNGICEMMEDG-----LGTICKCPNPD-------ELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECP-TCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPC 2133
            K   VCGSD + Y S C ++R  C     I                     P  ICG          +     C++ +C     P    V +    C CP  +C      +CG+D  TY N C M++ +C  N++I   +Q+  G+       CD     +C     +F   C+M +D        T   C   D       E C K ++ PV G+D+  Y +EC LK+ +CK    + +   G                       + S  +  C+C   +C +T  DPVCG D   YDN+C + + +C     + V     C                     +GK+TCEC  E CPK ++PVCG+D   Y++ C +   AC T                         P +  CK+   +A+C C   CP+S   + VCGTD  TY +EC ++   CET                             NR + P C+CP DC      VCGSD+ TY NEC +K ++C  N  +    +G C
Sbjct:    7 KSDPVCGSDNVTYASECQLRRAACLNDTWITTQRKGDCACSCPSSCGDESLPQPICGSNNKTYANECELRMDSCKNNNCVVHLGPRCANVPSGKISCTCP--ECSKREDPVCGSDSKTYPNECRMRQEACWNNKWIIVAQQEECGQIYCVCPECDNTESPVCTNDGKKFPNECQMRQDACFNKQWTTPISCAQDDQPTCVCVEPCPKTLK-PVYGTDNKNYDNECLLKLAACKSNTRILIAGFG-----------------------RYSKQIPVCACPE-NCSSTV-DPVCGTDNNTYDNECLMRQQACVANATVAVRRKGHCA-------------------KDGKATCEC-SEDCPKTLKPVCGSDNNDYDNECLMQARACST-------------------------PPHSTCKAVGDKAECVCSKVCPRS--LDLVCGTDNITYNNECFLKRQGCET-----------------------------NRTITPMCVCPKDCPASLDLVCGSDNITYSNECLMKYQACRTNSALKVKRKGDC 447          

HSP 2 Score: 127.487 bits (319), Expect = 8.089e-31
Identity = 136/515 (26.41%), Postives = 203/515 (39.42%), Query Frame = 1
Query:  877 CPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNP--DELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFC-------------ENNPCS--GVKCPDPYQYCRID--------------NNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTI 2328
            CP+  C   S  +CG+D +TY + C++++ +C  + +I  Q  G C                        C CP+   DE    ++  P+CGS++ TY +EC L+++SCK                      +N   H G +C    +    C+C      +   DPVCG+D   Y N+C + + +C     + V     C             E+  C+  G K P+  Q  R D               + + TC C  EPCPK ++PV G D   Y++ C L   AC +   + I   G      R  +Q   C   + C S +                + VCGTD  TY +EC MR  AC  N+  + +   G C K                  +  C C  DC    +PVCGSD+  Y+NEC ++ ++C+     T  + G                           +CVC+  C +    VCGTD   Y NEC LKR+ C  N+TI
Sbjct:    1 CPD--CKDKSDPVCGSDNVTYASECQLRRAACLNDTWITTQRKGDC-----------------------ACSCPSSCGDE----SLPQPICGSNNKTYANECELRMDSCKN---------------------NNCVVHLGPRCANVPSGKISCTCPEC---SKREDPVCGSDSKTYPNECRMRQEACWNNKWIIVAQQEECGQIYCVCPECDNTESPVCTNDGKKFPNECQM-RQDACFNKQWTTPISCAQDDQPTCVC-VEPCPKTLKPVYGTDNKNYDNECLLKLAACKSNTRILIAGFG------RYSKQIPVCACPENCSSTV----------------DPVCGTDNNTYDNECLMRQQACVANAT-VAVRRKGHCAK----------------DGKATCECSEDCPKTLKPVCGSDNNDYDNECLMQARACSTPPHSTCKAVG------------------------DKAECVCSKVCPRSLDLVCGTDNITYNNECFLKRQGCETNRTI 397          

HSP 3 Score: 119.783 bits (299), Expect = 2.861e-28
Identity = 116/405 (28.64%), Postives = 157/405 (38.77%), Query Frame = 1
Query: 1120 KNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRV 2334
            K+   PVCGSD+VTY SEC L+  +C     +T   KG C                             CSC       +   P+CG++   Y N+C L   SC K     V     C N P                 +GK +C CP+  C K   PVCG+D  TY + C + + AC   K  WII             Q ++C           Q  C CP C        VC  DGK + +EC MR  AC        I+                  C  +   +P C+C   C    +PV G+D++ Y+NEC LK+ +C  N  I     G    Q             P+        C C + CS     VCGTD N Y+NEC ++++AC+ N T+ V
Sbjct:    5 KDKSDPVCGSDNVTYASECQLRRAACLNDTWITTQRKGDCA----------------------------CSCPSSCGDESLPQPICGSNNKTYANECELRMDSC-KNNNCVVHLGPRCANVP-----------------SGKISCTCPE--CSKREDPVCGSDSKTYPNECRMRQEACWNNK--WIIV-----------AQQEEC----------GQIYCVCPEC--DNTESPVCTNDGKKFPNECQMRQDACFNKQWTTPIS------------------CAQDD--QPTCVCVEPCPKTLKPVYGTDNKNYDNECLLKLAACKSNTRILIAGFGRYSKQI------------PV--------CACPENCSSTVDPVCGTDNNTYDNECLMRQQACVANATVAV 296          

HSP 4 Score: 102.449 bits (254), Expect = 1.587e-22
Identity = 129/484 (26.65%), Postives = 189/484 (39.05%), Query Frame = 1
Query:  538 DPCSKLNC--KFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGR-------------KEAQQDGISKSNEQFCQHQSC-----PPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDK 1929
            D C   NC    G +C     N P+    C+  +C   ++E  VCGSD   Y + C M+++ C+  K I V+    CG+                  DG    NE   +  +C         +C  +  P C C  + C  +   + GTD   Y N C +K  +CK+N  I     GR     + K                +C CP   E C+  +  PVCG+D+ TY +EC ++ ++C    ++ V  KG                     C K      +CS    DC  T + PVCG+D   YDN+C +   +C                          P+  C+   + K+ C C K  CP+ +  VCG D +TY + C L R  C T + +  +   +C          KDCP+      DL                  VCG+D  TY +EC M+  AC TNS ALK+   G C +
Sbjct:   78 DSCKNNNCVVHLGPRC----ANVPSGKISCTCPEC--SKREDPVCGSDSKTYPNECRMRQEACWNNKWIIVAQQEECGQIYCVCPECDNTESPVCTNDGKKFPNECQMRQDACFNKQWTTPISCAQDDQPTCVCV-EPCPKTLKPVYGTDNKNYDNECLLKLAACKSNTRILIAGFGR-----YSK-------------QIPVCACP---ENCSSTVD-PVCGTDNNTYDNECLMRQQACVANATVAVRRKG--------------------HCAKDGKATCECS---EDCPKTLK-PVCGSDNNDYDNECLMQARACSTP-----------------------PHSTCKAVGD-KAECVCSKV-CPRSLDLVCGTDNITYNNECFLKRQGCETNRTITPMC--VC---------PKDCPA----SLDL------------------VCGSDNITYSNECLMKYQACRTNS-ALKVKRKGDCGR 449          
BLAST of Agrin, putative vs. Ensembl Nematostella
Match: EDO40374 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7C5])

HSP 1 Score: 120.168 bits (300), Expect = 1.225e-29
Identity = 106/339 (31.27%), Postives = 151/339 (44.54%), Query Frame = 1
Query: 1321 AQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVA 2337
            A C+C  L C N   DPVCG+DG  YDN C L + +C+    + +I+ + C  +                   GK TC C  EPCPKI++PV G+D   Y++ C L   AC +K  + I  +G  +++P C           +C             CP+  + + V G+DGK Y +EC +++ AC++ S  L IA  G  DK                   P C+C   C  + +PV GSD + Y+NEC LK+ +C     I     G   LQ  KP                   CVC + C ++   V G+DG  Y+NEC LK  AC     I +A
Sbjct:    7 AVCTC--LSCPNML-DPVCGSDGKNYDNVCKLRQNACKTNTLITLISRDACLQD-------------------GKPTCVC-VEPCPKILKPVYGSDGKNYDNECLLKLAACKSKSRILIAGSGRYHDKPTC-----------VCVE----------PCPE--ILKPVYGSDGKDYDNECLLKLAACKSKSRIL-IAGFGH-DK-------------------PTCVCVEPCPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFG---LQDDKP------------------TCVCVEPCPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIA 257          

HSP 2 Score: 93.2041 bits (230), Expect = 1.896e-20
Identity = 105/400 (26.25%), Postives = 166/400 (41.50%), Query Frame = 1
Query:  892 CDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSC 2091
            C +    +CG+D   Y N+C++++ +CK N  I    + R D C             ++DG  T C C  P   C K ++ PV GSD   Y +EC LK+ +              C++K +  I  + + H    C+     V  C             PV G+DG  YDN+C L   +C+ +  + +  + F  + P                     TC C  EPCP+I++PV G+D   Y++ C L   AC +K  + I   G+ +++P C           +C             CP+  + + V G+DGK Y +EC +++ AC++ S  L IA  G                               C  + +PV GSD + Y+NEC LK+ +C
Sbjct:   14 CPNMLDPVCGSDGKNYDNVCKLRQNACKTNTLI--TLISR-DAC-------------LQDGKPT-CVCVEP---CPKILK-PVYGSDGKNYDNECLLKLAA--------------CKSKSRILIAGSGRYHDKPTCV----CVEPCP--------EILKPVYGSDGKDYDNECLLKLAACKSKSRILI--AGFGHDKP---------------------TCVC-VEPCPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGLQDDKPTC-----------VCVE----------PCPE--ILKPVYGSDGKDYDNECLLKLAACKSKSRIL-IAGFGQ-----------------------------PCPEILKPVYGSDGKDYDNECLLKLAAC 289          

HSP 3 Score: 84.3445 bits (207), Expect = 1.514e-17
Identity = 59/191 (30.89%), Postives = 91/191 (47.64%), Query Frame = 1
Query: 1768 QAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSC-AENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVA 2337
            +A C C +CP   + + VCG+DGK Y + C +R +AC+TN++   I+     D C                 +P C+C   C  + +PV GSD + Y+NEC LK+ +C +++R++ A S                      G+      CVC + C ++   V G+DG  Y+NEC LK  AC     I +A
Sbjct:    6 EAVCTCLSCPN--MLDPVCGSDGKNYDNVCKLRQNACKTNTLITLISR----DACLQDG-------------KPTCVCVEPCPKILKPVYGSDGKNYDNECLLKLAACKSKSRILIAGS----------------------GRYHDKPTCVCVEPCPEILKPVYGSDGKDYDNECLLKLAACKSKSRILIA 155          

HSP 4 Score: 68.9366 bits (167), Expect = 2.708e-12
Identity = 98/406 (24.14%), Postives = 142/406 (34.98%), Query Frame = 1
Query:  661 VCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHAC 1878
            VCGSDG  YD+ C +++  C     I      +  R    QDG               P   CV           + C      + G+D   Y N C +K  +CK+   I     GR                   D    +C  P P+      I  PV GSD   Y +EC LK+ +CK K  + +   G                H    C+     V  C             PV G+DG  YDN+C L   +C+ +  + +      ++ P                     TC C  EPCP+I++PV G+D   Y++ C L   AC +K    I+  G           G+ CP                       + + V G+DGK Y +EC +++ AC
Sbjct:   21 VCGSDGKNYDNVCKLRQNACKTNTLIT-----LISRDACLQDG--------------KPTCVCV-----------EPCPKILKPVYGSDGKNYDNECLLKLAACKSKSRILIAGSGR-----------------YHDKPTCVCVEPCPE------ILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFG----------------HDKPTCV----CVEPCP--------EILKPVYGSDGKDYDNECLLKLAACKSKSRILIAGFGLQDDKP---------------------TCVC-VEPCPEILKPVYGSDGKDYDNECLLKLAACKSKS--RILIAGF----------GQPCPE----------------------ILKPVYGSDGKDYDNECLLKLAAC 289          

HSP 5 Score: 62.003 bits (149), Expect = 5.422e-10
Identity = 45/120 (37.50%), Postives = 56/120 (46.67%), Query Frame = 1
Query: 1984 EPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPS 2343
            E  C C   C  +  PVCGSD + Y+N C L+  +C  N LIT +S   C LQ  KP                   CVC + C K+   V G+DG  Y+NEC LK  AC     I +A S
Sbjct:    6 EAVCTC-LSCPNMLDPVCGSDGKNYDNVCKLRQNACKTNTLITLISRDAC-LQDGKP------------------TCVCVEPCPKILKPVYGSDGKNYDNECLLKLAACKSKSRILIAGS 105          
BLAST of Agrin, putative vs. Ensembl Nematostella
Match: EDO38470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCV7])

HSP 1 Score: 119.398 bits (298), Expect = 3.583e-29
Identity = 106/401 (26.43%), Postives = 161/401 (40.15%), Query Frame = 1
Query: 1132 VPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRV 2334
            +PVCG+D  TY ++C ++  +C K   +TV Y G+C++ +                    N  AQC C  + C   +  PVCG+DG +Y N+C +   +C++Q  +                    P    +     +  CE     CP I  PVC ++  TY + C++   AC+    L ++  G                           A C+CP    S +   VCG+DGK YK +C +R  ACE+    + +A+  +C K K              +L   C  P  C    RPVC SD +TY N C +    C ++  +  V                           RNG C   ++C K   +VCG+DG  Y+NEC LK   C   K ++V
Sbjct:   10 MPVCGTDGKTYGNKCEMRASACLKSTMVTVAYPGECESNV-------------------VNGSAQCVCPSI-CPLHY-SPVCGSDGNMYSNECAMRAAACKQQKMIT-------------------PSLPSKCSKYTQGECE---IACPDIYDPVCASNGKTYSNRCDMDADACIRDTKLTVVSQG---------------------------ALCKCPPSICSPVISPVCGSDGKIYKDDCELRKTACESKK-NIVVADKDSCSKWKRG------------YLF--CFSPRPCTADYRPVCASDGQTYPNVCTMDSAGCQKSMNLKVV---------------------------RNGTCCVVNECPKNSSKVCGSDGWTYDNECFLKLYTCRQGKDVKV 298          

