dedicator of cytokinesis protein 5

Overview
Namededicator of cytokinesis protein 5
Smed IDSMED30021567
Length (bp)6102
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of dedicator of cytokinesis protein 5 (SMED30021567) t-SNE clustered cells

Violin plots show distribution of expression levels for dedicator of cytokinesis protein 5 (SMED30021567) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of dedicator of cytokinesis protein 5 (SMED30021567) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for dedicator of cytokinesis protein 5 (SMED30021567) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021567

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30021567SMESG000068985.1 PL08005B2A08ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30021567SMESG000068985.1 dd_Smed_v4_3618_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021567SMESG000068985.1 dd_Smed_v4_3618_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021567SMESG000068985.1 dd_Smed_v6_3618_1dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021567SMESG000068985.1 dd_Smed_v4_3618_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Human
Match: DOCK1 (dedicator of cytokinesis 1 [Source:HGNC Symbol;Acc:HGNC:2987])

HSP 1 Score: 259.61 bits (662), Expect = 9.448e-69
Identity = 362/1634 (22.15%), Postives = 671/1634 (41.06%), Query Frame = 1
Query:   28 IMKWLNYEEGDCFAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIK--------------ILSND--IYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISER-RYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQ---REYESSRRVSKLSDSTIDY-----------VSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYG----KSQKIFLVFHFIRKGPMCLT-KKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQ---IGIQLIT-RDECLENNAEKLITDYRINKREYSSTINIQL-----KTIRPE--DISDRNVMVLGLDPYYPA--TNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNK---VVMPSFDWRGFDEYSSVIYYHNAKPKWCEV--ICIPLFEKFSKFPPHTHIRFIIWHRSLN---DRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFD----KLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTMHFDVHKQIFRELINN--KPESDSNI---LRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPI-LRSLVLRKAGLIINALIPVCQPIGMARLVNN-LLKSCSDLDANMKSELTMNCMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSC-VAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKT------ELITQIDQAMESAYSNYCEEMTKAFKQVLSSNT---KYAFDS--QLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYTTVERKYPEPEDFA--SADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIE 4644
            + +W+  +  + + +A YNY    +  + L+ GD + I E Y GWYRG+   +     +FP S+I               ++  D  +  E+   +  W T  R  Y+  +   F  +   I   I  R +  S       ++  ++ +  K+D   + L L    R+E G  +D    S I L+  H+   ++ E   +  K     ID            ++L++ L NV  +  + A+ ++    +LY   + K   ISE Y  R +      D+ R + +       G    K +KI  V   +R G M L    T K     RRP GV+V++VT+++   +D E +   I  Q +   ++ L+    K+I    +N +     + ++L       IR E   + DR   V      +P      + RN +Y+ L   + DK  K +  N EV +S+ D  G +   V+ P        EY SVIYY   +P+W E   + IP+ E  ++    +H+RF   HRS     D+S+    +A++KL   D   +      D  H L +YK + +K++ A      P  + +     ++ +  + T + M S     + KD+  + T+VCST+ T +     LL    N SL  Q +   +         +D  E+ KF    L++  +++ + ++       + + L  +   I +       P  E  + K    T+ +    ++ +  ++   KP  +  +   ++A +   K  V+S   +  ++  N  EA     L   +  I + ++S  D+ + ++   L+    I+N +  V  P  ++++    +L     L    K    +  ++S LF    CR I+LP  T  +         K + E++ D    L+  C  +   +++  R       ++     +  II  K+LR+    ++S G +    SE  G          V+ +   L  + D  +  +++       F + R  TD  D +ME F +   L    V+P                                      W+ M  VQ++ FL  + Q  +++ K +    L Q                  + +L  +      + +TQ  L LE   S+   +++       GD+R     +I+++W +L   K +F         ++T I   ++R   +   FD++  +  + ++      E+IT++D  +E    +  E+    F ++L  +    KY   +    V+ ++  M  + +    ++D +  N M    N+  FY E+ R ++  RYL+KL  +H++  NY+E   TLL  +   +WS ++        +      + Q+K +L +E + YF+K   WE+ I + KEL + Y     D+ +LS +  K ++  + I+   RP+ + + + Y G+GFP F   L  K  + R K      +    L +QF      +    P D    S  + I    VKP +   P K+  + V ++I+ +Y   E++ F Y R +   E++P        I+  I     KLP IL    VKS+  + I P + A+  ++
Sbjct:    1 MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIFPASYIHLKEAIVEGKGQHETVIPGDLPLIQEVTTTLREWSTIWRQLYVQDNREMFRSVRHMIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTSTISLFRAHEIASKQVEERLQEEKSQKQNIDINRQAKFAATPSLALFVNLKNVVCKIGEDAEVLM----SLYDPVESKF--ISENYLVRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQIVRVGRMELRDNNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQPVAGENDFLQTVINKVIAAKEVNHKGQGLWVTLKLLPGDIHQIRKEFPHLVDRTTAV-ARKTGFPEIIMPGDVRNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKSVIYYQVKQPRWFETVKVAIPI-EDVNR----SHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYDGTTL-----RDGEHDLIVYKAEAKKLEDAATYLSLPSTKAE-----LEEKGHSATGKSMQSLGSCTISKDSFQISTLVCSTKLTQNVDLLGLLKWRSNTSLLQQNLRQLM--------KVDGGEVVKFLQDTLDALFNIMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVNEQLYKAMKALESIFKFIVRSRILFN-QLYENKGEADFVESLLQLFRSINDMMSSMSDQTVRVKGAALKYLPTIVNDVKLVFDPKELSKMFTEFILNVPMGLLTIQKLYCLIEIVHSDLFTQHDCREILLPMMTDQL---------KYHLERQED----LEACCQLLSHILEVLYRK------DVGPTQRHVQIIMEKLLRTVNRTVISMGRD----SELIGN--------FVACMTAILRQMEDYHYAHLIKT------FGKMR--TDVVDFLMETFIMFKNLIGKNVYPF------------------------------------DWVIMNMVQNKVFLRAINQYADMLNKKF----LDQ---------------ANFELQLWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKY----GDMRRQIGFEIRDMWYNLGQHKIKFIPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHSTRSFQMFENEIITKLDHEVEGGRGD--EQYKVLFDKILLEHCRKHKYLAKTGETFVKLVVRLMERLLDYRTIMHDENKENRMSCTVNVLNFYKEIEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEDVCVAHLTQRDGYQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKELAEQYENEMFDYEQLSELLKKQAQFYENIVKVIRPKPDYFAVGYYGQGFPTF---LRGKVFIYRGKEYERREDFEARLLTQFPNAEKMKTTSPPGDDIKNSPGQYIQCFTVKP-KLDLPPKFH-RPVSEQIVSFYRVNEVQRFEYSRPIRKGEKNPDNEFANMWIERTIYTTAYKLPGILRWFEVKSVFMVEISPLENAIETMQ 1498          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Human
Match: DOCK1 (dedicator of cytokinesis 1 [Source:HGNC Symbol;Acc:HGNC:2987])