HSP 2 Score: 108.612 bits (270), Expect = 1.565e-25
Identity = 105/413 (25.42%), Postives = 164/413 (39.71%), Query Frame = 1
Query:  913 ICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIK 2151
            +CGTD  TY N CEM+  +C  +  +   Y G        +CE N +           C CP+   +C  +   PVCGSD   Y +EC ++  +CK++  +T     KC    Q +                           + C + + DPVC ++G  Y N+C +   +C +  ++ V++                            + C+CP   C  ++ PVCG+D   Y+  C L +TAC +KK + +     C++  R          Y  C S            P +     VC +DG+TY + C M    C+  S+ LK+   GTC             C +N        CP +       VCGSD  TY+NECFLK+ +C + + +     G C  +  K
Sbjct:   12 VCGTDGKTYGNKCEMRASACLKSTMVTVAYPG--------ECESNVV------NGSAQCVCPS---ICPLHYS-PVCGSDGNMYSNECAMRAAACKQQKMITPSLPSKCSKYTQGEC-------------------------EIACPDIY-DPVCASNGKTYSNRCDMDADACIRDTKLTVVSQG--------------------------ALCKCPPSICSPVISPVCGSDGKIYKDDCELRKTACESKKNIVVADKDSCSKWKR---------GYLFCFSPR----------PCTADYRPVCASDGQTYPNVCTMDSAGCQ-KSMNLKVVRNGTC-------------CVVNE-------CPKN----SSKVCGSDGWTYDNECFLKLYTCRQGKDVKVQQMGECPAKISK 310          

HSP 3 Score: 92.0485 bits (227), Expect = 6.110e-20
Identity = 102/423 (24.11%), Postives = 156/423 (36.88%), Query Frame = 1
Query:  655 ISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTC 1923
            + VCG+DG  Y + C M+   C     + V+             G  +SN               V N    C CP+  C    S +CG+D   Y+N C M+  +CK  + I      +C   K+ +    G CE+          CP        +I  PVC S+  TY + C +  ++C +   LTV+ +G    K    ICS +                               PVCG+DG IY + C L K +CE +  + V + + C                      G   C  P+ PC    +PVC +D  TY ++C +    C     L ++ NG C                           C    CP++     VCG+DG TY +EC ++++ C      +K+  +G C
Sbjct:   10 MPVCGTDGKTYGNKCEMRASACLKSTMVTVA-----------YPGECESN---------------VVNGSAQCVCPS-ICPLHYSPVCGSDGNMYSNECAMRAAACKQQKMITPSLPSKCS--KYTQ----GECEIA---------CP--------DIYDPVCASNGKTYSNRCDMDADACIRDTKLTVVSQGA-LCKCPPSICSPVI-----------------------------SPVCGSDGKIYKDDCELRKTACESKKNIVVADKDSCSKW-----------------KRGYLFCFSPR-PCTADYRPVCASDGQTYPNVCTMDSAGCQKSMNLKVVRNGTC---------------------------CVVNECPKN--SSKVCGSDGWTYDNECFLKLYTCRQGK-DVKVQQMGEC 304          

HSP 4 Score: 82.8037 bits (203), Expect = 7.789e-17
Identity = 63/200 (31.50%), Postives = 92/200 (46.00%), Query Frame = 1
Query: 1819 VCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITA--------VSEGPCKLQ---FIKP---------------DEERCPEDCPLGKMCRNGQCVCTDK-CSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVA 2337
            VCGTDGKTY ++C MR  AC   S  + +A  G C+          ++   +     QC+CP+ C     PVCGSD   Y NEC ++  +C + ++IT          ++G C++       P               D + C  D  L  + +   C C    CS V   VCG+DG  Y+++CEL++ AC   K I VA
Sbjct:   12 VCGTDGKTYGNKCEMRASAC-LKSTMVTVAYPGECES---------NVVNGSA----QCVCPSICPLHYSPVCGSDGNMYSNECAMRAAACKQQKMITPSLPSKCSKYTQGECEIACPDIYDPVCASNGKTYSNRCDMDADACIRDTKLTVVSQGALCKCPPSICSPVISPVCGSDGKIYKDDCELRKTACESKKNIVVA 197          

HSP 5 Score: 75.8702 bits (185), Expect = 1.584e-14
Identity = 84/332 (25.30%), Postives = 121/332 (36.45%), Query Frame = 1
Query: 1369 PVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVC--TDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCI 2358
            PVCG DG  Y NKC +   +C K   + V     CE+N                  NG + C CP   CP    PVCG+D   Y + C +   AC                    K+Q    PS     S   Q +CE   CP   + + VC ++GKTY + C M   AC  ++  L + + G   KC                       P+ C  V  PVCGSD + Y+++C L+  +C   + I    +  C                      + G   C     C+     VC +DG  Y N C +    C  +  ++V  +   C+
Sbjct:   11 PVCGTDGKTYGNKCEMRASACLKSTMVTVAYPGECESNVV----------------NGSAQCVCPSI-CPLHYSPVCGSDGNMYSNECAMRAAAC--------------------KQQKMITPSLPSKCSKYTQGECEI-ACPD--IYDPVCASNGKTYSNRCDMDADACIRDT-KLTVVSQGALCKCP----------------------PSICSPVISPVCGSDGKIYKDDCELRKTACESKKNIVVADKDSCSKW-------------------KRGYLFCFSPRPCTADYRPVCASDGQTYPNVCTMDSAGCQKSMNLKVVRNGTCCV 260          

HSP 6 Score: 67.0106 bits (162), Expect = 1.478e-11
Identity = 36/110 (32.73%), Postives = 52/110 (47.27%), Query Frame = 1
Query: 1999 CPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTI 2328
            CP  C Y   PVCG+D +TY N+C ++  +C ++ ++T    G C+   +                  + QCVC   C      VCG+DGN Y NEC ++  AC   K I
Sbjct:    1 CPIFCTYEYMPVCGTDGKTYGNKCEMRASACLKSTMVTVAYPGECESNVVN----------------GSAQCVCPSICPLHYSPVCGSDGNMYSNECAMRAAACKQQKMI 94          
BLAST of Agrin, putative vs. Ensembl Nematostella
Match: EDO40383 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7E2])

HSP 1 Score: 115.931 bits (289), Expect = 3.227e-28
Identity = 94/345 (27.25%), Postives = 145/345 (42.03%), Query Frame = 1
Query:  892 CDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCEC-PTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTC 1923
            C    + +CG+D  TY N+C +    C++  FI + + G C             C    DG G IC+CP        ++  PVCG D  TY +EC L++ESC ++ S+T +  G C                       ++  A+C CD     +   DP+CG DG  Y+N   L   +C +Q  +   +   C     +   CPDP                    CP +   VCG D +TY+++C L   +C   +P+        N + +C   G+    Y        + +CEC  TCP+S   + VCG+D + Y +EC ++  AC      L + N G C
Sbjct:    9 CTREYAPVCGSDGNTYNNLCLLTAARCQSQTFIYRAHFGTCGT----------RCVPSADGSGHICECPRS----CPSVNYPVCGDDGQTYDNECLLQLESCSRRRSITTVNYGSCG----------------------ADNYARCECDLR--PDPAYDPICGTDGKTYNNDKDLESAACAQQTSIVRWHKGPCTVG--AVCTCPDP------------------AACPLVKSRVCGTDGITYDNLCRLRAESCRRYQPV--------NVKVKCAFYGQCVWYYD------GRTQCECRRTCPRS--DQLVCGSDDRDYANECVLQARACTWRDSLLTVHNKGPC 279          

HSP 2 Score: 110.153 bits (274), Expect = 3.173e-26
Identity = 99/345 (28.70%), Postives = 140/345 (40.58%), Query Frame = 1
Query: 1132 VPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQ-CSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECP---TCPQSGLGESVCGTDGKTYKSECHMRMHACET-NSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCA-ENRLITAVSEGPCKLQFI 2148
             PVCGSD  TY + C L    C+ +  +   + G C                G +C+ +++     C C    C +    PVCG+DG  YDN+C L   SC ++  +  +N                 Y  C  DN  +  CEC   P P    P+CG D  TY +  +L   AC  +  +   + G C                       V A C CP    CP   +   VCGTDG TY + C +R  +C     + +K+            KC+FY  C        QC C   C    + VCGSDDR Y NEC L+ ++C   + L+T  ++GPC  + I
Sbjct:   14 APVCGSDGNTYNNLCLLTAARCQSQTFIYRAHFGTC----------------GTRCVPSADGSGHICECP-RSCPSV-NYPVCGDDGQTYDNECLLQLESCSRRRSITTVN-----------------YGSCGADNYAR--CECDLRPDPAY-DPICGTDGKTYNNDKDLESAACAQQTSIVRWHKGPCT----------------------VGAVCTCPDPAACPL--VKSRVCGTDGITYDNLCRLRAESCRRYQPVNVKV------------KCAFYGQCVWYYDGRTQCECRRTCPRSDQLVCGSDDRDYANECVLQARACTWRDSLLTVHNKGPCGGRRI 284          

HSP 3 Score: 88.5817 bits (218), Expect = 8.021e-19
Identity = 74/257 (28.79%), Postives = 117/257 (45.53%), Query Frame = 1
Query: 1573 CPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECP-TCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIK--PDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRV 2334
            C +   PVCG+D  TY ++C LT   C ++  ++  + G C    RC           +  +D     CECP +CP   +   VCG DG+TY +EC +++ +C +   ++   N G+C          Y+ C+ +   +P             P+CG+D +TY N+  L+  +CA+   I    +GPC +  +   PD    P  CPL                 VK RVCGTDG  Y+N C L+ ++C   + + V
Sbjct:    9 CTREYAPVCGSDGNTYNNLCLLTAARCQSQTFIYRAHFGTCGT--RC-----------VPSADGSGHICECPRSCPS--VNYPVCGDDGQTYDNECLLQLESC-SRRRSITTVNYGSCGA------DNYARCECDLRPDP----------AYDPICGTDGKTYNNDKDLESAACAQQTSIVRWHKGPCTVGAVCTCPD----PAACPL-----------------VKSRVCGTDGITYDNLCRLRAESCRRYQPVNV 212          

HSP 4 Score: 74.3294 bits (181), Expect = 4.295e-14
Identity = 66/221 (29.86%), Postives = 99/221 (44.80%), Query Frame = 1
Query:  661 VCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQ-----------------DGISKSNEQFCQHQSCPPYATCVT------NPYPYCKCPND-KCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKIS-LTVMYKGKCQTK 1248
            VCG DG  YD+ CL++ + C  ++SI       CG     +                 DG + +N++  +  +C    + V            C CP+   C    S++CGTD ITY N+C ++  SC+  + +  +          VKC F G C    DG  T C+C      C ++ Q+ VCGSDD  Y +EC L+  +C  + S LTV  KG C  +
Sbjct:   77 VCGDDGQTYDNECLLQLESCSRRRSITTVNYGSCGADNYARCECDLRPDPAYDPICGTDGKTYNNDKDLESAACAQQTSIVRWHKGPCTVGAVCTCPDPAACPLVKSRVCGTDGITYDNLCRLRAESCRRYQPVNVK----------VKCAFYGQCVWYYDGR-TQCEC---RRTCPRSDQL-VCGSDDRDYANECVLQARACTWRDSLLTVHNKGPCGGR 282          

HSP 5 Score: 55.8398 bits (133), Expect = 5.478e-8
Identity = 36/113 (31.86%), Postives = 47/113 (41.59%), Query Frame = 1
Query: 1990 QCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTI 2328
            +C+C   C     PVCGSD  TY N C L    C     I     G C  + +       P     G +C      C   C  V   VCG DG  Y+NEC L+ ++C   ++I
Sbjct:    2 KCVCSAACTREYAPVCGSDGNTYNNLCLLTAARCQSQTFIYRAHFGTCGTRCV-------PSADGSGHICE-----CPRSCPSVNYPVCGDDGQTYDNECLLQLESCSRRRSI 102          
BLAST of Agrin, putative vs. Ensembl Medaka
Match: agrn (agrin [Source:NCBI gene;Acc:101156494])

HSP 1 Score: 316.62 bits (810), Expect = 5.754e-87
Identity = 249/767 (32.46%), Postives = 358/767 (46.68%), Query Frame = 1
Query:  538 DPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQ-ICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENN---PCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCR-----------NGQCVCTDKCSKVKLR-VCGTDGNYYENECELKRKACIDNKTIR------------VAPSVI-----------GCISHNYIADEKNKRS-----CLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF----TEN--GCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGC 2676
            D C  + C FGA C++ P +P  A C C    C +      VCGSD   Y + C M+R +C  Q+ I+V     C  K+             C   +C   +TCV +       C CP   CD  + + +CG+D   Y + CE+ + +CK  + I  Q++G CD CK  +   N +C +  + L       +P E C      P+C SD  TY +ECH+     +K I L  ++ G+C+   + D C + +C + A C+       +CSCD L+C +T++ P+CG +G  Y N C   K  CE +  + + +   C+ N   PC    C      C + NN +  CECP E C     PVCG+D  +Y S C +    C  +K + I + G+C+E         +C    IC  DL   +C CP+ C +S   + VCG+DG TY SEC + + AC T    L++ + G C  C    C++ ++C  N+    QC+          P+CGSD +TY+NEC L+  SC +N+ I    +G C             E C   + CR           + +CVC   C  V    VCG+DG  Y NECELK+  C   + +             V P+ +           GC S N  A     ++     C CN  GS    CDP+T QC CK G+ GQ CDRC  G+WNF    TEN  GCT CSC+  GS    C   +G C+CK    G  C+VCP G  +  +GC
Sbjct:   67 DGCRGMLCGFGAVCERDPADPAKADCVCKKGDCPS--LVAPVCGSDSSTYSNECEMERAQCKAQRRIKVLRRGPCSLKDP------------CAEVTCSYGSTCVQSSDGLAAKCMCPLG-CDGKAGETVCGSDGNDYPSECELHQHACKNQKNIRVQHLGPCDPCKDAENSLNVLCRV--EALTRRPLLYSPPESCPPGDD-PLCASDGHTYPNECHMTATGVQKGIKLQKIHAGQCR---RLDECQD-ECLFNAVCVVEPEG-PRCSCDPLECDDTYK-PLCGRNGRTYTNDCLRRKAECEMKTLISIRSQGPCDLNTPSPCLDKVCKH-GAVCVVKNN-EPVCECP-EACQLTSDPVCGSDGHSYGSPCEMRAMGCAFQKTIHIQHKGLCDE------ACANCSFGAIC--DLQSKRCVCPSECVKSR--QPVCGSDGNTYDSECELHVKAC-TQQTDLQVVSQGACKTCGPTVCAWGALCVQNKCECQQCV-----GEALSPLCGSDGKTYDNECELRRSSCLQNKKIDVEKDGSCDEDCGSGGSGSGAESCEQDR-CRKYGGTWDEDAEDDRCVCDFSCESVPHNAVCGSDGKNYSNECELKKAGCDRRELVSIQNHGPCAALSAVTPTALTAAQHCSQSAHGCCSDNATAALGAGQAGCPSTCQCNLYGSYKGTCDPATGQCSCKPGVGGQKCDRCEPGFWNFRGIVTENMSGCTPCSCDPVGSIRDDCEQMSGLCSCKTAVKGLKCNVCPDGSKMGMNGC 789          

HSP 2 Score: 142.124 bits (357), Expect = 2.504e-33
Identity = 163/716 (22.77%), Postives = 298/716 (41.62%), Query Frame = 1
Query: 2725 FLKDSFAKSYWS-GNAENYLSINISLVPYSSD--GIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKP----NCPHIDFKNSVDVIEDPDKEEQSEKENLK------------IKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV----SHIWKFKDNSFVIFPSESL---QLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKH--ENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKR--------DKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK--PVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 4752
            F+     +SY +    + Y ++ I++   +S+  G++ Y+     S D++++ L N  VE R + GSG   L S+V+++ G  H + V R  R+  L +DG     G +P     L+      IG  T  +   ++    V+ G VGC+  L +      ++  + +     +  S V       C     KN         + +++E    K            ++D C   K C     CQ   E  Y C C  G +G  CE+V     +++  F  +S++      L    LRQ++ + +  +   ++GL+ +     D    FIS+ LN   LE       G   + S     +  WN + + ++ +   + +N   QP +          V+S ++ K        + +F GG     ++  +    L   F G +QKI++  + +  + + +  +N+  +QG PC   Q PC       G C P +    C+C P +  +N  +     H+  A       + G++  +Y     K         +K+   N   +  +T +  G+L+   K          +AI +G +++  +LG +  VLR   +  ++ N+W  ++  R  R+  L + +    A +  ++      L TDG +WLGG ++       P  Y+T F GCI ++ VD +  +LV DA  N   IL C
Sbjct: 1274 FIPSFGGQSYLAFPTMKAYHTVRIAMAFRASEMNGVLLYNGQRG-SKDFISLTLVNGKVELRFNTGSGTGTLTSKVKVSQGHWHQVEVTRNRRNGVLSVDGEPDVQGESPHGTDGLNLDTELFIGGVTEDLKQDVTARTGVSAGLVGCIRMLDVN----NRMLNLQEDGGDSLFGSGVGECGNNPCEPNPCKNGAQC-----QVKEAEMFQCKCSKGFWGTLCADVRDPCAASK-CHATSQCQVLPEGGYKCVCPMGREGRHCEKVAERRGAYMPTFNGDSYLELKGLHLYGHDLRQKVSMMVVLMANDSDGLIFYNGQKTDGKGDFISLGLNNGILEFRYDLGKGPAIIRSKAPLPLKVWNTINLERSLRKGEIRINDQ-QPARGE-----SPAVHSDLNLK--------ESLFVGGA--PDYSKLARAAGLTEGFKGTVQKIMLMSDPVLKEENALSSSNVAMFQGHPCS--QEPCQN----GGRCNPMLATYECSCFPGYVGDNCSV---AIHEKSAGETEAVAFDGRTFIEYHNGVTKSQLTNEIPDEKALLVNKFELSIRTEATHGLLLWSGKGVERSDYI-ALAIVDGRVQMTYDLGSRPVVLR--SSVRVNTNRWIHIKASRALRDGFLQVGNE---AAVTGSSPLAATQLDTDGALWLGGLEELAVARRLPKAYSTGFVGCIKDVVVDGVELHLVEDAL-NSPKILHC 1946          

HSP 3 Score: 110.153 bits (274), Expect = 1.425e-23
Identity = 147/584 (25.17%), Postives = 221/584 (37.84%), Query Frame = 1
Query:  541 PCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQ-------TKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDP-----YQYCR------IDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGICNEEPR------CKEQGK---DCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPT-DC-VYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCP 2172
            PC    CK GA C      P   VC C    CQ       VCGSDG  Y S C M+   C  QK+I +    +C    A     + S    C  QS              C CP++ C  S   +CG+D  TY + CE+   +C     ++    G C  C    C +  +C      +   C+C    + C      P+CGSD  TY +EC L+  SC +   + V   G C        +   ++ C   +C              +C CD+  C++   + VCG+DG  Y N+C L K  C+++  + + N     + PC+ +    P      Q+C         +N  +     +  CP   Q    N   +Y+  C+     C  K           +P +  + GI  E         C   G    DC        + +   C C T  + GL  +VC    K       M M+ C++   A           C +  C F + C +    +  C CP+ DC V  +  VCGSD  TY ++C LK  +C +++ I     G C     +P +   P
Sbjct:  365 PCLDKVCKHGAVCVVKNNEP---VCECPEA-CQLTSD--PVCGSDGHSYGSPCEMRAMGCAFQKTIHIQHKGLCDEACA-----NCSFGAICDLQS------------KRCVCPSE-CVKSRQPVCGSDGNTYDSECELHVKACTQQTDLQVVSQGACKTCGPTVCAWGALC------VQNKCEC----QQCVGEALSPLCGSDGKTYDNECELRRSSCLQNKKIDVEKDGSCDEDCGSGGSGSGAESCEQDRCRKYGGTWDEDAEDDRCVCDF-SCESVPHNAVCGSDGKNYSNECELKKAGCDRRELVSIQN-----HGPCAALSAVTPTALTAAQHCSQSAHGCCSDNATAALGAGQAGCPSTCQ---CNLYGSYKGTCDPATGQCSCKPGVGGQKCDRCEPGFWNFRGIVTENMSGCTPCSCDPVGSIRDDC--------EQMSGLCSCKTAVK-GLKCNVCPDGSK-------MGMNGCDSGPEAP--------GSCADLVCGFGATCIVVNG-QAHCECPSPDCDVKNKTKVCGSDGVTYADQCQLKTIACRQDKDILVAHTGQCTESIFEPADPHPP 880          

HSP 4 Score: 88.5817 bits (218), Expect = 5.200e-17
Identity = 100/455 (21.98%), Postives = 179/455 (39.34%), Query Frame = 1
Query: 2494 RCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAK----SYWSGNAENYLSINISLVPYSSDGIIFYHSD-TDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV-------SHIWKFKDNSFVIF-------------PSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNH 3783
            +C  G+W       T C+  R    +  C+  +    C+ L  G Y  VCP+G      G     + E +  A    F  DS+ +      +  +    +S+ + L+   SDG+IFY+   TD   D++++ L N  +E+R DLG G   ++S+  L +   ++I +ER  R   + I+      G +P   ++L+      +G A  P  + L+    +T+GF G +           KI LM+                P +  +N++           S       + +  + +PC NGG C       Y C C PGY G  C   +       +    F   +F+ +             P E   L    K E++    A +GLL +   G +R+  +I++ +    +++T         L S       +W H+   +A +  +L + +
Sbjct: 1476 KCSKGFWG------TLCADVRDPCAASKCHATS---QCQVLPEGGYKCVCPMG----REGRHCEKVAERR-GAYMPTFNGDSYLELKGLHLYGHDLRQKVSMMVVLMANDSDGLIFYNGQKTDGKGDFISLGLNNGILEFRYDLGKGPAIIRSKAPLPLKVWNTINLERSLRKGEIRINDQQPARGESPAVHSDLNLKESLFVGGA--PDYSKLARAAGLTEGFKGTVQ----------KIMLMSD---------------PVLKEENAL-----------SSSNVAMFQGHPCSQEPCQNGGRCNPML-ATYECSCFPGYVGDNCSVAIHEKSAGETEAVAFDGRTFIEYHNGVTKSQLTNEIPDEKALLVN--KFELSIRTEATHGLLLWSGKGVERS-DYIALAIVDGRVQMTYDLGSRPVVLRSSVRVNTNRWIHIKASRALRDGFLQVGN 1874          

HSP 5 Score: 69.707 bits (169), Expect = 3.225e-11
Identity = 58/251 (23.11%), Postives = 107/251 (42.63%), Query Frame = 1
Query: 3340 KIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSH-IWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQ---NSDIILNNITQWQGPPCGPLQSPC 4080
            K +  C +H PCL+GG C+      YSC+C  G  G  CE+V+ + I  F   S++ FP+  ++    +++ + F     NG+L +  +G   +  FIS+TL    +E+   T  G   L S      G W+ V + +  +   L+++  P    +       LN+++               +F GGV  +     +    +     G I+ + +N+  +  Q      +  + + +    PC P  +PC
Sbjct: 1231 KTQRPCDSH-PCLHGGTCEDDGS-TYSCRCPAGRGGPVCEKVMKYFIPSFGGQSYLAFPT--MKAYHTVRIAMAFRASEMNGVLLY--NGQRGSKDFISLTLVNGKVELRFNTGSGTGTLTSKVKVSQGHWHQVEVTRNRRNGVLSVDGEPDVQGESPHGTDGLNLDT--------------ELFIGGVTEDLKQDVTARTGVSAGLVGCIRMLDVNNRMLNLQEDGGDSLFGSGVGECGNNPCEP--NPC 1459          
BLAST of Agrin, putative vs. Ensembl Medaka
Match: agrn (agrin [Source:NCBI gene;Acc:101156494])

HSP 1 Score: 316.235 bits (809), Expect = 6.516e-87
Identity = 248/766 (32.38%), Postives = 357/766 (46.61%), Query Frame = 1
Query:  538 DPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQ-ICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENN---PCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNG----------QCVCTDKCSKVKLR-VCGTDGNYYENECELKRKACIDNKTIR------------VAPSVI-----------GCISHNYIADEKNKRS-----CLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF----TEN--GCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGC 2676
            D C  + C FGA C++ P +P  A C C    C +      VCGSD   Y + C M+R +C  Q+ I+V     C  K+             C   +C   +TCV +       C CP   CD  + + +CG+D   Y + CE+ + +CK  + I  Q++G CD CK  +   N +C +  + L       +P E C      P+C SD  TY +ECH+     +K I L  ++ G+C+   + D C + +C + A C+       +CSCD L+C +T++ P+CG +G  Y N C   K  CE +  + + +   C+ N   PC    C      C + NN +  CECP E C     PVCG+D  +Y S C +    C  +K + I + G+C+E         +C    IC  DL   +C CP+ C +S   + VCG+DG TY SEC + + AC T    L++ + G C  C    C++ ++C  N+    QC+          P+CGSD +TY+NEC L+  SC +N+ I    +G C             E C   +  + G          +CVC   C  V    VCG+DG  Y NECELK+  C   + +             V P+ +           GC S N  A     ++     C CN  GS    CDP+T QC CK G+ GQ CDRC  G+WNF    TEN  GCT CSC+  GS    C   +G C+CK    G  C+VCP G  +  +GC
Sbjct:   67 DGCRGMLCGFGAVCERDPADPAKADCVCKKGDCPS--LVAPVCGSDSSTYSNECEMERAQCKAQRRIKVLRRGPCSLKDP------------CAEVTCSYGSTCVQSSDGLAAKCMCPLG-CDGKAGETVCGSDGNDYPSECELHQHACKNQKNIRVQHLGPCDPCKDAENSLNVLCRV--EALTRRPLLYSPPESCPPGDD-PLCASDGHTYPNECHMTATGVQKGIKLQKIHAGQCR---RLDECQD-ECLFNAVCVVEPEG-PRCSCDPLECDDTYK-PLCGRNGRTYTNDCLRRKAECEMKTLISIRSQGPCDLNTPSPCLDKVCKH-GAVCVVKNN-EPVCECP-EACQLTSDPVCGSDGHSYGSPCEMRAMGCAFQKTIHIQHKGLCDE------ACANCSFGAIC--DLQSKRCVCPSECVKSR--QPVCGSDGNTYDSECELHVKAC-TQQTDLQVVSQGACKTCGPTVCAWGALCVQNKCECQQCV-----GEALSPLCGSDGKTYDNECELRRSSCLQNKKIDVEKDGSCDEDCGSGGSGSGAESCEQDRCRKYGGTWDEDAEDDRCVCDFSCESVPHNAVCGSDGKNYSNECELKKAGCDRRELVSIQNHGPCAALSAVTPTALTAAQHCSQSAHGCCSDNATAALGAGQAGCPSTCQCNLYGSYKGTCDPATGQCSCKPGVGGQKCDRCEPGFWNFRGIVTENMSGCTPCSCDPVGSIRDDCEQMSGLCSCKTAVKGLKCNVCPDGSKMGMNGC 789          