HSP 1 Score: 253.447 bits (646), Expect = 8.475e-67
Identity = 363/1655 (21.93%), Postives = 671/1655 (40.54%), Query Frame = 1
Query:   28 IMKWLNYEEGDCFAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIK--------------ILSNDI--YPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISER-RYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQ---REYESSRRVSKLSDSTIDY-----------VSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYG----KSQKIFLVFHFIRKGPMCLT-KKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQ---IGIQLITRDEC----------------------LENNAEKLITDYRINKREYSSTINIQL-----KTIRPE--DISDRNVMVLGLDPYYPA--TNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNK---VVMPSFDWRGFDEYSSVIYYHNAKPKWCEVI--CIPLFEKFSKFPPHTHIRFIIWHRSLND---RSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFD----KLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTMHFDVHKQIFRELINN--KPESDSNI---LRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPI-LRSLVLRKAGLIINALIPVCQPIGMARLVNN-LLKSCSDLDANMKSELTMNCMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSC-VAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKT------ELITQIDQAMESAYSNYCEEMTKAFKQVLSSNT---KYAFDS--QLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYTTVERKYPEPEDFA--SADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIE 4644
            + +W+  +  + + +A YNY    +  + L+ GD + I E Y GWYRG+   +     +FP S+I               ++  D+    E+   +  W T  R  Y+  +   F  +   I   I  R +  S       ++  ++ +  K+D   + L L    R+E G  +D    S I L+  H+   ++ E   +  K     ID            ++L++ L NV  +  + A+ ++    +LY   + K   ISE Y  R +      D+ R + +       G    K +KI  V   +R G M L    T K     RRP GV+V++VT+++   +D E +   I  Q +  D+                       L+    K+I    +N +     + ++L       IR E   + DR   V      +P      + RN +Y+ L   + DK  K +  N EV +S+ D  G +   V+ P        EY SVIYY   +P+W E +   IP+ E  ++    +H+RF   HRS  D   +S+    +A++KL   D   +      D  H L +YK + +K++ A      P  + +     ++ +  + T + M S     + KD+  + T+VCST+ T +     LL    N SL  Q +   +         +D  E+ KF    L++  +++ + ++       + + L  +   I +       P  E  + K    T+ +    ++ +  ++   KP  +  +   ++A +   K  V+S   +  ++  N  EA     L   +  I + ++S  D+ + ++   L+    I+N +  V  P  ++++    +L     L    K    +  ++S LF    CR I+LP  T  +         K + E++ D    L+  C  +   +++  R       ++     +  II  K+LR+    ++S G +    SE  G          V+ +   L  + D  +  +++       F + R  TD  D +ME F +   L    V+P                                      W+ M  VQ++ FL  + Q  +++ K +    L Q                  + +L  +      + +TQ  L LE   S+   +++       GD+R     +I+++W +L   K +F         ++T I   ++R   +   FD++  +  + ++      E+IT++D  +E    +  E+    F ++L  +    KY   +    V+ ++  M  + +    ++D +  N M    N+  FY E+ R ++  RYL+KL  +H++  NY+E   TLL  +   +WS ++        +      + Q+K +L +E + YF+K   WE+ I + KEL + Y     D+ +LS +  K ++  + I+   RP+ + + + Y G+GFP F   L  K  + R K      +    L +QF      +    P D    S  + I    VKP +   P K+  + V ++I+ +Y   E++ F Y R +   E++P        I+  I     KLP IL    VKS+  + I P + A+  ++
Sbjct:    1 MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIFPASYIHLKEAIVEGKGQHETVIPGDLPLIQEVTTTLREWSTIWRQLYVQDNREMFRSVRHMIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTSTISLFRAHEIASKQVEERLQEEKSQKQNIDINRQAKFAATPSLALFVNLKNVVCKIGEDAEVLM----SLYDPVESKF--ISENYLVRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQIVRVGRMELRDNNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQPLALDDAIRHKPLNMSSRFSPRVAGENDFLQTVINKVIAAKEVNHKGQGLWVTLKLLPGDIHQIRKEFPHLVDRTTAV-ARKTGFPEIIMPGDVRNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKSVIYYQVKQPRWFETVKVAIPI-EDVNR----SHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYDGTTL-----RDGEHDLIVYKAEAKKLEDAATYLSLPSTKAE-----LEEKGHSATGKSMQSLGSCTISKDSFQISTLVCSTKLTQNVDLLGLLKWRSNTSLLQQNLRQLM--------KVDGGEVVKFLQDTLDALFNIMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVNEQLYKAMKALESIFKFIVRSRILFN-QLYENKGEADFVESLLQLFRSINDMMSSMSDQTVRVKGAALKYLPTIVNDVKLVFDPKELSKMFTEFILNVPMGLLTIQKLYCLIEIVHSDLFTQHDCREILLPMMTDQL---------KYHLERQED----LEACCQLLSHILEVLYRK------DVGPTQRHVQIIMEKLLRTVNRTVISMGRD----SELIGNF--------VACMTAILRQMEDYHYAHLIKT------FGKMR--TDVVDFLMETFIMFKNLIGKNVYPF------------------------------------DWVIMNMVQNKVFLRAINQYADMLNKKF----LDQ---------------ANFELQLWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKY----GDMRRQIGFEIRDMWYNLGQHKIKFIPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHSTRSFQMFENEIITKLDHEVEGGRGD--EQYKVLFDKILLEHCRKHKYLAKTGETFVKLVVRLMERLLDYRTIMHDENKENRMSCTVNVLNFYKEIEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEDVCVAHLTQRDGYQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKELAEQYENEMFDYEQLSELLKKQAQFYENIVKVIRPKPDYFAVGYYGQGFPTF---LRGKVFIYRGKEYERREDFEARLLTQFPNAEKMKTTSPPGDDIKNSPGQYIQCFTVKP-KLDLPPKFH-RPVSEQIVSFYRVNEVQRFEYSRPIRKGEKNPDNEFANMWIERTIYTTAYKLPGILRWFEVKSVFMVEISPLENAIETMQ 1519          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Human
Match: DOCK2 (dedicator of cytokinesis 2 [Source:HGNC Symbol;Acc:HGNC:2988])

HSP 1 Score: 226.483 bits (576), Expect = 1.269e-58
Identity = 387/1788 (21.64%), Postives = 724/1788 (40.49%), Query Frame = 1
Query:   67 AIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKI--------------------LSNDIYPELWAEMFSW----ITYIRDSYLLVDTTDFDKITEAIQLAISERRYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYE--SSRRVSKLSDSTIDYV-----------SLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYGKSQ----KIFLVFHFIRKGPMCLTKKTIKEGV-PYRRPKGVSVIEVTNVMTENL--DSEKQIGIQ---LITRDECLENNAEKLIT--------DYRINKREYSSTINIQLKTIRPEDISDRNVMVLGLDPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQG----NKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVI--CIPLFEKFSKFPPHTHIRFIIWHRSL---NDRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLD-LIQQATDDSYLGKNILELLGEMFKAIKNLPDSENQ-----LDKFIQDTMHFDV---HKQIFREL-----INNKPESDSNILR---ATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGL-IINALIPVCQPIGMARLVNNLLK---SCSDLDANMKSEL-TMN-CMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLD-NICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSC-VAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIV------HLDRENKKTELITQIDQAMESAYSNYCEEMTKAFKQVL-SSNTKYAFDSQLVENIIVQMNNIEE----CSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYTTVERKYPEPEDFA--SADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRYVSP-VSGGVTK---------LVEMIPNNDDNFSYTSEVVNQVLSLIYQYLQAFE--IYDTLDNYMIFVSAFQNLCSSVSRSLDL-VSEEYNVKILPDLYSKSKKRETNFTATIRRPSV 5064
             +AIYN++ + +  + L+ GD + I+E    WYRG+      +  +FP S I I                    L+ ++   LW     W    +   ++ +L V +  +D +    QL          + K ++ E  ++ +  K+D   K L L    R+E G  +D +  SVI L+  H+   +  + R   ++S    DY            SLY+ + N      + A+    + ++LY  +  K T ISE Y  R   R +  ++   N + +     G       KI+L+   +R G M L     K+     RRP GV+V+++T+++      D EKQ  I    +   ++ L +   K+I            +  +     I IQ++   P  +    V+   L         + RN +Y+ L   + DK  K +  N EV + +    G    N + + + D +  +EY SV+YY   +P+W E +   +P+ E   +     H+RF+  HRS     D+ +    ++Y+KL  +D   +     +D +H L + K D +K++ A      P Y      + ++N+  T +    +     V  +D   + T+VCST+ T +  L  +    ++ Q +   L      +K +D  E+ KF    L++  + +++ +  D Y   +IL +   +   I  + D + Q     L+ +IQ   HF     +K++   L      +++ E    ILR   A ++  K  V+S     R +   + E     E  +S   + E + +        +++L+ A L  I +++   + +  A+L++ LL    +C       K ++ +MN  + S LF   +CR I+LP  TK + EL          +K+  Q Q+L+   C E++  I L   S+Q +      + + E++++  +LR+    +++ G +++  S              V+ +   L+ + D+ + F +   +   +           D +ME F +  +L    V+P                                      WM M  VQ+R FL  + +         +   ++Q          F   T   +F+L  +      + ITQ  L LE+   +   +++       GD+R      I+++W  L   K  F         ++T I   ++R   +   FD++        D +  + E+I ++D  +E    +  E+  +  + +L     ++   ++ VEN +  +  + E        + D S  N M    NL  FY +  R ++  RYL+KL  +H    NY+E   TLL  +   +WS E      + +  +  +   Q+K  L E  + YF+K   WE+ I +CKEL + Y     D+  LS    + ++  + IM   RP+ + + + Y G+GFP F+ +   K  + R K      +  + L +QF           P D    +  + I    V+P     P +++ K V  +I+ +Y +  ++ F Y R +     DP        I+    +   KLP IL    V  + +  I P + A+  +     K  M+   Y++ ++     L   +  I    V P V GG  K          V   P + D  ++  +++   +  +   ++  E  + D L         F +      ++L + V +EY V+ +PD   +   R  +   + R+ S+
Sbjct:   13 GVAIYNFQGSGAPQLSLQIGDVVRIQETCGDWYRGYLIKHKMLQGIFPKSFIHIKEVTVEKRRNTENIIPAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFLQVQSMMYDLMEWRSQL------LSGTLPKDELKELKQK-VTSKIDYGNKILELDLIVRDEDGNILDPDNTSVISLFHAHEEATDKITERIKEEMSKDQPDYAMYSRISSSPTHSLYVFVRNFVCRIGEDAE----LFMSLY--DPNKQTVISENYLVRWGSRGFPKEIEMLNNLKVVFTDLGNKDLNRDKIYLICQIVRVGKMDLKDTGAKKCTQGLRRPFGVAVMDITDIIKGKAESDEEKQHFIPFHPVTAENDFLHSLLGKVIASKGDSGGQGLWVTMKMLVGDI-IQIRKDYPHLVDRTTVVARKLGFPEIIMPGDVRNDIYITLLQGDFDKYNKTTQRNVEVIMCVCAEDGKTLPNAICVGAGD-KPMNEYRSVVYYQVKQPRWMETVKVAVPI-EDMQRI----HLRFMFRHRSSLESKDKGEKNFAMSYVKLMKEDGTTL-----HDGFHDLVVLKGDSKKMEDASAYLTLPSYR-----HHVENKGATLSRSSSSVGGLSVSSRDVFSISTLVCSTKLTQNVGLLGLLKWRMKPQLLQENLEK----LKIVDGEEVVKFLQDTLDALFNIMMEHSQSDEY---DIL-VFDALIYIIGLIADRKFQHFNTVLEAYIQQ--HFSATLAYKKLMTVLKTYLDTSSRGEQCEPILRTLKALEYVFKFIVRS-----RTLFSQLYEGKEQMEFEESMRRLFESINNLMKSQYKTTILLQVAALKYIPSVLHDVEMVFDAKLLSQLLYEFYTCIPPVKLQKQKVQSMNEIVQSNLFKKQECRDILLPVITKELKELLE--------QKDDMQHQVLERKYCVELLNSI-LEVLSYQDAA--FTYHHIQEIMVQ--LLRTVNRTVITMGRDHILISH------------FVACMTAILNQMGDQHYSFYIETFQTSSELV---------DFLMETFIMFKDLIGKNVYPG------------------------------------DWMAMSMVQNRVFLRAINK---------FAETMNQK---------FLEHT-NFEFQLWNNYFHLAVAFITQDSLQLEQFSHAKYNKILNKY----GDMRRLIGFSIRDMWYKLGQNKICFIPGMVGPILEMTLIPEAELRKATIPIFFDMMLCEYQRSGDFKKFENEIILKLDHEVEGGRGD--EQYMQLLESILMECAAEHPTIAKSVENFVNLVKGLLEKLLDYRGVMTDESKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQCASQVMQTGQQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLRN---KVFIYRGKEYERREDFQMQLMTQFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHP-RFKNKPVPDQIINFYKSNYVQRFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTANEKILMMINQYQSDETLPINPLSMLLNGI----VDPAVMGGFAKYEKAFFTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNL-------RPFHDRMEECFKNLKMKVEKEYGVREMPDFDDRRVGRPRSMLRSYRQMSI 1645          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Human
Match: DOCK5 (dedicator of cytokinesis 5 [Source:HGNC Symbol;Acc:HGNC:23476])

HSP 1 Score: 178.718 bits (452), Expect = 5.028e-44
Identity = 225/946 (23.78%), Postives = 391/946 (41.33%), Query Frame = 1
Query:   64 FAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKILSNDI----------------YPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERR--YDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKLSD----------------STIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAI--IMKDIQYGK--SQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSE--------KQIGIQ-----------------LITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDIS----------DRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGN---KVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPL-FEKFSKFPPHTHIRFIIWHRS---LNDRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHP----EYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTMHFDVHKQIFRELINNKPESDSN-----ILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGL-----IINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNCMN----SKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNI 2577
            + +AIYNY  +    + L+ GD + I E Y GWYRG+         +FP ++I +    +                  EL + +  W    R  Y+    T F ++ +     I  R       + K ++ E  ++ +  K+D   + LGL    R++ G  +D +  S I L+  H  E  S R   K+ +                STI    LY+   N      + A+    + + LY  +  + T ISE Y  R        ++ + N +  +  D+        ++ LV   +R G M L K+  K     RRP GV+V+++T+++   +D E        +QI ++                 +I  +E L +   K+I    +N +     ++++L    P D++          DR+  +   +G  +   P    + RN +Y+ L H E DK +KK+  N EV +S+ D +G    K + P   + G  EY SV+YY   +P W E + + +  E+ ++     HIRF   HRS     D+S+   GVA++KL   D   +      D  H L +YK D +K++ A++    P    E E + EL + KN        ++  T  K   KD+  + T++CST+ T +  L  + N     Q I H L      +  +D  E+ KF    L++  +++ + +D       + + L  +   I ++      P  E  + K    T+ +    ++    + N  +S         L+A  +  +  ++S   Y R   G   +   FN   +S   +        D+P+  ++ ++ A L     IIN +  V  P+ ++ L    ++S  D   N      +NCM     S LF  S+CR ++LP  T  +    +   NK  +E      QLL NI
Sbjct:   12 YGVAIYNYNASQDVELSLQIGDTVHILEMYEGWYRGYTLQNKSKKGIFPETYIHLKEATVEDLGQHETVIPGELPLVQELTSTLREWAVIWRKLYVNNKLTLFRQLQQMTYSLIEWRSQILSGTLPKDELAELKKK-VTAKIDHGNRMLGLDLVVRDDNGNILDPDETSTIALFKAH--EVASKRIEEKIQEEKSILQNLDLRGQSIFSTIHTYGLYVNFKNFVCNIGEDAE----LFMALY--DPDQSTFISENYLIRWGSNGMPKEIEKLNNLQAVFTDLSSMDLIRPRVSLVCQIVRVGHMEL-KEGKKHTCGLRRPFGVAVMDITDIIHGKVDDEEKQHFIPFQQIAMETYIRQRQLIMSPLITSHVIGENEPLTSVLNKVIAAKEVNHKGQGLWVSLKL---LPGDLTQVQKNFSHLVDRSTAIARKMGFPEIILPG---DVRNDIYVTLIHGEFDKGKKKTPKNVEVTMSVHDEEGKLLEKAIHPGAGYEGISEYKSVVYYQVKQPCWYETVKVSIAIEEVTR----CHIRFTFRHRSSQETRDKSERAFGVAFVKLMNPDGTTL-----QDGRHDLVVYKGDNKKMEDAKFYLTLPGTKMEME-EKELQASKN--------LVTFTPSKDSTKDSFQIATLICSTKLTQNVDLLGLLNWRSNSQNIKHNLKK----LMEVDGGEIVKFLQDTLDALFNIMMEMSDSETYDFLVFDALVFIISLIGDIKFQHFNPVLETYIYKHFSATLAYVKLSKVLNFYVANADDSSKTELLFAALKALKYLFRFIIQSRVLYLR-FYGQSKDGDEFN---NSIRQLFLAFNMLMDRPLEEAVKIKGAALKYLPSIINDVKLVFDPVELSVLFCKFIQSIPD---NQLVRQKLNCMTKIVESTLFRQSECREVLLPLLTDQLSGQLDDNSNKPDHEA---SSQLLSNI 909          

HSP 2 Score: 134.42 bits (337), Expect = 1.695e-30
Identity = 126/463 (27.21%), Postives = 201/463 (43.41%), Query Frame = 1
Query: 3355 GDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENK--------KTELITQIDQAMESAYSN-------------YCEEMTKAFKQVLSSNTKYAF-DSQLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYT-TVERKYPEPEDFASADKKIFYM---PVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIE 4644
            GD+R     +I+++W +L   K +F  +      ++T     ++R   +   FD++  +            + ELIT++DQ +E    +             +C    +  K + SS   +A   S L+EN++     I      + D S  N M    N+  FY E  R DI  RYL+KL  +H   +NY+E   TLL  +   QWS +      L  +      + ++K KL +E + YF+K   WEK I++ KEL + Y     D+  L  +  K +   + I+   RP+   + + Y G+GFP F+ +   K  + R K      + S+ L +QF     +    P  ED  S+ K+  YM    VKP     P  Y+ K V ++IL YY   E+++F Y R     E+DP        I+          P IL    VK I    I P + A+  +E
Sbjct: 1077 GDMRKEIGFRIRDMWYNLGPHKIKFIPSMVGPILEVTLTPEVELRKATIPIFFDMMQCEFNFSGNGNFHMFENELITKLDQEVEGGRGDEQYKVLLEKLLLEHC----RKHKYLSSSGEVFALLVSSLLENLLDYRTII------MQDESKENRMSCTVNVLNFYKEKKREDIYIRYLYKLRDLHRDCENYTEAAYTLLLHAELLQWSDKPCVPHLLQKDSYYVYTQQELKEKLYQEIISYFDKGKMWEKAIKLSKELAETYESKVFDYEGLGNLLKKRASFYENIIKAMRPQPEYFAVGYYGQGFPSFLRN---KIFIYRGKEYERREDFSLRLLTQFPNAEKMTSTTPPGEDIKSSPKQ--YMQCFTVKPV-MSLPPSYKDKPVPEQILNYYRANEVQQFRYSRPFRKGEKDPDNEFATMWIERTTYTTAYTFPGILKWFEVKQISTEEISPLENAIETME 1523          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Human
Match: DOCK5 (dedicator of cytokinesis 5 [Source:HGNC Symbol;Acc:HGNC:23476])