HSP 2 Score: 144.436 bits (363), Expect = 5.840e-34
Identity = 162/716 (22.63%), Postives = 296/716 (41.34%), Query Frame = 1
Query: 2725 FLKDSFAKSYWS-GNAENYLSINISLVPYSSD--GIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKP----NCPHIDFKNSVDVIEDPDKEEQSEKENLK------------IKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV----SHIWKFKDNSFVIFPSESL---QLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKH--ENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKR--------DKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK--PVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 4752
            F+     +SY +    + Y ++ I++   +S+  G++ Y+     S D++++ L N  VE R + GSG   L S+V+++ G  H + V R  R+  L +DG     G +P     L+      IG  T  +   ++    V+ G VGC+  L +      ++  + +     +  S V       C     KN         + +++E    K            ++D C   K C     CQ   E  Y C C  G +G  CE+V     +++  F  +S++      L    LRQ++ + +  +   ++GL+ +     D    FIS+ LN   LE       G   + S     +  WN + + ++ +   + +N   QP +    P    ++N              + +F GG     ++  +    L   F G +QKI++  + +  + + +  +N+  +QG PC   Q PC       G C P +    C+C P +  +N  +     H+  A       + G++  +Y     K         +K+   N   +  +T +  G+L+   K          +AI +G +++  +LG +  VLR   +  ++ N+W  ++  R  R+  L + +    A +  ++      L TDG +WLGG ++       P  Y+T F GCI ++ VD +  +LV DA  N   IL C
Sbjct: 1143 FIPSFGGQSYLAFPTMKAYHTVRIAMAFRASEMNGVLLYNGQRG-SKDFISLTLVNGKVELRFNTGSGTGTLTSKVKVSQGHWHQVEVTRNRRNGVLSVDGEPDVQGESPHGTDGLNLDTELFIGGVTEDLKQDVTARTGVSAGLVGCIRMLDVN----NRMLNLQEDGGDSLFGSGVGECGNNPCEPNPCKNGAQC-----QVKEAEMFQCKCSKGFWGTLCADVRDPCAASK-CHATSQCQVLPEGGYKCVCPMGREGRHCEKVAERRGAYMPTFNGDSYLELKGLHLYGHDLRQKVSMMVVLMANDSDGLIFYNGQKTDGKGDFISLGLNNGILEFRYDLGKGPAIIRSKAPLPLKVWNTINLERSLRKGEIRINDQ-QPARGE-SPAVHSDLN------------LKESLFVGGA--PDYSKLARAAGLTEGFKGTVQKIMLMSDPVLKEENALSSSNVAMFQGHPCS--QEPCQN----GGRCNPMLATYECSCFPGYVGDNCSV---AIHEKSAGETEAVAFDGRTFIEYHNGVTKSQLTNEIPDEKALLVNKFELSIRTEATHGLLLWSGKGVERSDYI-ALAIVDGRVQMTYDLGSRPVVLR--SSVRVNTNRWIHIKASRALRDGFLQVGNE---AAVTGSSPLAATQLDTDGALWLGGLEELAVARRLPKAYSTGFVGCIKDVVVDGVELHLVEDAL-NSPKILHC 1815          

HSP 3 Score: 106.686 bits (265), Expect = 1.691e-22
Identity = 145/571 (25.39%), Postives = 217/571 (38.00%), Query Frame = 1
Query:  541 PCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQ-------TKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDP-----YQYCR------IDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGICNEEPR------CKEQGK---DCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPT-DC-VYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPC 2133
            PC    CK GA C      P   VC C    CQ       VCGSDG  Y S C M+   C  QK+I +    +C    A     + S    C  QS              C CP++ C  S   +CG+D  TY + CE+   +C     ++    G C  C    C +  +C      +   C+C    + C      P+CGSD  TY +EC L+  SC +   + V   G C        +   ++ C   +C              +C CD+  C++   + VCG+DG  Y N+C L K  C+++  + + N     + PC+ +    P      Q+C         +N  +     +  CP   Q    N   +Y+  C+     C  K           +P +  + GI  E         C   G    DC        + +   C C T  + GL  +VC    K       M M+ C++   A           C +  C F + C +    +  C CP+ DC V  +  VCGSD  TY ++C LK  +C +++ I     G C
Sbjct:  365 PCLDKVCKHGAVCVVKNNEP---VCECPEA-CQLTSD--PVCGSDGHSYGSPCEMRAMGCAFQKTIHIQHKGLCDEACA-----NCSFGAICDLQS------------KRCVCPSE-CVKSRQPVCGSDGNTYDSECELHVKACTQQTDLQVVSQGACKTCGPTVCAWGALC------VQNKCEC----QQCVGEALSPLCGSDGKTYDNECELRRSSCLQNKKIDVEKDGSCDEDCGSGGSGSGAESCEQDRCRKYGGTWDEDAEDDRCVCDF-SCESVPHNAVCGSDGKNYSNECELKKAGCDRRELVSIQN-----HGPCAALSAVTPTALTAAQHCSQSAHGCCSDNATAALGAGQAGCPSTCQ---CNLYGSYKGTCDPATGQCSCKPGVGGQKCDRCEPGFWNFRGIVTENMSGCTPCSCDPVGSIRDDC--------EQMSGLCSCKTAVK-GLKCNVCPDGSK-------MGMNGCDSGPEAP--------GSCADLVCGFGATCIVVNG-QAHCECPSPDCDVKNKTKVCGSDGVTYADQCQLKTIACRQDKDILVAHTGQC 867          

HSP 4 Score: 89.3521 bits (220), Expect = 3.159e-17
Identity = 100/455 (21.98%), Postives = 179/455 (39.34%), Query Frame = 1
Query: 2494 RCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAK----SYWSGNAENYLSINISLVPYSSDGIIFYHSD-TDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV-------SHIWKFKDNSFVIF-------------PSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNH 3783
            +C  G+W       T C+  R    +  C+  +    C+ L  G Y  VCP+G      G     + E +  A    F  DS+ +      +  +    +S+ + L+   SDG+IFY+   TD   D++++ L N  +E+R DLG G   ++S+  L +   ++I +ER  R   + I+      G +P   ++L+      +G A  P  + L+    +T+GF G +           KI LM+                P +  +N++           S       + +  + +PC NGG C       Y C C PGY G  C   +       +    F   +F+ +             P E   L    K E++    A +GLL +   G +R+  +I++ +    +++T         L S       +W H+   +A +  +L + +
Sbjct: 1345 KCSKGFWG------TLCADVRDPCAASKCHATS---QCQVLPEGGYKCVCPMG----REGRHCEKVAERR-GAYMPTFNGDSYLELKGLHLYGHDLRQKVSMMVVLMANDSDGLIFYNGQKTDGKGDFISLGLNNGILEFRYDLGKGPAIIRSKAPLPLKVWNTINLERSLRKGEIRINDQQPARGESPAVHSDLNLKESLFVGGA--PDYSKLARAAGLTEGFKGTVQ----------KIMLMSD---------------PVLKEENAL-----------SSSNVAMFQGHPCSQEPCQNGGRCNPML-ATYECSCFPGYVGDNCSVAIHEKSAGETEAVAFDGRTFIEYHNGVTKSQLTNEIPDEKALLVN--KFELSIRTEATHGLLLWSGKGVERS-DYIALAIVDGRVQMTYDLGSRPVVLRSSVRVNTNRWIHIKASRALRDGFLQVGN 1743          

HSP 5 Score: 70.4774 bits (171), Expect = 1.722e-11
Identity = 58/251 (23.11%), Postives = 107/251 (42.63%), Query Frame = 1
Query: 3340 KIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSH-IWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQ---NSDIILNNITQWQGPPCGPLQSPC 4080
            K +  C +H PCL+GG C+      YSC+C  G  G  CE+V+ + I  F   S++ FP+  ++    +++ + F     NG+L +  +G   +  FIS+TL    +E+   T  G   L S      G W+ V + +  +   L+++  P    +       LN+++               +F GGV  +     +    +     G I+ + +N+  +  Q      +  + + +    PC P  +PC
Sbjct: 1100 KTQRPCDSH-PCLHGGTCEDDGS-TYSCRCPAGRGGPVCEKVMKYFIPSFGGQSYLAFPT--MKAYHTVRIAMAFRASEMNGVLLY--NGQRGSKDFISLTLVNGKVELRFNTGSGTGTLTSKVKVSQGHWHQVEVTRNRRNGVLSVDGEPDVQGESPHGTDGLNLDT--------------ELFIGGVTEDLKQDVTARTGVSAGLVGCIRMLDVNNRMLNLQEDGGDSLFGSGVGECGNNPCEP--NPC 1328          
BLAST of Agrin, putative vs. Ensembl Medaka
Match: agrn (agrin [Source:NCBI gene;Acc:101156494])

HSP 1 Score: 313.538 bits (802), Expect = 5.383e-86
Identity = 247/760 (32.50%), Postives = 355/760 (46.71%), Query Frame = 1
Query:  559 CKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNP---YPYCKCPNDKCDSSSSQ-ICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENN---PCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPT-CPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCR-----------NGQCVCTDKCSKVKLR-VCGTDGNYYENECELKRKACIDNKTIR------------VAPSVI-----------GCISHNYIADEKNKRS-----CLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNF----TEN--GCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGC 2676
            C FGA C++ P +P  A C C    C +      VCGSD   Y + C M+R +C  Q+ I+V     C  K+             C   +C   +TCV +       C CP   CD  + + +CG+D   Y + CE+ + +CK  + I  Q++G CD CK  +   N +C +  + L       +P E C      P+C SD  TY +ECH+     +K I L  ++ G+C+   + D C + +C + A C+       +CSCD L+C +T++ P+CG +G  Y N C   K  CE +  + + +   C+ N   PC    C      C + NN +  CECP E C     PVCG+D  +Y S C +    C  +K + I + G+C+E         +C    IC  DL   +C CP+ C +S   + VCG+DG TY SEC + + AC T    L++ + G C  C    C++ ++C  N+    QC+          P+CGSD +TY+NEC L+  SC +N+ I    +G C             E C   + CR           + +CVC   C  V    VCG+DG  Y NECELK+  C   + +             V P+ +           GC S N  A     ++     C CN  GS    CDP+T QC CK G+ GQ CDRC  G+WNF    TEN  GCT CSC+  GS    C   +G C+CK    G  C+VCP G  +  +GC
Sbjct:    3 CGFGAVCERDPADPAKADCVCKKGDCPS--LVAPVCGSDSSTYSNECEMERAQCKAQRRIKVLRRGPCSLKDP------------CAEVTCSYGSTCVQSSDGLAAKCMCPLG-CDGKAGETVCGSDGNDYPSECELHQHACKNQKNIRVQHLGPCDPCKDAENSLNVLCRV--EALTRRPLLYSPPESCPPGDD-PLCASDGHTYPNECHMTATGVQKGIKLQKIHAGQCR---RLDECQD-ECLFNAVCVVEPEG-PRCSCDPLECDDTYK-PLCGRNGRTYTNDCLRRKAECEMKTLISIRSQGPCDLNTPSPCLDKVCKH-GAVCVVKNN-EPVCECP-EACQLTSDPVCGSDGHSYGSPCEMRAMGCAFQKTIHIQHKGLCDE------ACANCSFGAIC--DLQSKRCVCPSECVKSR--QPVCGSDGNTYDSECELHVKAC-TQQTDLQVVSQGACKTCGPTVCAWGALCVQNKCECQQCV-----GEALSPLCGSDGKTYDNECELRRSSCLQNKKIDVEKDGSCDEDCGSGGSGSGAESCEQDR-CRKYGGTWDEDAEDDRCVCDFSCESVPHNAVCGSDGKNYSNECELKKAGCDRRELVSIQNHGPCAALSAVTPTALTAAQHCSQSAHGCCSDNATAALGAGQAGCPSTCQCNLYGSYKGTCDPATGQCSCKPGVGGQKCDRCEPGFWNFRGIVTENMSGCTPCSCDPVGSIRDDCEQMSGLCSCKTAVKGLKCNVCPDGSKMGMNGC 718          

HSP 2 Score: 150.214 bits (378), Expect = 9.998e-36
Identity = 163/708 (23.02%), Postives = 298/708 (42.09%), Query Frame = 1
Query: 2725 FLKDSFAKSYWS-GNAENYLSINISLVPYSSD--GIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKP----NCPHIDFKNSVDVIEDPDKEEQSEKENLK------------IKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV----SHIWKFKDNSFVIFPSESL---QLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKH--ENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNT--LATDGWMWLGGAKK--PVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 4752
            F+     +SY +    + Y ++ I++   +S+  G++ Y+     S D++++ L N  VE R + GSG   L S+V+++ G  H + V R  R+  L +DG     G +P     L+      IG  T  +   ++    V+ G VGC+  L +      ++  + +     +  S V       C     KN         + +++E    K            ++D C   K C     CQ   E  Y C C  G +G  CE+V     +++  F  +S++      L    LRQ++ + +  +   ++GL+ +     D    FIS+ LN   LE       G   + S     +  WN + + ++ +   + +N   QP +          V+S ++ K        + +F GG     ++  +    L   F G +QKI++  + +  + + +  +N+  +QG PC   Q PC       G C P +    C+C P +  +N  +     H+  A       + G++  +Y     K +K+   N   +  +T +  G+L+   K          +AI +G +++  +LG +  VLR   +  ++ N+W  ++  R  R+  L + +    A +  ++      L TDG +WLGG ++       P  Y+T F GCI ++ VD +  +LV DA  N   IL C
Sbjct: 1203 FIPSFGGQSYLAFPTMKAYHTVRIAMAFRASEMNGVLLYNGQRG-SKDFISLTLVNGKVELRFNTGSGTGTLTSKVKVSQGHWHQVEVTRNRRNGVLSVDGEPDVQGESPHGTDGLNLDTELFIGGVTEDLKQDVTARTGVSAGLVGCIRMLDVN----NRMLNLQEDGGDSLFGSGVGECGNNPCEPNPCKNGAQC-----QVKEAEMFQCKCSKGFWGTLCADVRDPCAASK-CHATSQCQVLPEGGYKCVCPMGREGRHCEKVAERRGAYMPTFNGDSYLELKGLHLYGHDLRQKVSMMVVLMANDSDGLIFYNGQKTDGKGDFISLGLNNGILEFRYDLGKGPAIIRSKAPLPLKVWNTINLERSLRKGEIRINDQ-QPARGE-----SPAVHSDLNLK--------ESLFVGGA--PDYSKLARAAGLTEGFKGTVQKIMLMSDPVLKEENALSSSNVAMFQGHPCS--QEPCQN----GGRCNPMLATYECSCFPGYVGDNCSV---AIHEKSAGETEAVAFDGRTFIEYHNGVTKSEKALLVNKFELSIRTEATHGLLLWSGKGVERSDYI-ALAIVDGRVQMTYDLGSRPVVLR--SSVRVNTNRWIHIKASRALRDGFLQVGNE---AAVTGSSPLAATQLDTDGALWLGGLEELAVARRLPKAYSTGFVGCIKDVVVDGVELHLVEDAL-NSPKILHC 1867          