HSP 1 Score: 140.584 bits (353), Expect = 1.444e-32
Identity = 162/657 (24.66%), Postives = 285/657 (43.38%), Query Frame = 1
Query:  820 KIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSE--------KQIGIQ-----------------LITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDIS----------DRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGN---KVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPL-FEKFSKFPPHTHIRFIIWHRS---LNDRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHP----EYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTMHFDVHKQIFRELINNKPESDSN-----ILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGL-----IINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNCMN----SKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERD-QDQLLDNI 2577
            ++ LV   +R G M L K+  K     RRP GV+V+++T+++   +D E        +QI ++                 +I  +E L +   K+I    +N +     ++++L    P D++          DR+  +   +G  +   P    + RN +Y+ L H E DK +KK+  N EV +S+ D +G    K + P   + G  EY SV+YY   +P W E + + +  E+ ++     HIRF   HRS     D+S+   GVA++KL   D   +      D  H L +YK D +K++ A++    P    E E + EL + KN        ++  T  K   KD+  + T++CST+ T +  L  + N     Q I H L      +  +D  E+ KF    L++  +++ + +D       + + L  +   I ++      P  E  + K    T+ +    ++    + N  +S         L+A  +  +  ++S   Y R   G   +   FN   +S   +        D+P+  ++ ++ A L     IIN +  V  P+ ++ L    ++S  D   N      +NCM     S LF  S+CR ++LP  T  +    + QL+   N+ + +   QLL NI
Sbjct:   65 RVSLVCQIVRVGHMEL-KEGKKHTCGLRRPFGVAVMDITDIIHGKVDDEEKQHFIPFQQIAMETYIRQRQLIMSPLITSHVIGENEPLTSVLNKVIAAKEVNHKGQGLWVSLKL---LPGDLTQVQKNFSHLVDRSTAIARKMGFPEIILPG---DVRNDIYVTLIHGEFDKGKKKTPKNVEVTMSVHDEEGKLLEKAIHPGAGYEGISEYKSVVYYQVKQPCWYETVKVSIAIEEVTR----CHIRFTFRHRSSQETRDKSERAFGVAFVKLMNPDGTTL-----QDGRHDLVVYKGDNKKMEDAKFYLTLPGTKMEME-EKELQASKN--------LVTFTPSKDSTKDSFQIATLICSTKLTQNVDLLGLLNWRSNSQNIKHNLKK----LMEVDGGEIVKFLQDTLDALFNIMMEMSDSETYDFLVFDALVFIISLIGDIKFQHFNPVLETYIYKHFSATLAYVKLSKVLNFYVANADDSSKTELLFAALKALKYLFRFIIQSRVLYLR-FYGQSKDGDEFN---NSIRQLFLAFNMLMDRPLEEAVKIKGAALKYLPSIINDVKLVFDPVELSVLFCKFIQSIPD---NQLVRQKLNCMTKIVESTLFRQSECREVLLPLLTDQL----SGQLDDNSNKPDHEASSQLLSNI 681          

HSP 2 Score: 55.8398 bits (133), Expect = 1.117e-6
Identity = 52/195 (26.67%), Postives = 85/195 (43.59%), Query Frame = 1
Query: 3355 GDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENK--------KTELITQIDQAMESAYSN---------YCEEMTKAFKQVLSSNTKYAF-DSQLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLL 3885
            GD+R     +I+++W +L   K +F  +      ++T     ++R   +   FD++  +            + ELIT++DQ +E    +            E  +  K + SS   +A   S L+EN++     I      + D S  N M    N+  FY E  R DI  RYL+KL  +H   +NY+E   TLL
Sbjct:  849 GDMRKEIGFRIRDMWYNLGPHKIKFIPSMVGPILEVTLTPEVELRKATIPIFFDMMQCEFNFSGNGNFHMFENELITKLDQEVEGGRGDEQYKVLLEKLLLEHCRKHKYLSSSGEVFALLVSSLLENLLDYRTII------MQDESKENRMSCTVNVLNFYKEKKREDIYIRYLYKLRDLHRDCENYTEAAYTLL 1037          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Celegans
Match: ced-5 (CED-5 [Source:UniProtKB/TrEMBL;Acc:G5EEN3])

HSP 1 Score: 77.7962 bits (190), Expect = 1.015e-13
Identity = 130/622 (20.90%), Postives = 254/622 (40.84%), Query Frame = 1
Query: 3361 IRLSGAVQIKNIWQDLD-ILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKT--------ELITQIDQAME--SAYSNYCEE-------MTKAFKQVLSSNTKYAFD------SQLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLP-SEYEDCEFEFQVKAKLLEESLKYFEK-EDWEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNKRNVSEMSIDLNSQFEYTTVERKYPEPEDFASADKKIFYMPVKPSRFI---------FPTKYEGKI-VKQRILKYYDNYEIEEFIYKRLMNN-----TEEDPSKRIIDG----RIILCEEKLPNILSVGPVKSI-EKIPIDPFKEALSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRYVSPVSGGVTKLVEMIPNNDDNFSYTSE--VVNQVLSLIYQYLQAFEIYDTLDNYMIFVSAFQNLCSSVSRSLDLVSEEYNVKILPDLYSKSKKR-ETNFTATIRRPSVALRVR 5079
            +R + A  ++++W  L    K  +  +    F K++ + + + R   +   FD++  +     +        EL++Q+D  ++  SA   + E        + ++ K+++++  +   +      + L+E   V   ++ EC   L        M     L ++YN+    ++  +Y++KL  +H    N  E   TLL  ++   +  + +    +  S     E   Q+K  L+EE+   F K EDWE  + V  +L+  Y    +D+ KL+ +  K+++L   I   +R     Y++ + G+GFP +   L     V R+++      ++++ +F    + + Y  PE     D    ++   P R+I             +E    VK  I KY+  Y I+ F Y ++        T  DPS   +      R I   + LP  L    +  + + I + P + A   +E   +K++ L +   +A+S     L    +DI+    + V GGV            N     E  V+ ++ SLI + ++  E       Y  +V A +  C   +R+++         +L D +   ++  E NF  T  R      +R
Sbjct: 1062 LRKAAAKDLRSMWFRLTPSQKLNYIPSMIGSFLKVSLVDDDETREATIPIFFDMMQTEYNTSASRSFTEFASELVSQLDTNVDQHSATKGFKEHFRQLSITLCQSDKELMANGGEELIERIDRLLTALIEYHEVASKSLVECVDSL--------MSRTVQLMRYYNQYSHKELYVKYIYKLYDLHTSYGNKIEAAKTLLRHATMLTFDDDALPQWLIARSLNRHRELHRQLKEDLMEEAGNLFSKGEDWEDALIVYNQLVPVYQNIIMDYDKLAGLLQKIAQLYTSISRTERAYFYYYLVAFYGQGFPAY---LNGHKFVFRSEK------LEMHGEF-MQRIMKMYDNPEKIMKTD-PCPHLVDSPGRYIQVFNIDPIGTGCSFENNPEVKPVIKKYFRYYNIQTFEYSKVEERKDTKWTSIDPSSEFMRNWLVRRRIKTADSLPTDLRFTEIVELSDPIYVTPLQNA---VEQMRKKNKELNETAASAESNPNFDLKLLSRDILGVVSAAVMGGVKNYEVFFTEACRNICECGEQSVIMELSSLIIEQVEILE-------YCCYVHASR--CQGEARAIN--------TMLADSFDSHRRYVEENFGKTRSRLPTHANIR 1644          

HSP 2 Score: 65.0846 bits (157), Expect = 7.544e-10
Identity = 122/568 (21.48%), Postives = 235/568 (41.37%), Query Frame = 1
Query:   55 GDCFAIAIYNYK----PANSQHMELRSGDYLFIREHYPGWYRGFKYTQP---CILKVFPMSHIKILSNDIY----------PELWAEMFSWITYIRDSYLLVDTT---DFDKITEAI-QLAISERRYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKL-----SDSTI-DYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRA--NAIIMKDIQYGKSQKIFLVFHFIRKGPMCLTKKTIKE------GVP----YRRPKGVSVIEVTNVMTENLDSEKQIGIQLITRDECLENNAEKLITDYRI-----NKREYSSTINIQL--------KTIRPEDISDRNVMVLGLDPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNKV--VMPSFDWRGFD---EYSSVIYYHNAKPKWCEVICIPLFEKFSKFPPHTHIRFIIWHRSLNDR---SKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMD 1578
            G  +AI  Y ++      ++  +EL  GD + +   +  W  G K+ +    C   +FP+++++I+   ++           E+   +  W T I++  L+V+TT    F+ + ++  +L I + + +S     + +   R  + + +D     LG     RNE+G  +D+ ++S++  Y  H     S  RV  L      + TI D  SL + + +V            +I+I+LY L+ +  T  S T+        +    ++A       +DIQ    +K  +V   +   P+  +  T+++       +P     R+     ++E++++    +  E +  +  + R+  L  + +      RI     N  E    I+ QL        K   P   S     +L        +  + RN +Y+ L  AE+    K SD N E  + + +  G+ +  V  +    G      Y S++ YH  KP W E I I L    S      ++R + + +   D+    K P  +A+++L    ++A+L   E    H L +YK+D
Sbjct:    5 GFYYAIVQYTFEDPLPSCDAPRLELFIGDRICVYGQHGEWGYGRKFDEKNGKC--GIFPLAYVQIVQKSMFVSTSDGYLVVDEISRVINEWWTKIKE--LMVETTRIGSFEDLMDSFNELLIIKTKIESGGIPIEELSKLRLRVSKLVDRGNTILGQDVVIRNEEGVPLDVESLSLLRTYEAH---ISSKGRVGSLMREKPENVTINDSFSLLLSIKSVELH----CKYSCEISISLYDLDKKMFTTDSYTFLWNSGSGKHTDLNLKALFTDFAKEDIQ----KKYLMVTRVVHVSPIESSNATMRKHGHHEATIPKTFYCRQSYASDIMEMSSIFLAGVGHEAKERVIFLNREPELPLSLKAYHATNRIPKNLSNDMETKLLISTQLVPGNVSQIKARHPHLFSRCPAAILRRADRTAVSIEDSRNEMYITLMQAELSG--KSSDRNIEARLHVVESNGHVMENVFETISVTGSQLSTVYKSIVVYHTDKPMWTEPIKIALPSCASH---DVYLRILFYSKKAYDKPKPEKGPFAIAHVQLI--RSSALLCDGE----HDLAVYKID 546          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Celegans
Match: ced-5 (CED-5 [Source:UniProtKB/TrEMBL;Acc:G5EEN3])

HSP 1 Score: 77.7962 bits (190), Expect = 1.015e-13
Identity = 130/622 (20.90%), Postives = 254/622 (40.84%), Query Frame = 1
Query: 3361 IRLSGAVQIKNIWQDLD-ILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKT--------ELITQIDQAME--SAYSNYCEE-------MTKAFKQVLSSNTKYAFD------SQLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLP-SEYEDCEFEFQVKAKLLEESLKYFEK-EDWEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNKRNVSEMSIDLNSQFEYTTVERKYPEPEDFASADKKIFYMPVKPSRFI---------FPTKYEGKI-VKQRILKYYDNYEIEEFIYKRLMNN-----TEEDPSKRIIDG----RIILCEEKLPNILSVGPVKSI-EKIPIDPFKEALSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRYVSPVSGGVTKLVEMIPNNDDNFSYTSE--VVNQVLSLIYQYLQAFEIYDTLDNYMIFVSAFQNLCSSVSRSLDLVSEEYNVKILPDLYSKSKKR-ETNFTATIRRPSVALRVR 5079
            +R + A  ++++W  L    K  +  +    F K++ + + + R   +   FD++  +     +        EL++Q+D  ++  SA   + E        + ++ K+++++  +   +      + L+E   V   ++ EC   L        M     L ++YN+    ++  +Y++KL  +H    N  E   TLL  ++   +  + +    +  S     E   Q+K  L+EE+   F K EDWE  + V  +L+  Y    +D+ KL+ +  K+++L   I   +R     Y++ + G+GFP +   L     V R+++      ++++ +F    + + Y  PE     D    ++   P R+I             +E    VK  I KY+  Y I+ F Y ++        T  DPS   +      R I   + LP  L    +  + + I + P + A   +E   +K++ L +   +A+S     L    +DI+    + V GGV            N     E  V+ ++ SLI + ++  E       Y  +V A +  C   +R+++         +L D +   ++  E NF  T  R      +R
Sbjct: 1062 LRKAAAKDLRSMWFRLTPSQKLNYIPSMIGSFLKVSLVDDDETREATIPIFFDMMQTEYNTSASRSFTEFASELVSQLDTNVDQHSATKGFKEHFRQLSITLCQSDKELMANGGEELIERIDRLLTALIEYHEVASKSLVECVDSL--------MSRTVQLMRYYNQYSHKELYVKYIYKLYDLHTSYGNKIEAAKTLLRHATMLTFDDDALPQWLIARSLNRHRELHRQLKEDLMEEAGNLFSKGEDWEDALIVYNQLVPVYQNIIMDYDKLAGLLQKIAQLYTSISRTERAYFYYYLVAFYGQGFPAY---LNGHKFVFRSEK------LEMHGEF-MQRIMKMYDNPEKIMKTD-PCPHLVDSPGRYIQVFNIDPIGTGCSFENNPEVKPVIKKYFRYYNIQTFEYSKVEERKDTKWTSIDPSSEFMRNWLVRRRIKTADSLPTDLRFTEIVELSDPIYVTPLQNA---VEQMRKKNKELNETAASAESNPNFDLKLLSRDILGVVSAAVMGGVKNYEVFFTEACRNICECGEQSVIMELSSLIIEQVEILE-------YCCYVHASR--CQGEARAIN--------TMLADSFDSHRRYVEENFGKTRSRLPTHANIR 1644          

HSP 2 Score: 65.0846 bits (157), Expect = 7.544e-10
Identity = 122/568 (21.48%), Postives = 235/568 (41.37%), Query Frame = 1
Query:   55 GDCFAIAIYNYK----PANSQHMELRSGDYLFIREHYPGWYRGFKYTQP---CILKVFPMSHIKILSNDIY----------PELWAEMFSWITYIRDSYLLVDTT---DFDKITEAI-QLAISERRYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKL-----SDSTI-DYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRA--NAIIMKDIQYGKSQKIFLVFHFIRKGPMCLTKKTIKE------GVP----YRRPKGVSVIEVTNVMTENLDSEKQIGIQLITRDECLENNAEKLITDYRI-----NKREYSSTINIQL--------KTIRPEDISDRNVMVLGLDPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNKV--VMPSFDWRGFD---EYSSVIYYHNAKPKWCEVICIPLFEKFSKFPPHTHIRFIIWHRSLNDR---SKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMD 1578
            G  +AI  Y ++      ++  +EL  GD + +   +  W  G K+ +    C   +FP+++++I+   ++           E+   +  W T I++  L+V+TT    F+ + ++  +L I + + +S     + +   R  + + +D     LG     RNE+G  +D+ ++S++  Y  H     S  RV  L      + TI D  SL + + +V            +I+I+LY L+ +  T  S T+        +    ++A       +DIQ    +K  +V   +   P+  +  T+++       +P     R+     ++E++++    +  E +  +  + R+  L  + +      RI     N  E    I+ QL        K   P   S     +L        +  + RN +Y+ L  AE+    K SD N E  + + +  G+ +  V  +    G      Y S++ YH  KP W E I I L    S      ++R + + +   D+    K P  +A+++L    ++A+L   E    H L +YK+D
Sbjct:    5 GFYYAIVQYTFEDPLPSCDAPRLELFIGDRICVYGQHGEWGYGRKFDEKNGKC--GIFPLAYVQIVQKSMFVSTSDGYLVVDEISRVINEWWTKIKE--LMVETTRIGSFEDLMDSFNELLIIKTKIESGGIPIEELSKLRLRVSKLVDRGNTILGQDVVIRNEEGVPLDVESLSLLRTYEAH---ISSKGRVGSLMREKPENVTINDSFSLLLSIKSVELH----CKYSCEISISLYDLDKKMFTTDSYTFLWNSGSGKHTDLNLKALFTDFAKEDIQ----KKYLMVTRVVHVSPIESSNATMRKHGHHEATIPKTFYCRQSYASDIMEMSSIFLAGVGHEAKERVIFLNREPELPLSLKAYHATNRIPKNLSNDMETKLLISTQLVPGNVSQIKARHPHLFSRCPAAILRRADRTAVSIEDSRNEMYITLMQAELSG--KSSDRNIEARLHVVESNGHVMENVFETISVTGSQLSTVYKSIVVYHTDKPMWTEPIKIALPSCASH---DVYLRILFYSKKAYDKPKPEKGPFAIAHVQLI--RSSALLCDGE----HDLAVYKID 546          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Fly
Match: mbc (gene:FBgn0015513 transcript:FBtr0304729)