HSP 3 Score: 109.768 bits (273), Expect = 1.795e-23
Identity = 147/584 (25.17%), Postives = 221/584 (37.84%), Query Frame = 1
Query:  541 PCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQ-------TKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDP-----YQYCR------IDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTK-----------KPLWIIYNGICNEEPR------CKEQGK---DCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPT-DC-VYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCP 2172
            PC    CK GA C      P   VC C    CQ       VCGSDG  Y S C M+   C  QK+I +    +C    A     + S    C  QS              C CP++ C  S   +CG+D  TY + CE+   +C     ++    G C  C    C +  +C      +   C+C    + C      P+CGSD  TY +EC L+  SC +   + V   G C        +   ++ C   +C              +C CD+  C++   + VCG+DG  Y N+C L K  C+++  + + N     + PC+ +    P      Q+C         +N  +     +  CP   Q    N   +Y+  C+     C  K           +P +  + GI  E         C   G    DC        + +   C C T  + GL  +VC    K       M M+ C++   A           C +  C F + C +    +  C CP+ DC V  +  VCGSD  TY ++C LK  +C +++ I     G C     +P +   P
Sbjct:  294 PCLDKVCKHGAVCVVKNNEP---VCECPEA-CQLTSD--PVCGSDGHSYGSPCEMRAMGCAFQKTIHIQHKGLCDEACA-----NCSFGAICDLQS------------KRCVCPSE-CVKSRQPVCGSDGNTYDSECELHVKACTQQTDLQVVSQGACKTCGPTVCAWGALC------VQNKCEC----QQCVGEALSPLCGSDGKTYDNECELRRSSCLQNKKIDVEKDGSCDEDCGSGGSGSGAESCEQDRCRKYGGTWDEDAEDDRCVCDF-SCESVPHNAVCGSDGKNYSNECELKKAGCDRRELVSIQN-----HGPCAALSAVTPTALTAAQHCSQSAHGCCSDNATAALGAGQAGCPSTCQ---CNLYGSYKGTCDPATGQCSCKPGVGGQKCDRCEPGFWNFRGIVTENMSGCTPCSCDPVGSIRDDC--------EQMSGLCSCKTAVK-GLKCNVCPDGSK-------MGMNGCDSGPEAPG--------SCADLVCGFGATCIVVNG-QAHCECPSPDCDVKNKTKVCGSDGVTYADQCQLKTIACRQDKDILVAHTGQCTESIFEPADPHPP 809          

HSP 4 Score: 92.4337 bits (228), Expect = 3.267e-18
Identity = 98/445 (22.02%), Postives = 180/445 (40.45%), Query Frame = 1
Query: 2494 RCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAK----SYWSGNAENYLSINISLVPYSSDGIIFYHSD-TDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVV-------SHIWKFKDNSFVIFPSESLQLRQRL---KLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNH 3783
            +C  G+W       T C+  R    +  C+  +    C+ L  G Y  VCP+G      G     + E +  A    F  DS+ +      +  +    +S+ + L+   SDG+IFY+   TD   D++++ L N  +E+R DLG G   ++S+  L +   ++I +ER  R   + I+      G +P   ++L+      +G A  P  + L+    +T+GF G +           KI LM+                P +  +N++           S       + +  + +PC NGG C       Y C C PGY G  C   +       +    F   +F+ + +   +  + L   K E++    A +GLL +   G +R+  +I++ +    +++T         L S       +W H+   +A +  +L + +
Sbjct: 1405 KCSKGFWG------TLCADVRDPCAASKCHATS---QCQVLPEGGYKCVCPMG----REGRHCEKVAERR-GAYMPTFNGDSYLELKGLHLYGHDLRQKVSMMVVLMANDSDGLIFYNGQKTDGKGDFISLGLNNGILEFRYDLGKGPAIIRSKAPLPLKVWNTINLERSLRKGEIRINDQQPARGESPAVHSDLNLKESLFVGGA--PDYSKLARAAGLTEGFKGTVQ----------KIMLMSD---------------PVLKEENAL-----------SSSNVAMFQGHPCSQEPCQNGGRCNPML-ATYECSCFPGYVGDNCSVAIHEKSAGETEAVAFDGRTFIEYHNGVTKSEKALLVNKFELSIRTEATHGLLLWSGKGVERS-DYIALAIVDGRVQMTYDLGSRPVVLRSSVRVNTNRWIHIKASRALRDGFLQVGN 1795          

HSP 5 Score: 70.0922 bits (170), Expect = 2.229e-11
Identity = 58/251 (23.11%), Postives = 107/251 (42.63%), Query Frame = 1
Query: 3340 KIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSH-IWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQ---NSDIILNNITQWQGPPCGPLQSPC 4080
            K +  C +H PCL+GG C+      YSC+C  G  G  CE+V+ + I  F   S++ FP+  ++    +++ + F     NG+L +  +G   +  FIS+TL    +E+   T  G   L S      G W+ V + +  +   L+++  P    +       LN+++               +F GGV  +     +    +     G I+ + +N+  +  Q      +  + + +    PC P  +PC
Sbjct: 1160 KTQRPCDSH-PCLHGGTCEDDGS-TYSCRCPAGRGGPVCEKVMKYFIPSFGGQSYLAFPT--MKAYHTVRIAMAFRASEMNGVLLY--NGQRGSKDFISLTLVNGKVELRFNTGSGTGTLTSKVKVSQGHWHQVEVTRNRRNGVLSVDGEPDVQGESPHGTDGLNLDT--------------ELFIGGVTEDLKQDVTARTGVSAGLVGCIRMLDVNNRMLNLQEDGGDSLFGSGVGECGNNPCEP--NPC 1388          

HSP 6 Score: 55.8398 bits (133), Expect = 4.504e-7
Identity = 49/208 (23.56%), Postives = 84/208 (40.38%), Query Frame = 1
Query: 2584 IETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSG--NAENYLSIN---ISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDA-GFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGE 3189
            + T +C+C P  +G  CSV               +I+E      E           Y +G   +E  L +N   +S+   ++ G++ +       SDY+ + + +  V+   DLGS  + L+S V++   R   I   R  RD  L +    +  G +P   T LD  G ++  G     +   L      + GFVGC+  + +   E
Sbjct: 1661 LATYECSCFPGYVGDNCSV---------------AIHEKSAGETEAVAFDGRTFIEYHNGVTKSEKALLVNKFELSIRTEATHGLLLWSGKGVERSDYIALAIVDGRVQMTYDLGSRPVVLRSSVRVNTNRWIHIKASRALRDGFLQVGNEAAVTGSSPLAATQLDTDGALWLGGLEELAVARRLPKA--YSTGFVGCIKDVVVDGVE 1851          
BLAST of Agrin, putative vs. Ensembl Medaka
Match: EGFLAM (EGF like, fibronectin type III and laminin G domains [Source:NCBI gene;Acc:101173710])

HSP 1 Score: 123.25 bits (308), Expect = 1.043e-27
Identity = 144/660 (21.82%), Postives = 261/660 (39.55%), Query Frame = 1
Query: 2764 NAENYLSINISLVPYSSDGIIFYHSDTDRS-SDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEE---VVSHIWKFKDNSFVI--FPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFR--KYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXV-IAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISELYVDEISYNLVL 4716
            N+     I +     S DG++ Y  + +    D+ ++ L    + YR + G+GA  + S  Q+ +GR H++ V R      L +D      G +    T +       +G +  P    L        GF GC+ SL I                                    VD+   P  +  S  +  +  D       C NGG+C  +  + Y C C  G++G+ CEE   + S ++     S+ +  +P         ++ E+TF P   +G+L +  D    +  F+++ +   ++E       G   + S E   +  W+ + + + AK   L ++   Q   + +    F  +N             + P++ GGV  +   +      LKP F G IQK+++ND  I          N+      PC  + SPC+      G C P+ +   C C   ++        +H   A T      +++G+S   Y      +  S ++ N+ ++F++ + DG+L+          S  + + +++G I  + NLG  +GV  I  N   SD KWH V+ +R+ ++  L +DD   +           L  +G +++GG K+       +Y     GC+S   +    Y+L L
Sbjct:  351 NSYQTFQITLDFKANSEDGLLLYCGENEHGRGDFASLALIRGKIHYRFNCGTGAAQIVSESQIVVGRWHTVTVFRDGMSGWLRLDNDTPISGRSQGQYTKITFRSQLYLGGS--PSTYWLVRATGTNRGFEGCVQSLTIN--------------------------------NKVVDLRPWPLGKALSGADIGECSDSVCNQVSCANGGVCFANRADGYICLCPLGFRGLLCEESFLLSSPLFNETVFSYAVIPWPQRPQNYLSFMEFEVTFWPSTPDGVLLYSDDAASGD--FLAINIVDKYVEFRFDCGSGEAVIRSDEQISLDSWHELRVTRTAKSGILQVDS--QRAVEGISEGAFTQINC------------SSPLYIGGV-PHYDKTKRTARVLKP-FTGIIQKLILNDRTISITAGSAGGVNVIN-SAHPC--VDSPCAN----GGTCRPKWDGYECDCPLGYDG-------RHCQKAVTEAIEIPQFIGRSYLTYDNRDILKRVSGSRTNLFMRFRSTAKDGLLLWRGDSPLRSNSDFLSMGLQDGNIVFSYNLG--SGVASIVVNGTFSDGKWHKVKAVRDGQSGKLTVDDYGAKTGR-SPGKMRQLNINGPLYVGGMKEIALHTNRQYFGGLVGCVSHFTL-STDYHLAL 940          

HSP 2 Score: 90.5077 bits (223), Expect = 1.006e-17
Identity = 103/436 (23.62%), Postives = 177/436 (40.60%), Query Frame = 1
Query: 2629 YCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSI---NISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVS---HIWKFKDNSFVIFPSESLQLR---QRLKLEITFLPLANNGLLSFISDGHDR-NPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNS-LVSRKLTQFRIKNQPIFFGGV 3903
            Y  +CP+G+      C+E+ +  + +   E  F   S+A   W    +NYLS     ++  P + DG++ Y SD   S D+L I + ++YVE+R D GSG   ++S  Q+++   H + V R  +   L +D   +  G++    T ++      IG    P  +    T  V   F G +  L           ++N +T  I   S              V+VI        S               PC NGG C+   +  Y C C  GY G  C++ V+    I +F   S++ + +  +  R    R  L + F   A +GLL +  D   R N  F+S+ L   ++  +     GV  ++   +   GKW+ V  ++  +   L ++       +       LN+N  L    + +  +     +FGG+
Sbjct:  535 YICLCPLGFR--GLLCEESFLLSSPL-FNETVF---SYAVIPWPQRPQNYLSFMEFEVTFWPSTPDGVLLY-SDDAASGDFLAINIVDKYVEFRFDCGSGEAVIRSDEQISLDSWHELRVTRTAKSGILQVDSQRAVEGISEGAFTQINCSSPLYIGGV--PHYDKTKRTARVLKPFTGIIQKL-----------ILNDRTISITAGS-----------AGGVNVINSAHPCVDS---------------PCANGGTCRPKWDG-YECDCPLGYDGRHCQKAVTEAIEIPQFIGRSYLTYDNRDILKRVSGSRTNLFMRFRSTAKDGLLLWRGDSPLRSNSDFLSMGLQDGNIVFSYNLGSGVASIVVNGTFSDGKWHKVKAVRDGQSGKLTVDDYGAKTGRSPGKMRQLNINGPLYVGGMKEIALHTNRQYFGGL 923          
BLAST of Agrin, putative vs. Ensembl Medaka
Match: EGFLAM (EGF like, fibronectin type III and laminin G domains [Source:NCBI gene;Acc:101173710])

HSP 1 Score: 122.479 bits (306), Expect = 1.709e-27
Identity = 144/660 (21.82%), Postives = 261/660 (39.55%), Query Frame = 1
Query: 2764 NAENYLSINISLVPYSSDGIIFYHSDTDRS-SDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEE---VVSHIWKFKDNSFVI--FPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFR--KYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXV-IAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISELYVDEISYNLVL 4716
            N+     I +     S DG++ Y  + +    D+ ++ L    + YR + G+GA  + S  Q+ +GR H++ V R      L +D      G +    T +       +G +  P    L        GF GC+ SL I                                    VD+   P  +  S  +  +  D       C NGG+C  +  + Y C C  G++G+ CEE   + S ++     S+ +  +P         ++ E+TF P   +G+L +  D    +  F+++ +   ++E       G   + S E   +  W+ + + + AK   L ++   Q   + +    F  +N             + P++ GGV  +   +      LKP F G IQK+++ND  I          N+      PC  + SPC+      G C P+ +   C C   ++        +H   A T      +++G+S   Y      +  S ++ N+ ++F++ + DG+L+          S  + + +++G I  + NLG  +GV  I  N   SD KWH V+ +R+ ++  L +DD   +           L  +G +++GG K+       +Y     GC+S   +    Y+L L
Sbjct:  451 NSYQTFQITLDFKANSEDGLLLYCGENEHGRGDFASLALIRGKIHYRFNCGTGAAQIVSESQIVVGRWHTVTVFRDGMSGWLRLDNDTPISGRSQGQYTKITFRSQLYLGGS--PSTYWLVRATGTNRGFEGCVQSLTIN--------------------------------NKVVDLRPWPLGKALSGADIGECSDSVCNQVSCANGGVCFANRADGYICLCPLGFRGLLCEESFLLSSPLFNETVFSYAVIPWPQRPQNYLSFMEFEVTFWPSTPDGVLLYSDDAASGD--FLAINIVDKYVEFRFDCGSGEAVIRSDEQISLDSWHELRVTRTAKSGILQVDS--QRAVEGISEGAFTQINC------------SSPLYIGGV-PHYDKTKRTARVLKP-FTGIIQKLILNDRTISITAGSAGGVNVIN-SAHPC--VDSPCAN----GGTCRPKWDGYECDCPLGYDG-------RHCQKAVTEAIEIPQFIGRSYLTYDNRDILKRVSGSRTNLFMRFRSTAKDGLLLWRGDSPLRSNSDFLSMGLQDGNIVFSYNLG--SGVASIVVNGTFSDGKWHKVKAVRDGQSGKLTVDDYGAKTGR-SPGKMRQLNINGPLYVGGMKEIALHTNRQYFGGLVGCVSHFTL-STDYHLAL 1040          