HSP 1 Score: 136.732 bits (343), Expect = 1.621e-31
Identity = 222/925 (24.00%), Postives = 371/925 (40.11%), Query Frame = 1
Query:   64 FAIAIYNYKPANSQH-MELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIK------------ILSNDIYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQ-------LAISERRYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKLSD--STIDYVSLYIK--LLNVNFERSQLADEILDINITLYKLEDRKITRISETYS---HRVAIRSYGCDLIRANAIIMKDIQYG--KSQKIFLVFHFIRKGPMCL--------TKKTIKEGVP-------------------------YRRPKGVSVIEVTNVMTENLDSEKQIGIQLI-TRDECLENNAEKLITDYRINKREYSSTINIQ-----LKTIRPE--DISDRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNKVVMPSFDWRG-----FDEYSSVIYYHNAKPKWCEV--ICIPLFEKFSKFPPHTHIRFIIWHRSLN---DRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGD-PELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNLPDSE--NQLDKFIQDTMHF--------DVHKQIFRELINNKPES-DSNIL-------------RATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNCMN----SKLFVDSQCRSIILPETTKNI 2499
            F IA  N+   +  H + L  GD + I +    WY G++     I  +FP S+I             I   DI  E+   +  W +  +D Y L     F KI   +          IS       + K K++ +N      ++D   K LGL    R+E G+ +D N +   +LY QH    +   + ++LS    T    + Y    LL+VN    +  ++  D+  TL+  E  K   ISE Y     R  I +   D I  N ++  D+        K++LV + IR G M          T  +I   +                           RRP GV+  ++T  + ++ D    I +  I    E L+    KLI +  I K +    + I+     +K I+ E   +   NV V   +G  +   P    + RN LYL +   E  +  K S+ N EV + + + QG   +MP     G      DEY SV+YYH+ KPKW E   I +P+ E F +     H+RF++ HRS N   DR++ P G+AY++L   +   I         H L +YK+D +K  +     C+ E      EL   K      T          ++ KD L +   +CST+ T    L  + N S   +T+   L+     +  +   E+ KF   IL++  +++ +        + +   +  + + + +L      + LD +I ++  F        DV ++   E I+ K +S D N L             R   + +K  ++S   Y  EM  N D       L +     ++ +    +       +L+   +I   L+ V + +   RL  ++++          ++  M C+     +KLF   +CR+I+LP   K+I
Sbjct:   14 FGIAKCNFDQESKPHRLNLDVGDAVIILKETTHWYYGYRQKAKEIRGIFPKSYIHLCEYNIVNGEYCIQRTDIVEEITKVLLEWGSIAKD-YFLTTNPSFPKIRRKMNELNNNRAALISGNLPLDEVRKVKLLATN------QIDTGNKLLGLDMVVRDESGDILDTNAICTTELYEQHMHAVQRIDKANRLSSERGTTRTPNKYSHNILLHVNAFVCKFQEDS-DLLFTLFDGETHK--PISENYVVKWSRTGI-ARDTDQIDNNRVLFTDLSKSDLAIAKMYLVCYAIRIGSMEFKDSAESKRTSMSIANSMLNASSRKASQLSVSSSGSSSSNGEYIIRRPFGVACKDLTPFINKSDDFRGNIDLPFIMCEKETLDGTLRKLIANKDIGKIDSKMAVTIEVLRGDIKQIKEEFPRLMHTNVPVARKMGFPEVILPG---DVRNDLYLTICSGEFARIAKTSEKNVEVSVCVANEQG--YLMPGVLSIGAGHQPIDEYKSVVYYHDDKPKWQETFKIHVPI-EDFKQ----CHLRFVLKHRSSNEQKDRTEKPFGLAYVRLMQANGTTI-----TQGQHILAVYKIDHKKYDKT-VANCYLELPATVAELQGAKPSIGGLT----------LLPKDQLSIGVNLCSTKLTQSVSLLGLLNWSAHKETLEQSLN----ALSTVPGEEVVKFLQDILDALFNILVENDHPEKYDQLVFMSIIHLIETVSDLKYQHFLSVLDVYINESFSFTLAYTKLMDVLQKNISEAISPKEKSADGNDLEESPEVRRLYKTTRYLHYVMKFVIRSRVLYA-EMNCNTDYMDFATRLQELLRMFIDMIGCPSNLLKSEGALLKNLHIIATDLMQVFEHV---RLSISIVEILEKFPPRRLTQSKMGCIKDFVETKLFTLPKCRAILLPVFCKHI 893          

HSP 2 Score: 111.309 bits (277), Expect = 9.089e-24
Identity = 122/532 (22.93%), Postives = 222/532 (41.73%), Query Frame = 1
Query: 3358 DIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKTELITQIDQAMESA-----YSNYCEEMTKAFKQVLSSNTKYAFDSQLVENIIVQMNNIEECSHH---------------------------LNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEK-EDWEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYTTVERKYPEP-EDFASADKKIFYM----PVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLM----NNTEEDPSKRIIDGRIIL-CEEKLPNILSVGPVKSIEKIPIDPFKEA---LSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRYVSP-VSGGVTKLVEMIPNND 4806
            DIR   A++I+ +W  L   K +F         +++ I   ++R   +   FD++  +  + + E  +  D    +A     +S++   M +    ++ +    A    L E I+     +E C+ H                           + D S  N M    +L +FY+E+   ++  RY+ KL  +H + +NY+E   TL   +   +W+   + H      + +C    Q+K  L  E ++YF+K + WE  I++C+ L + Y E   D++KL+ + ++M+   +KI+ E R  S  + + + G+GFP+F   L  +  + R K     S+    +  Q     + +    P +D  ++D +   +    P+    F    K+  KI+   I+KY+    +++F + R      N  + D  + +   R  L     LP IL   PV       I P + A   + D    IR+  +L++  ET        L  K+  I    V P V GG  K  E    +D
Sbjct: 1121 DIRKDTAMEIRKMWFQLGQHKPKFVPQLVEPILEMSMIPEKELRQETIPIFFDMMQCEYYSSRLEHESYGDTKFNNAHHKGNFSDFKTAMIEKLDILIGAGKGDAEYKHLFETIM-----LERCAAHNTLNVDGTAFVQMVTRLMDKLLEYRFIIQDESKENRMACTFSLLQFYSEVDLKEMYIRYVNKLCALHMEFENYTEAAFTLKLHTELLRWTDTELSHQLRSYRHNNCRTHRQLKEALYFEIMEYFDKGKQWECAIDMCRVLARQYEEEIFDYLKLAELLNRMALFYEKIIKELRHNSEYFRVCFYGRGFPRF---LQNRVYIFRGKEYERHSDFCARMLVQHPQAELMQTLEAPGDDITNSDGQYIQVNKVEPIMGQAF---NKFNDKIINNEIVKYFTANNVQKFQFSRPFRDSTNGGDRDDVRNLWLERTELRISYPLPGILRWFPVVETNTFKISPLERAVEIMKDTNRDIRQLVILHKSDETLHI---NPLSMKLNGI----VDPAVMGGFAKYEEAFLTDD 1634          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Fly
Match: mbc (gene:FBgn0015513 transcript:FBtr0084459)

HSP 1 Score: 136.732 bits (343), Expect = 1.635e-31
Identity = 222/925 (24.00%), Postives = 371/925 (40.11%), Query Frame = 1
Query:   64 FAIAIYNYKPANSQH-MELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIK------------ILSNDIYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQ-------LAISERRYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKLSD--STIDYVSLYIK--LLNVNFERSQLADEILDINITLYKLEDRKITRISETYS---HRVAIRSYGCDLIRANAIIMKDIQYG--KSQKIFLVFHFIRKGPMCL--------TKKTIKEGVP-------------------------YRRPKGVSVIEVTNVMTENLDSEKQIGIQLI-TRDECLENNAEKLITDYRINKREYSSTINIQ-----LKTIRPE--DISDRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNKVVMPSFDWRG-----FDEYSSVIYYHNAKPKWCEV--ICIPLFEKFSKFPPHTHIRFIIWHRSLN---DRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGD-PELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNLPDSE--NQLDKFIQDTMHF--------DVHKQIFRELINNKPES-DSNIL-------------RATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNCMN----SKLFVDSQCRSIILPETTKNI 2499
            F IA  N+   +  H + L  GD + I +    WY G++     I  +FP S+I             I   DI  E+   +  W +  +D Y L     F KI   +          IS       + K K++ +N      ++D   K LGL    R+E G+ +D N +   +LY QH    +   + ++LS    T    + Y    LL+VN    +  ++  D+  TL+  E  K   ISE Y     R  I +   D I  N ++  D+        K++LV + IR G M          T  +I   +                           RRP GV+  ++T  + ++ D    I +  I    E L+    KLI +  I K +    + I+     +K I+ E   +   NV V   +G  +   P    + RN LYL +   E  +  K S+ N EV + + + QG   +MP     G      DEY SV+YYH+ KPKW E   I +P+ E F +     H+RF++ HRS N   DR++ P G+AY++L   +   I         H L +YK+D +K  +     C+ E      EL   K      T          ++ KD L +   +CST+ T    L  + N S   +T+   L+     +  +   E+ KF   IL++  +++ +        + +   +  + + + +L      + LD +I ++  F        DV ++   E I+ K +S D N L             R   + +K  ++S   Y  EM  N D       L +     ++ +    +       +L+   +I   L+ V + +   RL  ++++          ++  M C+     +KLF   +CR+I+LP   K+I
Sbjct:   14 FGIAKCNFDQESKPHRLNLDVGDAVIILKETTHWYYGYRQKAKEIRGIFPKSYIHLCEYNIVNGEYCIQRTDIVEEITKVLLEWGSIAKD-YFLTTNPSFPKIRRKMNELNNNRAALISGNLPLDEVRKVKLLATN------QIDTGNKLLGLDMVVRDESGDILDTNAICTTELYEQHMHAVQRIDKANRLSSERGTTRTPNKYSHNILLHVNAFVCKFQEDS-DLLFTLFDGETHK--PISENYVVKWSRTGI-ARDTDQIDNNRVLFTDLSKSDLAIAKMYLVCYAIRIGSMEFKDSAESKRTSMSIANSMLNASSRKASQLSVSSSGSSSSNGEYIIRRPFGVACKDLTPFINKSDDFRGNIDLPFIMCEKETLDGTLRKLIANKDIGKIDSKMAVTIEVLRGDIKQIKEEFPRLMHTNVPVARKMGFPEVILPG---DVRNDLYLTICSGEFARIAKTSEKNVEVSVCVANEQG--YLMPGVLSIGAGHQPIDEYKSVVYYHDDKPKWQETFKIHVPI-EDFKQ----CHLRFVLKHRSSNEQKDRTEKPFGLAYVRLMQANGTTI-----TQGQHILAVYKIDHKKYDKT-VANCYLELPATVAELQGAKPSIGGLT----------LLPKDQLSIGVNLCSTKLTQSVSLLGLLNWSAHKETLEQSLN----ALSTVPGEEVVKFLQDILDALFNILVENDHPEKYDQLVFMSIIHLIETVSDLKYQHFLSVLDVYINESFSFTLAYTKLMDVLQKNISEAISPKEKSADGNDLEESPEVRRLYKTTRYLHYVMKFVIRSRVLYA-EMNCNTDYMDFATRLQELLRMFIDMIGCPSNLLKSEGALLKNLHIIATDLMQVFEHV---RLSISIVEILEKFPPRRLTQSKMGCIKDFVETKLFTLPKCRAILLPVFCKHI 893          

HSP 2 Score: 110.923 bits (276), Expect = 9.421e-24
Identity = 122/532 (22.93%), Postives = 222/532 (41.73%), Query Frame = 1
Query: 3358 DIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKTELITQIDQAMESA-----YSNYCEEMTKAFKQVLSSNTKYAFDSQLVENIIVQMNNIEECSHH---------------------------LNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEK-EDWEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYTTVERKYPEP-EDFASADKKIFYM----PVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLM----NNTEEDPSKRIIDGRIIL-CEEKLPNILSVGPVKSIEKIPIDPFKEA---LSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRYVSP-VSGGVTKLVEMIPNND 4806
            DIR   A++I+ +W  L   K +F         +++ I   ++R   +   FD++  +  + + E  +  D    +A     +S++   M +    ++ +    A    L E I+     +E C+ H                           + D S  N M    +L +FY+E+   ++  RY+ KL  +H + +NY+E   TL   +   +W+   + H      + +C    Q+K  L  E ++YF+K + WE  I++C+ L + Y E   D++KL+ + ++M+   +KI+ E R  S  + + + G+GFP+F   L  +  + R K     S+    +  Q     + +    P +D  ++D +   +    P+    F    K+  KI+   I+KY+    +++F + R      N  + D  + +   R  L     LP IL   PV       I P + A   + D    IR+  +L++  ET        L  K+  I    V P V GG  K  E    +D
Sbjct: 1083 DIRKDTAMEIRKMWFQLGQHKPKFVPQLVEPILEMSMIPEKELRQETIPIFFDMMQCEYYSSRLEHESYGDTKFNNAHHKGNFSDFKTAMIEKLDILIGAGKGDAEYKHLFETIM-----LERCAAHNTLNVDGTAFVQMVTRLMDKLLEYRFIIQDESKENRMACTFSLLQFYSEVDLKEMYIRYVNKLCALHMEFENYTEAAFTLKLHTELLRWTDTELSHQLRSYRHNNCRTHRQLKEALYFEIMEYFDKGKQWECAIDMCRVLARQYEEEIFDYLKLAELLNRMALFYEKIIKELRHNSEYFRVCFYGRGFPRF---LQNRVYIFRGKEYERHSDFCARMLVQHPQAELMQTLEAPGDDITNSDGQYIQVNKVEPIMGQAF---NKFNDKIINNEIVKYFTANNVQKFQFSRPFRDSTNGGDRDDVRNLWLERTELRISYPLPGILRWFPVVETNTFKISPLERAVEIMKDTNRDIRQLVILHKSDETLHI---NPLSMKLNGI----VDPAVMGGFAKYEEAFLTDD 1596          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Fly
Match: spg (gene:FBgn0264324 transcript:FBtr0330304)

HSP 1 Score: 119.398 bits (298), Expect = 3.074e-26
Identity = 119/466 (25.54%), Postives = 198/466 (42.49%), Query Frame = 1
Query: 3277 TQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKTELITQIDQAMESAYSNYCEEMTKAFKQVLSSNT-----KYAFDSQLVENIIVQMNNIEECS------------HHLNDNSPING-------MIVINNLRKFY-NEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRN--KRNVSEMSIDLNSQFEYTTVERKYPEPED--FASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNIL 4572
            TQP L LE+      L+++ S     GD+R+    QI ++W  L   K  F  +    F ++T +    +R   +   +D++             Q +QA   ++     E+      ++S N      +  F + L+E + V+  N +E                L+  S + G       M    NL  FY NE+ R ++  RY++KL  +H + +NY+E G TL   +S   W  E    SF P +    + E+Q K +L  E LKYF+K   WEKGI +CKEL   Y     D+ KLS +  + ++  + I+ + RPE   + + + G G P F+ +   K  V R      +   +  L ++F    +      P++    + D+ I    V+P       K     V ++I ++Y+  ++  FIY R M     D         I+  I+     LP IL
Sbjct: 1032 TQPSLQLEQYREPKRLKILHSH----GDMRVLMGFQILSMWSQLGEQKLHFIPSMVGPFLEVTLVPEPALRKATLSVFYDMM-------------QCEQAARGSFRLVESELIDKLDLLISENKGDDEYRELFSTILLEKVQVENPNWKEAGIAFIASVTRLLERLLDYRSVMQGEENRDKRMTCTVNLLNFYKNEINRKEMYLRYIYKLHNLHLQAENYTEAGFTLKLYASMLSWDRET--QSFAPFD-NSGQPEWQRKERLYHEILKYFDKGKCWEKGIPLCKELAHLYETRRFDYNKLSEILIQEAKFFQNILTQLRPEPEYFRVGFYGMGLPLFVRN---KQFVYRGLEYERIGAFTQRLQTEFPSAQILGNNSPPDNAILNAPDQYIQISNVRPVGDAQALKTAMVPVPEKIARFYEVNDVTRFIYDRPMYKGTVDKDNEFKSLWIERTILEIASPLPGIL 1474          

HSP 2 Score: 59.6918 bits (143), Expect = 4.168e-8
Identity = 49/159 (30.82%), Postives = 76/159 (47.80%), Query Frame = 1
Query: 1174 RNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNKVVMPSFDWRGFD---EYSSVIYYHNAKPKWCEV--ICIPLFEKFSKFPPHTHIRFIIWHRSLNDRSKNPR--GVAYMKLFPDDNNAILSKNENDNYHSLTIYKM-DMEKIKRAEY--LTCHP 1620
            RN L+LNL   E ++  K +  N  V + + D  GN +    +   G +   +Y S+I YH   P W E+  + +P+ +KFS      H+RF   H S  D+++ P+    ++ +L  D   A L     D  H L +YK  D  K++ A Y  L C P
Sbjct:  415 RNDLFLNLERGEFERGGKNTGKNILVTVVVLDVAGNVLTDCLWGASGMESQPQYRSMILYHQNAPSWNEMLRLSVPI-DKFST----AHVRFEFRHCSTRDKTE-PKLFAFSFARLM-DTGGATL----GDGLHELYVYKCEDPAKLQVANYLRLQCRP 562          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Fly
Match: spg (gene:FBgn0264324 transcript:FBtr0330303)

HSP 1 Score: 119.013 bits (297), Expect = 3.328e-26
Identity = 119/466 (25.54%), Postives = 198/466 (42.49%), Query Frame = 1
Query: 3277 TQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKTELITQIDQAMESAYSNYCEEMTKAFKQVLSSNT-----KYAFDSQLVENIIVQMNNIEECS------------HHLNDNSPING-------MIVINNLRKFY-NEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRN--KRNVSEMSIDLNSQFEYTTVERKYPEPED--FASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNIL 4572
            TQP L LE+      L+++ S     GD+R+    QI ++W  L   K  F  +    F ++T +    +R   +   +D++             Q +QA   ++     E+      ++S N      +  F + L+E + V+  N +E                L+  S + G       M    NL  FY NE+ R ++  RY++KL  +H + +NY+E G TL   +S   W  E    SF P +    + E+Q K +L  E LKYF+K   WEKGI +CKEL   Y     D+ KLS +  + ++  + I+ + RPE   + + + G G P F+ +   K  V R      +   +  L ++F    +      P++    + D+ I    V+P       K     V ++I ++Y+  ++  FIY R M     D         I+  I+     LP IL
Sbjct: 1032 TQPSLQLEQYREPKRLKILHSH----GDMRVLMGFQILSMWSQLGEQKLHFIPSMVGPFLEVTLVPEPALRKATLSVFYDMM-------------QCEQAARGSFRLVESELIDKLDLLISENKGDDEYRELFSTILLEKVQVENPNWKEAGIAFIASVTRLLERLLDYRSVMQGEENRDKRMTCTVNLLNFYKNEINRKEMYLRYIYKLHNLHLQAENYTEAGFTLKLYASMLSWDRET--QSFAPFD-NSGQPEWQRKERLYHEILKYFDKGKCWEKGIPLCKELAHLYETRRFDYNKLSEILIQEAKFFQNILTQLRPEPEYFRVGFYGMGLPLFVRN---KQFVYRGLEYERIGAFTQRLQTEFPSAQILGNNSPPDNAILNAPDQYIQISNVRPVGDAQALKTAMVPVPEKIARFYEVNDVTRFIYDRPMYKGTVDKDNEFKSLWIERTILEIASPLPGIL 1474          