HSP 2 Score: 90.5077 bits (223), Expect = 1.128e-17
Identity = 103/436 (23.62%), Postives = 177/436 (40.60%), Query Frame = 1
Query: 2629 YCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSI---NISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVS---HIWKFKDNSFVIFPSESLQLR---QRLKLEITFLPLANNGLLSFISDGHDR-NPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNS-LVSRKLTQFRIKNQPIFFGGV 3903
            Y  +CP+G+      C+E+ +  + +   E  F   S+A   W    +NYLS     ++  P + DG++ Y SD   S D+L I + ++YVE+R D GSG   ++S  Q+++   H + V R  +   L +D   +  G++    T ++      IG    P  +    T  V   F G +  L           ++N +T  I   S              V+VI        S               PC NGG C+    + Y C C  GY G  C++ V+    I +F   S++ + +  +  R    R  L + F   A +GLL +  D   R N  F+S+ L   ++  +     GV  ++   +   GKW+ V  ++  +   L ++       +       LN+N  L    + +  +     +FGG+
Sbjct:  635 YICLCPLGFR--GLLCEESFLLSSPL-FNETVF---SYAVIPWPQRPQNYLSFMEFEVTFWPSTPDGVLLY-SDDAASGDFLAINIVDKYVEFRFDCGSGEAVIRSDEQISLDSWHELRVTRTAKSGILQVDSQRAVEGISEGAFTQINCSSPLYIGGV--PHYDKTKRTARVLKPFTGIIQKL-----------ILNDRTISITAGS-----------AGGVNVINSAHPCVDS---------------PCANGGTCR-PKWDGYECDCPLGYDGRHCQKAVTEAIEIPQFIGRSYLTYDNRDILKRVSGSRTNLFMRFRSTAKDGLLLWRGDSPLRSNSDFLSMGLQDGNIVFSYNLGSGVASIVVNGTFSDGKWHKVKAVRDGQSGKLTVDDYGAKTGRSPGKMRQLNINGPLYVGGMKEIALHTNRQYFGGL 1023          
BLAST of Agrin, putative vs. Planmine SMEST
Match: SMESG000028865.1 (SMESG000028865.1)

HSP 1 Score: 3066.56 bits (7949), Expect = 0.000e+0
Identity = 1541/1566 (98.40%), Postives = 1541/1566 (98.40%), Query Frame = 1
Query:  103 MMXXXXXXXXGFQRNVLSTDCDLSNQFNQKIESSDLIIVGRVLNLANSEVIVSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDFIMYLKKTEQNNFFELNYAKEFGNGLFEKRISVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEY----------------RVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 4752
            MMLLVLLLFLGFQRNVLSTDCDLSNQFNQKIESSDLIIVGRVLNLANSEVIVSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDFIMYLKKTEQNNFFELNYAKEFGNGLFEKRISVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK         RCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEY                RVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDSNTFNSFSNVVSLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMLILLKKIYSIKKSFLVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC
Sbjct:    1 MMLLVLLLFLGFQRNVLSTDCDLSNQFNQKIESSDLIIVGRVLNLANSEVIVSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDFIMYLKKTEQNNFFELNYAKEFGNGLFEKRISVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK---------RCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYSDKIIHIIIVHYYTYFRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDSNTFNSFSNVVSLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMLILLKKIYSIKKSFLVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 1557          
BLAST of Agrin, putative vs. Planmine SMEST
Match: SMESG000028865.1 (SMESG000028865.1)

HSP 1 Score: 3065.02 bits (7945), Expect = 0.000e+0
Identity = 1531/1556 (98.39%), Postives = 1531/1556 (98.39%), Query Frame = 1
Query:  133 GFQRNVLSTDCDLSNQFNQKIESSDLIIVGRVLNLANSEVIVSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDFIMYLKKTEQNNFFELNYAKEFGNGLFEKRISVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEY----------------RVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 4752
            GFQRNVLSTDCDLSNQFNQKIESSDLIIVGRVLNLANSEVIVSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDFIMYLKKTEQNNFFELNYAKEFGNGLFEKRISVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK         RCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEY                RVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDSNTFNSFSNVVSLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMLILLKKIYSIKKSFLVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC
Sbjct:   10 GFQRNVLSTDCDLSNQFNQKIESSDLIIVGRVLNLANSEVIVSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDFIMYLKKTEQNNFFELNYAKEFGNGLFEKRISVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK---------RCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYSDKIIHIIIVHYYTYFRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDSNTFNSFSNVVSLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMLILLKKIYSIKKSFLVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 1556          
BLAST of Agrin, putative vs. Planmine SMEST
Match: SMESG000028865.1 (SMESG000028865.1)

HSP 1 Score: 3027.27 bits (7847), Expect = 0.000e+0
Identity = 1526/1566 (97.45%), Postives = 1526/1566 (97.45%), Query Frame = 1
Query:  103 MMXXXXXXXXGFQRNVLSTDCDLSNQFNQKIESSDLIIVGRVLNLANSEVIVSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDFIMYLKKTEQNNFFELNYAKEFGNGLFEKRISVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEY----------------RVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 4752
            MMLLVLLLFLGFQRNVLSTDCDLSNQFNQKIESSDLIIVGRVLNLANSEVIVSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDFIMYLKKTEQNNFFELNYAKEFGNGLFEKRISVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK         RCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEY                RVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRL               LTQFRIKNQPIFFGGVDSNTFNSFSNVVSLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMLILLKKIYSIKKSFLVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC
Sbjct:    1 MMLLVLLLFLGFQRNVLSTDCDLSNQFNQKIESSDLIIVGRVLNLANSEVIVSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDFIMYLKKTEQNNFFELNYAKEFGNGLFEKRISVFLNGATSKQVQNDDPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK---------RCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYSDKIIHIIIVHYYTYFRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRL---------------LTQFRIKNQPIFFGGVDSNTFNSFSNVVSLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMLILLKKIYSIKKSFLVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 1542          
BLAST of Agrin, putative vs. Planmine SMEST
Match: SMESG000028859.1 (SMESG000028859.1)

HSP 1 Score: 2135.92 bits (5533), Expect = 0.000e+0
Identity = 1085/1207 (89.89%), Postives = 1117/1207 (92.54%), Query Frame = 1
Query: 1138 VCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFC--ENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 4752
            VCG++   Y + CHL+ E+C   I + + Y G C        CS + C +   C   +N   +C C    CK+  +D +CG+ G  YDN C L    C+    ++++N   C  ENNPC+GVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQ K+CPSYQICKSDLVQ KCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCIS NYIADEKNK+SCLCNSIGSLN+ECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCN ETGKCNCKPLAMGKYCSVCPIGYSISNHGCK+NSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSG   LKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDV DGFVGCLSSLKITAGEETKIY MNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSS++MYSCQCLPGYQGI CEEVVSHIWKFKDNSFVIFPSES+QLRQRLKLEITFLPLANNGLLSFISDGHDRN AFISVTLNKN LEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRL               LTQFRIKNQP+FFGGVDSNTFNSFSNVVSLKPNF GAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNP+NTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMLILLKKIYSIKKSFLVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWH+VQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTL TDGWMWLGGAK PVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPIL+C
Sbjct:   74 VCGTNLKQYATVCHLRREACTLMIDIGIKYHGLCNP------CSLVNCSHNM-CSLDANRKPKCDCPST-CKDDPKDLLCGSSGKTYDNLCLLNLDKCQTGQHIYIVNKGPCQFENNPCNGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQEKECPSYQICKSDLVQTKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCISQNYIADEKNKKSCLCNSIGSLNNECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNTETGKCNCKPLAMGKYCSVCPIGYSISNHGCKKNSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGVNLLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVIDGFVGCLSSLKITAGEETKIYRMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSKKMYSCQCLPGYQGIICEEVVSHIWKFKDNSFVIFPSESVQLRQRLKLEITFLPLANNGLLSFISDGHDRNTAFISVTLNKNQLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRL---------------LTQFRIKNQPLFFGGVDSNTFNSFSNVVSLKPNFNGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPSNTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMLILLKKIYSIKKSFLVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHSVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLETDGWMWLGGAKIPVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILKC 1257          

HSP 2 Score: 138.272 bits (347), Expect = 2.053e-32
Identity = 154/519 (29.67%), Postives = 233/519 (44.89%), Query Frame = 1
Query:  538 DPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQK--EISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDI----CKFVKC-EFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKC----QTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDC-KNTWRDPVCGNDGIIYDNKCFLMKMSCE-KQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICN------EEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETN-SIALKIANIG------TCDKCKNKKCSFYSICQMNRFLEP---QCICPT 2007
            +PC   +CK+ A C     N  +A C C  +    G      SVCG++   Y + C ++R+ C L   I +  + +C       +  S  N   C H  C   A    N  P C CP+   D     +CG+   TY N+C +    C+  + I     G C      C  VKC +    C +  +G  T C+CP   E C K +Q PVCG+D VTY+S C+L   +C  K  L ++Y G C    + K Q   C + Q           + + Q  C+   C ++   + VCG DG  Y ++C +   +CE   + + + N   C+   C   KC   Y  C+++   +  C CP + C  + +PVCG+D  TYE+ C L   +C   + +  +  G C       +E RC E   DCP  ++C++     +C C T   S +   VCGTDG  Y++EC ++  AC  N +I +  + IG        D+   K C   SI  +N   +P   QCIC T
Sbjct:   32 NPCLNHSCKYQAWCIP-NSNFTSANCICYTSCFDVGDSTDSESVCGTNLKQYATVCHLRREACTLMIDIGIKYHGLC-------NPCSLVN---CSHNMCSLDA----NRKPKCDCPSTCKDDPKDLLCGSSGKTYDNLCLLNLDKCQTGQHIYIVNKGPCQFENNPCNGVKCPDPYQYCRIDNNGKST-CECPK--EPCPKIVQ-PVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQEKECPSYQI--------CKSDLVQTKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDK--CKNKKC-SFYSICQMNRFLEPQCICPTD-CVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPE---DCPLGKMCRN----GQCVC-TDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCISQNYIADEKNKKSCLCNSIGSLNNECDPSTTQCICKT 511          
BLAST of Agrin, putative vs. Planmine SMEST
Match: SMESG000028859.1 (SMESG000028859.1)

HSP 1 Score: 2110.11 bits (5466), Expect = 0.000e+0
Identity = 1076/1207 (89.15%), Postives = 1108/1207 (91.80%), Query Frame = 1
Query: 1138 VCGSDDVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMHVINSNFC--ENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIGYSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSEEMYSCQCLPGYQGITCEEVVSHIWKFKDNSFVIFPSESLQLRQRLKLEITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSRKLTQFRIKNQPIFFGGVDXXXXXXXXXXXXLKPNFYGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMXXXXXXXXXXXXXXXVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWMWLGGAKKPVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC 4752
            VCG++   Y + CHL+ E+C   I + + Y G C        CS + C +   C   +N   +C C    CK+  +D +CG+ G  YDN C L    C+    ++++N   C  ENNPC+GVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQ K+CPSYQICKSDLVQ KCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK         RCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCIS NYIADEKNK+SCLCNSIGSLN+ECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCN ETGKCNCKPLAMGKYCSVCPIGYSISNHGCK+NSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSG   LKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDV DGFVGCLSSLKITAGEETKIY MNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSS++MYSCQCLPGYQGI CEEVVSHIWKFKDNSFVIFPSES+QLRQRLKLEITFLPLANNGLLSFISDGHDRN AFISVTLNKN LEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRL               LTQFRIKNQP+FFGGVDSNTFNSFSNVVSLKPNF GAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNP+NTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMLILLKKIYSIKKSFLVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWH+VQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTL TDGWMWLGGAK PVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPIL+C
Sbjct:   74 VCGTNLKQYATVCHLRREACTLMIDIGIKYHGLCNP------CSLVNCSHNM-CSLDANRKPKCDCPST-CKDDPKDLLCGSSGKTYDNLCLLNLDKCQTGQHIYIVNKGPCQFENNPCNGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQEKECPSYQICKSDLVQTKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK---------RCPEDCPLGKMCRNGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCISQNYIADEKNKKSCLCNSIGSLNNECDPSTTQCICKTGITGQYCDRCIDGYWNFTENGCTACSCNRFGSESIVCNTETGKCNCKPLAMGKYCSVCPIGYSISNHGCKKNSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLVPYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGVNLLKSRVQLTIGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATGPIINTLSHTGDVIDGFVGCLSSLKITAGEETKIYRMNQQTSWIIESSNVKPNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTSSKKMYSCQCLPGYQGIICEEVVSHIWKFKDNSFVIFPSESVQLRQRLKLEITFLPLANNGLLSFISDGHDRNTAFISVTLNKNQLEVTCRTPIGVTRLISMESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRL---------------LTQFRIKNQPLFFGGVDSNTFNSFSNVVSLKPNFNGAIQKILINDENIRFQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPKHENLCIRNSMQHDNPSNTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRIKFKTASNDGMLILLKKIYSIKKSFLVIAIRNGVIEVAINLGGKNGVLRITGNKNISDNKWHSVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLETDGWMWLGGAKIPVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILKC 1248          

HSP 2 Score: 137.502 bits (345), Expect = 3.726e-32
Identity = 153/513 (29.82%), Postives = 231/513 (45.03%), Query Frame = 1
Query:  538 DPCSKLNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQK--EISVCGSDGIFYDSHCLMKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCVTNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQYVGRCDI----CKFVKC-EFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSDDVTYQSECHLKIESCKKKISLTVMYKGKC----QTKIQSDICSNIQCHYGAKCIKTSNTVAQCSCDYLDC-KNTWRDPVCGNDGIIYDNKCFLMKMSCE-KQMEMHVINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQICKSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETN-SIALKIANIG------TCDKCKNKKCSFYSICQMNRFLEP---QCICPT 2007
            +PC   +CK+ A C     N  +A C C  +    G      SVCG++   Y + C ++R+ C L   I +  + +C       +  S  N   C H  C   A    N  P C CP+   D     +CG+   TY N+C +    C+  + I     G C      C  VKC +    C +  +G  T C+CP   E C K +Q PVCG+D VTY+S C+L   +C  K  L ++Y G C    + K Q   C + Q           + + Q  C+   C ++   + VCG DG  Y ++C +   +CE   + + + N   C+   C   KC   Y  C+++   +  C CP + C  + +PVCG+D  TYE+ C L   +C   + +  +  G C    RC E   DCP  ++C++     +C C T   S +   VCGTDG  Y++EC ++  AC  N +I +  + IG        D+   K C   SI  +N   +P   QCIC T
Sbjct:   32 NPCLNHSCKYQAWCIP-NSNFTSANCICYTSCFDVGDSTDSESVCGTNLKQYATVCHLRREACTLMIDIGIKYHGLC-------NPCSLVN---CSHNMCSLDA----NRKPKCDCPSTCKDDPKDLLCGSSGKTYDNLCLLNLDKCQTGQHIYIVNKGPCQFENNPCNGVKCPDPYQYCRIDNNGKST-CECPK--EPCPKIVQ-PVCGNDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQEKECPSYQI--------CKSDLVQTKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALKIANIGTCDK--CKNKKC-SFYSICQMNRFLEPQCICPTD-CVYVRRPVCGSDDRTYENECFLKVKSCAENRLITAVSEGPCK---RCPE---DCPLGKMCRN----GQCVC-TDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIGCISQNYIADEKNKKSCLCNSIGSLNNECDPSTTQCICKT 502          
The following BLAST results are available for this feature:
BLAST of Agrin, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AGRN2.455e-8628.22agrin [Source:HGNC Symbol;Acc:HGNC:329][more]
AGRN3.382e-8530.10agrin [Source:HGNC Symbol;Acc:HGNC:329][more]
AGRN4.687e-8530.10agrin [Source:HGNC Symbol;Acc:HGNC:329][more]
AGRN4.863e-8530.10agrin [Source:HGNC Symbol;Acc:HGNC:329][more]
EGFLAM2.454e-3121.79EGF like, fibronectin type III and laminin G domai... [more]
back to top
BLAST of Agrin, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agr-12.065e-6828.99AGRin (Synaptic protein) homolog; AGRin (Synaptic ... [more]
lam-26.864e-1541.05Laminin-like protein lam-2 [Source:UniProtKB/Swis... [more]
lam-32.806e-1342.42LAMinin related. See also lmb; Laminin alpha chain... [more]
F29G6.15.510e-1323.67pep chromosome:WBcel235:X:11502267:11509432:1 gene... [more]
epi-16.294e-1343.18Laminin-like protein epi-1 [Source:UniProtKB/Swis... [more]
back to top
BLAST of Agrin, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SP23532.124e-2124.08gene:FBgn0034070 transcript:FBtr0087209[more]
SP23532.124e-2124.08gene:FBgn0034070 transcript:FBtr0340019[more]
CG323548.237e-2123.22gene:FBgn0052354 transcript:FBtr0076662[more]
wb2.071e-1633.33gene:FBgn0261563 transcript:FBtr0302731[more]
wb2.199e-1633.33gene:FBgn0261563 transcript:FBtr0305063[more]
back to top
BLAST of Agrin, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agrn3.761e-7630.73agrin [Source:ZFIN;Acc:ZDB-GENE-030131-1033][more]
agrn5.929e-7630.73agrin [Source:ZFIN;Acc:ZDB-GENE-030131-1033][more]
agrn1.690e-7430.09agrin [Source:ZFIN;Acc:ZDB-GENE-030131-1033][more]
agrn1.759e-7429.81agrin [Source:ZFIN;Acc:ZDB-GENE-030131-1033][more]
EGFLAM2.904e-2821.84EGF like, fibronectin type III and laminin G domai... [more]
back to top
BLAST of Agrin, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sos12.889e-8428.88SOS Ras/Rac guanine nucleotide exchange factor 1 [... [more]
sos13.786e-8428.88SOS Ras/Rac guanine nucleotide exchange factor 1 [... [more]
sos16.413e-8428.88SOS Ras/Rac guanine nucleotide exchange factor 1 [... [more]
sos16.481e-8428.98SOS Ras/Rac guanine nucleotide exchange factor 1 [... [more]
sos16.709e-8429.27SOS Ras/Rac guanine nucleotide exchange factor 1 [... [more]
back to top
BLAST of Agrin, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Agrn2.401e-8628.11agrin [Source:MGI Symbol;Acc:MGI:87961][more]
Agrn6.037e-8530.00agrin [Source:MGI Symbol;Acc:MGI:87961][more]
Agrn6.875e-8530.00agrin [Source:MGI Symbol;Acc:MGI:87961][more]
Agrn8.274e-8329.14agrin [Source:MGI Symbol;Acc:MGI:87961][more]
Egflam7.132e-2922.16EGF-like, fibronectin type III and laminin G domai... [more]
back to top
BLAST of Agrin, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P25304|AGRIN_RAT2.364e-8629.78Agrin OS=Rattus norvegicus OX=10116 GN=Agrn PE=1 S... [more]
sp|O00468|AGRIN_HUMAN1.673e-8528.22Agrin OS=Homo sapiens OX=9606 GN=AGRN PE=1 SV=6[more]
sp|A2ASQ1|AGRIN_MOUSE2.263e-8430.00Agrin OS=Mus musculus OX=10090 GN=Agrn PE=1 SV=1[more]
sp|P31696|AGRIN_CHICK1.222e-8028.45Agrin OS=Gallus gallus OX=9031 GN=AGRN PE=1 SV=3[more]
sp|A3KN33|EGFLA_BOVIN4.615e-3022.09Pikachurin OS=Bos taurus OX=9913 GN=EGFLAM PE=2 SV... [more]
back to top
BLAST of Agrin, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D6G2W89.155e-2198.39Agrin (Fragment) OS=Schmidtea mediterranea OX=7932... [more]
A0A4S2KB711.959e-17829.42Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4E0RI867.908e-16829.99Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A4S2KBC11.954e-16428.91Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5K4EU741.659e-16032.24Agrin, putative OS=Schistosoma mansoni OX=6183 PE=... [more]
back to top
BLAST of Agrin, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agrn1.318e-6727.91agrin [Source:ZFIN;Acc:ZDB-GENE-030131-1033][more]
agrn1.264e-6629.72agrin [Source:ZFIN;Acc:ZDB-GENE-030131-1033][more]
agrn1.851e-6629.72agrin [Source:ZFIN;Acc:ZDB-GENE-030131-1033][more]
EGFLAM6.500e-3021.80EGF like, fibronectin type III and laminin G domai... [more]
EGFLAM7.824e-3021.80EGF like, fibronectin type III and laminin G domai... [more]
back to top
BLAST of Agrin, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FST1.423e-2131.36follistatin [Source:HGNC Symbol;Acc:HGNC:3971][more]
tmeff2a4.798e-1232.00transmembrane protein with EGF-like and two follis... [more]
ENSPMAT00000007784.15.766e-1130.67pep scaffold:Pmarinus_7.0:GL477336:382472:417638:1... [more]
ENSPMAT00000000128.13.957e-934.62pep scaffold:Pmarinus_7.0:GL482156:314:14887:1 gen... [more]
ENSPMAT00000009682.16.619e-939.24pep scaffold:Pmarinus_7.0:GL479835:738:11671:-1 ge... [more]
back to top
BLAST of Agrin, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Agrin, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO403862.950e-5631.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403672.575e-3426.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403741.225e-2931.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384703.583e-2926.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO403833.227e-2827.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Agrin, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
agrn5.754e-8732.46agrin [Source:NCBI gene;Acc:101156494][more]
agrn6.516e-8732.38agrin [Source:NCBI gene;Acc:101156494][more]
agrn5.383e-8632.50agrin [Source:NCBI gene;Acc:101156494][more]
EGFLAM1.043e-2721.82EGF like, fibronectin type III and laminin G domai... [more]
EGFLAM1.709e-2721.82EGF like, fibronectin type III and laminin G domai... [more]
back to top
BLAST of Agrin, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028865.10.000e+098.40SMESG000028865.1[more]
SMESG000028865.10.000e+098.39SMESG000028865.1[more]
SMESG000028865.10.000e+097.45SMESG000028865.1[more]
SMESG000028859.12.053e-3289.89SMESG000028859.1[more]
SMESG000028859.13.726e-3289.15SMESG000028859.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021589 ID=SMED30021589|Name=Agrin, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=4897bp
TTGGTATTGACTTAGGCCATTATCTACGTCAACTCTAAAATCGATTTCAT
TTATCTGCGCAATAATTACTCATTGAGTGCTTAAGCATCTTATCAATCCA
TAATGATGCTACTGGTTCTCTTACTTTTCCTCGGGTTTCAAAGAAATGTT
TTATCCACTGATTGTGATTTGTCAAATCAATTCAACCAGAAAATCGAGTC
TTCTGATTTGATAATTGTTGGCCGTGTCTTGAATCTGGCCAATAGCGAAG
TGATAGTTTCCGTTATTCGAATATTAAAAGGATTCGATTTAATTAATGAA
GTGAAGAAAATAAGTCATGAAAATGACTACCATTTGATATTAGTAAGAAA
GATCAAATATATTATCAATTGCAAAATTTCTATAAAATCTGGTGAGGATT
TTATAATGTATTTAAAAAAGACTGAACAGAACAATTTCTTCGAACTGAAC
TATGCCAAAGAATTTGGAAATGGATTATTTGAGAAGCGCATCAGTGTGTT
TTTGAACGGTGCTACTAGTAAACAAGTGCAGAATGACGATCCTTGCAGCA
AACTTAATTGCAAATTTGGCGCACAGTGTCAGAAATGGCCAGGAAACCCT
CCAACTGCTGTATGCCATTGTTCAAATACGCAATGTCAAGCAGGGCAGAA
AGAAATTTCAGTCTGTGGCAGTGATGGGATATTTTACGACTCCCATTGTC
TTATGAAACGACAGGAATGTTTTTTACAAAAATCTATTCAGGTGTCCCCC
AATCATATTTGCGGTAGAAAAGAAGCGCAACAAGATGGAATTTCAAAATC
AAATGAACAGTTTTGCCAACATCAAAGCTGTCCACCATATGCTACTTGTG
TCACTAATCCGTACCCATACTGTAAATGCCCCAATGATAAATGTGACTCA
AGCAGTTCTCAAATTTGTGGCACTGACGAAATAACATACACAAATATATG
TGAAATGAAGAAAGTCAGTTGTAAAGCAAATCGGTTCATTGAACAACAAT
ACGTTGGAAGATGCGATATATGTAAATTTGTGAAATGCGAATTTAATGGC
ATATGCGAAATGATGGAGGACGGCCTTGGTACCATTTGCAAATGTCCAAA
TCCAGATGAGTTATGTACCAAAAACATCCAAGTACCAGTATGCGGTTCGG
ACGATGTTACATATCAAAGTGAATGTCATTTGAAAATTGAATCTTGTAAG
AAAAAAATTTCGCTCACTGTTATGTACAAAGGAAAATGTCAAACTAAAAT
ACAAAGTGACATATGCTCCAATATACAATGCCATTACGGAGCAAAATGTA
TTAAAACATCTAATACAGTTGCCCAATGTTCCTGTGACTACTTGGACTGC
AAAAATACTTGGAGGGATCCAGTTTGTGGAAATGATGGAATCATTTATGA
CAATAAATGCTTTCTAATGAAAATGTCTTGCGAAAAACAGATGGAAATGC
ATGTCATTAATTCTAACTTTTGCGAAAATAATCCATGTAGTGGGGTAAAA
TGTCCTGATCCATACCAATATTGTCGTATCGATAACAATGGAAAGAGTAC
ATGTGAATGTCCTAAAGAACCTTGTCCAAAAATCGTCCAACCTGTATGTG
GAAACGATAAAGTAACATATGAAAGTATCTGTAACCTAACGAGAACTGCA
TGTTTAACTAAAAAACCATTATGGATAATTTATAATGGAATTTGTAATGA
AGAACCGCGTTGCAAAGAGCAGGGCAAAGATTGTCCTTCTTACCAAATTT
GTAAATCCGATTTAGTGCAAGCTAAATGTGAATGTCCAACATGTCCTCAA
TCTGGACTTGGAGAATCTGTTTGTGGAACTGATGGAAAAACATATAAAAG
TGAATGCCATATGCGAATGCATGCTTGTGAAACCAATTCAATTGCTTTGA
AAATAGCAAACATAGGAACTTGTGATAAATGCAAAAACAAAAAATGCTCA
TTTTATTCGATATGCCAAATGAATCGTTTTCTTGAACCGCAGTGTATTTG
TCCGACAGATTGCGTTTATGTACGGAGACCTGTTTGTGGATCAGATGACA
GAACATATGAAAATGAATGTTTTCTTAAAGTCAAATCATGCGCTGAAAAC
CGACTTATTACCGCTGTTAGTGAAGGCCCATGCAAATTACAATTTATAAA
ACCTGATGAAGAAAGATGCCCCGAAGACTGCCCCCTTGGCAAGATGTGCA
GAAACGGACAATGCGTATGTACAGATAAATGCTCTAAAGTAAAATTACGG
GTATGTGGGACCGACGGGAATTACTATGAAAATGAATGCGAATTGAAAAG
AAAGGCCTGCATTGATAACAAAACCATTCGTGTTGCTCCATCTGTAATAG
GTTGTATTAGCCACAATTATATAGCTGATGAAAAAAACAAAAGATCGTGT
CTATGCAACAGCATCGGCTCATTGAACCACGAATGTGACCCAAGTACCAC
ACAGTGTATATGTAAAACAGGAATCACTGGCCAATATTGTGATAGGTGCA
TTGATGGATATTGGAATTTTACAGAAAATGGATGTACAGCATGTTCTTGT
AATAGATTTGGGTCGGAATCCATCGTATGTAACATTGAAACTGGGAAATG
TAATTGCAAGCCTCTAGCAATGGGCAAATACTGTTCAGTTTGTCCTATCG
GGTACTCTATATCAAATCATGGTTGCAAAGAAAATTCAATCTATGAAAAT
AAGGTCGATGCAGTTGAATTGGGGTTTTTGAAAGATTCATTTGCTAAATC
TTATTGGTCAGGAAATGCTGAAAATTATTTATCTATCAATATTTCTCTTG
TCCCATACAGTTCAGATGGAATCATTTTTTATCATTCTGATACAGACAGG
TCGTCAGATTATTTAACAATAGTCCTGAAAAATCGATATGTTGAATATAG
AGTTGATCTCGGAAGTGGAGCAATCTTTCTAAAAAGCCGAGTGCAGTTGA
CAATTGGAAGATCTCATTCTATATTAGTTGAAAGACTAAATAGAGATTCG
AGACTCGTTATAGATGGAACAGATTCTCAGTATGGAATGAATCCACCTTT
CCTAACCAATTTGGACGCCGGGTTTATTTTTACAATTGGACAAGCTACTG
GACCAATAATAAATACATTAAGCCATACAGGAGACGTCACTGATGGTTTT
GTAGGATGTTTATCGTCTTTAAAGATAACAGCGGGGGAAGAAACAAAGAT
TTACCTGATGAATCAGCAAACCTCTTGGATTATTGAAAGTTCCAATGTCA
AACCGAATTGTCCTCATATAGATTTCAAAAATAGTGTCGATGTGATTGAA
GATCCGGATAAAGAGGAACAGTCAGAAAAAGAAAACTTAAAAATCAAAGA
TTATTGTCAAACACATAAGCCGTGTCTGAATGGAGGGCTCTGTCAAACTA
GTTCTGAAGAAATGTATAGCTGTCAATGTTTACCGGGATACCAAGGTATC
ACCTGTGAAGAGGTGGTTTCTCATATATGGAAGTTCAAGGATAATTCTTT
TGTTATCTTTCCATCAGAATCATTGCAACTAAGGCAACGACTTAAATTAG
AAATAACATTCCTTCCTCTTGCTAACAATGGTTTGTTATCCTTTATATCA
GACGGACATGACCGAAACCCAGCTTTTATAAGTGTGACATTGAACAAAAA
CCACCTCGAAGTCACTTGTAGAACCCCAATTGGAGTTACTAGACTTATTT
CAATGGAATCTGCATTAATTGGTAAATGGAATCACGTTGTCATTCTGAAA
GCCGCCAAATATATTTATCTAAATTTGAATCACTCTCCACAACCTATAAA
AAAAAGACTTATCCCTAAAGGTTTTTTGAATGTTAATTCACTTGTAAGCA
GAAAGTTGACACAATTTCGAATCAAGAATCAACCTATTTTTTTTGGAGGT
GTAGACAGTAACACATTTAACAGTTTTTCAAATGTAGTTTCCCTAAAACC
GAATTTTTACGGAGCAATTCAAAAAATTCTTATTAACGATGAAAATATCA
GATTCCAGAATTCCGATATTATTCTAAATAACATAACTCAATGGCAAGGA
CCTCCATGTGGACCTCTTCAAAGTCCTTGTTCAAAAACAGATCCCGAAAA
AGGCTTCTGCGTACCAGAAATGAATGAAACAATATGCACTTGCAGTCCCA
AACATGAAAATCTTTGCATAAGAAATTCAATGCAGCACGATAATCCAGCA
AATACAAATTTCTTCAGAAAATATTTGGGCAAAAGTGCTTCAAAATATGC
AGCTGTTAAACAAAAAAGGGATAAATCTTCTACAAAAAATAATATACGCA
TAAAATTCAAGACTGCGTCGAATGACGGTATGCTAATATTGCTAAAAAAG
ATATACAGCATTAAAAAGTCATTCCTGGTCATTGCAATTCGGAATGGCGT
CATAGAAGTAGCAATAAATTTAGGAGGAAAAAATGGAGTTTTAAGAATAA
CTGGTAACAAGAATATATCAGATAATAAATGGCATACAGTGCAAGTCATA
AGGAATAACAGGAACGTTGTTCTGTTAATAGATGATAGAATGTTTCGTGC
ACAAATGTTGGATAACAATGATTATAATACTCTTGCAACTGATGGATGGA
TGTGGCTTGGTGGTGCTAAAAAACCAGTTGAAGGATTTCCTTGGGAATAT
AATACAAAGTTTAAAGGTTGCATTTCAGAACTTTATGTTGACGAAATTTC
TTATAACCTCGTTCTTGATGCAAGGAAAAACATCGGACCTATCTTAAGAT
GCTAAATTACTTTATATTAAAATAAATTACATAACATGACATTTCATTTC
GCAAGAATGGGCTTGAAAAATACCTCACGAGCTTTTATTTATATTTTCAC
TTTTTCATTATTAGCATTTTGTTTCATAACATTTTTTATTACCAGCT
back to top

protein sequence of SMED30021589-orf-1

>SMED30021589-orf-1 ID=SMED30021589-orf-1|Name=SMED30021589-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1551bp
MMLLVLLLFLGFQRNVLSTDCDLSNQFNQKIESSDLIIVGRVLNLANSEV
IVSVIRILKGFDLINEVKKISHENDYHLILVRKIKYIINCKISIKSGEDF
IMYLKKTEQNNFFELNYAKEFGNGLFEKRISVFLNGATSKQVQNDDPCSK
LNCKFGAQCQKWPGNPPTAVCHCSNTQCQAGQKEISVCGSDGIFYDSHCL
MKRQECFLQKSIQVSPNHICGRKEAQQDGISKSNEQFCQHQSCPPYATCV
TNPYPYCKCPNDKCDSSSSQICGTDEITYTNICEMKKVSCKANRFIEQQY
VGRCDICKFVKCEFNGICEMMEDGLGTICKCPNPDELCTKNIQVPVCGSD
DVTYQSECHLKIESCKKKISLTVMYKGKCQTKIQSDICSNIQCHYGAKCI
KTSNTVAQCSCDYLDCKNTWRDPVCGNDGIIYDNKCFLMKMSCEKQMEMH
VINSNFCENNPCSGVKCPDPYQYCRIDNNGKSTCECPKEPCPKIVQPVCG
NDKVTYESICNLTRTACLTKKPLWIIYNGICNEEPRCKEQGKDCPSYQIC
KSDLVQAKCECPTCPQSGLGESVCGTDGKTYKSECHMRMHACETNSIALK
IANIGTCDKCKNKKCSFYSICQMNRFLEPQCICPTDCVYVRRPVCGSDDR
TYENECFLKVKSCAENRLITAVSEGPCKLQFIKPDEERCPEDCPLGKMCR
NGQCVCTDKCSKVKLRVCGTDGNYYENECELKRKACIDNKTIRVAPSVIG
CISHNYIADEKNKRSCLCNSIGSLNHECDPSTTQCICKTGITGQYCDRCI
DGYWNFTENGCTACSCNRFGSESIVCNIETGKCNCKPLAMGKYCSVCPIG
YSISNHGCKENSIYENKVDAVELGFLKDSFAKSYWSGNAENYLSINISLV
PYSSDGIIFYHSDTDRSSDYLTIVLKNRYVEYRVDLGSGAIFLKSRVQLT
IGRSHSILVERLNRDSRLVIDGTDSQYGMNPPFLTNLDAGFIFTIGQATG
PIINTLSHTGDVTDGFVGCLSSLKITAGEETKIYLMNQQTSWIIESSNVK
PNCPHIDFKNSVDVIEDPDKEEQSEKENLKIKDYCQTHKPCLNGGLCQTS
SEEMYSCQCLPGYQGITCEEVVSHIWKFKDNSFVIFPSESLQLRQRLKLE
ITFLPLANNGLLSFISDGHDRNPAFISVTLNKNHLEVTCRTPIGVTRLIS
MESALIGKWNHVVILKAAKYIYLNLNHSPQPIKKRLIPKGFLNVNSLVSR
KLTQFRIKNQPIFFGGVDSNTFNSFSNVVSLKPNFYGAIQKILINDENIR
FQNSDIILNNITQWQGPPCGPLQSPCSKTDPEKGFCVPEMNETICTCSPK
HENLCIRNSMQHDNPANTNFFRKYLGKSASKYAAVKQKRDKSSTKNNIRI
KFKTASNDGMLILLKKIYSIKKSFLVIAIRNGVIEVAINLGGKNGVLRIT
GNKNISDNKWHTVQVIRNNRNVVLLIDDRMFRAQMLDNNDYNTLATDGWM
WLGGAKKPVEGFPWEYNTKFKGCISELYVDEISYNLVLDARKNIGPILRC
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036058Kazal_dom_sf
IPR002049Laminin_EGF
IPR001791Laminin_G
IPR000742EGF-like_dom
IPR002350Kazal_dom
IPR003645Fol_N
IPR013320ConA-like_dom_sf
IPR013032EGF-like_CS
IPR009030Growth_fac_rcpt_cys_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00011EGFLAMININcoord: 403..421
score: 30.86
coord: 129..147
score: 45.22
coord: 81..99
score: 45.22
NoneNo IPR availableGENE3DG3DSA:3.30.60.30coord: 5..50
e-value: 4.1E-10
score: 41.7
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 174..347
e-value: 8.6E-25
score: 89.4
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 386..425
e-value: 1.5E-10
score: 42.5
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 662..853
e-value: 1.6E-31
score: 111.3
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 426..618
e-value: 1.2E-18
score: 69.4
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 116..163
e-value: 5.0E-6
score: 28.3
coord: 67..115
e-value: 3.5E-12
score: 48.0
NoneNo IPR availablePANTHERPTHR10574:SF288AGRINcoord: 67..166
NoneNo IPR availablePANTHERPTHR10574NETRIN/LAMININ-RELATEDcoord: 445..845
coord: 67..166
NoneNo IPR availablePANTHERPTHR10574NETRIN/LAMININ-RELATEDcoord: 196..423
coord: 4..55
NoneNo IPR availablePANTHERPTHR10574:SF288AGRINcoord: 445..845
coord: 196..423
coord: 4..55
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 116..162
e-value: 5.31179E-8
score: 47.7342
NoneNo IPR availableCDDcd00104KAZAL_FScoord: 13..48
e-value: 1.21834E-6
score: 43.7978
NoneNo IPR availableCDDcd00110LamGcoord: 685..833
e-value: 2.06923E-20
score: 86.7032
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 68..113
e-value: 7.13879E-14
score: 64.683
NoneNo IPR availableCDDcd00054EGF_CAcoord: 386..422
e-value: 2.58489E-6
score: 42.6238
NoneNo IPR availableCDDcd00110LamGcoord: 431..598
e-value: 2.19074E-13
score: 66.2876
NoneNo IPR availableCDDcd00110LamGcoord: 176..328
e-value: 4.9049E-24
score: 97.1036
IPR002350Kazal domainSMARTSM00280kazal_3coord: 8..50
e-value: 6.3E-4
score: 29.0
IPR002350Kazal domainPFAMPF07648Kazal_2coord: 9..46
e-value: 8.9E-7
score: 28.9
IPR002350Kazal domainPROSITEPS51465KAZAL_2coord: 1..63
score: 9.443
IPR002049Laminin EGF domainSMARTSM00180lamegf_3coord: 117..161
e-value: 1.1E-5
score: 34.9
coord: 69..114
e-value: 2.7E-11
score: 53.5
IPR002049Laminin EGF domainPFAMPF00053Laminin_EGFcoord: 69..114
e-value: 2.7E-10
score: 40.2
coord: 117..157
e-value: 3.2E-5
score: 24.0
IPR002049Laminin EGF domainPROSITEPS01248EGF_LAM_1coord: 88..119
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 69..116
score: 18.252
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 117..163
score: 10.521
IPR000742EGF-like domainSMARTSM00181egf_5coord: 387..422
e-value: 4.5E-6
score: 36.2
IPR000742EGF-like domainPFAMPF00008EGFcoord: 388..420
e-value: 1.4E-6
score: 28.5
IPR000742EGF-like domainPROSITEPS50026EGF_3coord: 384..422
score: 19.721
IPR001791Laminin G domainSMARTSM00282LamG_3coord: 448..600
e-value: 7.0E-6
score: 35.5
coord: 697..835
e-value: 1.7E-22
score: 90.7
coord: 194..331
e-value: 8.7E-21
score: 85.1
IPR001791Laminin G domainPFAMPF00054Laminin_G_1coord: 705..835
e-value: 3.0E-19
score: 69.5
IPR001791Laminin G domainPFAMPF02210Laminin_G_2coord: 456..599
e-value: 4.5E-6
score: 27.3
coord: 205..328
e-value: 5.3E-16
score: 59.4
IPR001791Laminin G domainPROSITEPS50025LAM_G_DOMAINcoord: 675..853
score: 33.041
IPR001791Laminin G domainPROSITEPS50025LAM_G_DOMAINcoord: 173..356
score: 24.141
IPR001791Laminin G domainPROSITEPS50025LAM_G_DOMAINcoord: 426..622
score: 19.129
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 410..421
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 410..421
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 642..840
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 136..357
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 410..607
IPR009030Growth factor receptor cysteine-rich domain superfamilySUPERFAMILYSSF57184Growth factor receptor domaincoord: 69..423
IPR036058Kazal domain superfamilySUPERFAMILYSSF100895Kazal-type serine protease inhibitorscoord: 1..48