HSP 2 Score: 60.077 bits (144), Expect = 3.283e-8
Identity = 49/158 (31.01%), Postives = 74/158 (46.84%), Query Frame = 1
Query: 1174 RNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNKVVMPSFDWRGFD---EYSSVIYYHNAKPKWCEV--ICIPLFEKFSKFPPHTHIRFIIWHRSLNDRSKNPRGVAY-MKLFPDDNNAILSKNENDNYHSLTIYKM-DMEKIKRAEY--LTCHP 1620
            RN L+LNL   E ++  K +  N  V + + D  GN +    +   G +   +Y S+I YH   P W E+  + +P+ +KFS      H+RF   H S  D+++ P+  A+      D   A L     D  H L +YK  D  K++ A Y  L C P
Sbjct:  415 RNDLFLNLERGEFERGGKNTGKNILVTVVVLDVAGNVLTDCLWGASGMESQPQYRSMILYHQNAPSWNEMLRLSVPI-DKFST----AHVRFEFRHCSTRDKTE-PKLFAFSFARLMDTGGATL----GDGLHELYVYKCEDPAKLQVANYLRLQCRP 562          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Fly
Match: spg (gene:FBgn0264324 transcript:FBtr0336766)

HSP 1 Score: 119.013 bits (297), Expect = 3.328e-26
Identity = 119/466 (25.54%), Postives = 198/466 (42.49%), Query Frame = 1
Query: 3277 TQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKTELITQIDQAMESAYSNYCEEMTKAFKQVLSSNT-----KYAFDSQLVENIIVQMNNIEECS------------HHLNDNSPING-------MIVINNLRKFY-NEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRN--KRNVSEMSIDLNSQFEYTTVERKYPEPED--FASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNIL 4572
            TQP L LE+      L+++ S     GD+R+    QI ++W  L   K  F  +    F ++T +    +R   +   +D++             Q +QA   ++     E+      ++S N      +  F + L+E + V+  N +E                L+  S + G       M    NL  FY NE+ R ++  RY++KL  +H + +NY+E G TL   +S   W  E    SF P +    + E+Q K +L  E LKYF+K   WEKGI +CKEL   Y     D+ KLS +  + ++  + I+ + RPE   + + + G G P F+ +   K  V R      +   +  L ++F    +      P++    + D+ I    V+P       K     V ++I ++Y+  ++  FIY R M     D         I+  I+     LP IL
Sbjct: 1032 TQPSLQLEQYREPKRLKILHSH----GDMRVLMGFQILSMWSQLGEQKLHFIPSMVGPFLEVTLVPEPALRKATLSVFYDMM-------------QCEQAARGSFRLVESELIDKLDLLISENKGDDEYRELFSTILLEKVQVENPNWKEAGIAFIASVTRLLERLLDYRSVMQGEENRDKRMTCTVNLLNFYKNEINRKEMYLRYIYKLHNLHLQAENYTEAGFTLKLYASMLSWDRET--QSFAPFD-NSGQPEWQRKERLYHEILKYFDKGKCWEKGIPLCKELAHLYETRRFDYNKLSEILIQEAKFFQNILTQLRPEPEYFRVGFYGMGLPLFVRN---KQFVYRGLEYERIGAFTQRLQTEFPSAQILGNNSPPDNAILNAPDQYIQISNVRPVGDAQALKTAMVPVPEKIARFYEVNDVTRFIYDRPMYKGTVDKDNEFKSLWIERTILEIASPLPGIL 1474          

HSP 2 Score: 60.077 bits (144), Expect = 3.283e-8
Identity = 49/158 (31.01%), Postives = 74/158 (46.84%), Query Frame = 1
Query: 1174 RNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNKVVMPSFDWRGFD---EYSSVIYYHNAKPKWCEV--ICIPLFEKFSKFPPHTHIRFIIWHRSLNDRSKNPRGVAY-MKLFPDDNNAILSKNENDNYHSLTIYKM-DMEKIKRAEY--LTCHP 1620
            RN L+LNL   E ++  K +  N  V + + D  GN +    +   G +   +Y S+I YH   P W E+  + +P+ +KFS      H+RF   H S  D+++ P+  A+      D   A L     D  H L +YK  D  K++ A Y  L C P
Sbjct:  415 RNDLFLNLERGEFERGGKNTGKNILVTVVVLDVAGNVLTDCLWGASGMESQPQYRSMILYHQNAPSWNEMLRLSVPI-DKFST----AHVRFEFRHCSTRDKTE-PKLFAFSFARLMDTGGATL----GDGLHELYVYKCEDPAKLQVANYLRLQCRP 562          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Zebrafish
Match: dock5 (dedicator of cytokinesis 5 [Source:ZFIN;Acc:ZDB-GENE-080108-4])

HSP 1 Score: 160.229 bits (404), Expect = 1.407e-38
Identity = 206/917 (22.46%), Postives = 369/917 (40.24%), Query Frame = 1
Query:   64 FAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKILSNDI----------------YPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERRYDSNIEKSKMIESN----RRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQH-----------QREYESSRRVSKLSDSTIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAI--IMKDIQYGK--SQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSE--------KQIGIQ-----------------LITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDI----------SDRNVMV---LGLD----PYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGN---KVVMPSFDWRGFDEYSSVIYYHNAKPKWCEV--ICIPLFEKFSKFPPHTHIRFIIWHRSLN---DRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAE-YLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDV--NELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTMHFDVHKQIFRELINNKPESDSN-----ILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPI-----LRSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSCSDLD-ANMKSELTMNCMNSKLFVDSQCRSIILPETTKNI 2499
            + +AIYNY       + L+ GD + I E + GWYRG+   Q     +FP S+I +    +                  EL   +  W       Y+   +T F  +    Q+A S   Y S I    +   +    ++ +  K+D   + LGL    R+E G  +D  + S + L+  H           Q E    + + K   S    V  Y  L+N+      + ++  ++ ++LY  +  +   ISE +  R        ++ + N +  +  D+       Q++FLV   IR G M L K+  K     RRP GV+V+++T++     D +        +QI ++                 +I  +E L     K+I    +N +     + ++L    P D+           DR   +   +G      P Y       RN +Y+ L   E D+ +KK+  N EV +S+ D +GN   K + P   + G  EY SVIYY   +P W E   + IP+ E   +     H+R    HRS     D+S+ P G+A+++L   D   +      D  H L +YK+D +K   A+ YL+        P  Y+        T +  +      V KD+  + T+ CST+ T +  L  + N     + +      EEI+ K ++V   E+ KF    L++  +++ + +++      +   L  +   I ++      P  E  ++K    T+ +    ++    + +  +S         L+A  +  +  V+S   Y R   G  ++   F    DS   +   ++   D+P+     ++  +L+    IIN L  V   + ++  ++  ++S  D      K    +  + S LF    CR ++LP  T  +
Sbjct:   12 YGVAIYNYDAKGEPELSLQVGDTVHILETFEGWYRGYTLRQKSQKGIFPASYIHLKEAKVEGTGKQETVVPTELPLVQELGTTLREWTQIWHKLYVSNKSTLFRSVQ---QMAYSLIEYRSQIVSGTLPNDDLVELKKKVTAKIDYGNRILGLDLVVRDEAGNTLDPESSSTVSLFRAHESASHSIDERIQEEKMRLQNLEKRRQSLFSGVHTYSLLMNLRNFVCNIGEDA-ELFMSLYDPDKSEF--ISENFLVRWDSTGMPKEIEKLNNLPALFTDLNSSDLLRQRLFLVCQIIRVGCMEL-KEGKKHTGGLRRPFGVAVMDITDIAHGKTDDDDKQYFIPFQQIAMETYIRQRQLIMSPLIPSRVIGENEPLVAVFNKVIATREVNHKGQGLFVTLKL---LPGDVFQVQKDYPHFVDRTTAIVRKMGFPEIILPGY------VRNDIYVTLLQGEFDRGKKKTPKNVEVIVSVLDEEGNPMEKAIFPGAGYEGITEYKSVIYYQVKQPCWNETVKVAIPI-EDVCR----CHLRLTFRHRSSQDSRDKSEKPFGMAFVRLMKSDGTTL-----PDGKHELIVYKVDGKKADDAKTYLSL-------PGTYTEVEEKERQTGKSFHHGGAVPVTKDSFQIATLTCSTKLTQNVDLLGLLNWRSNTERL------EEILQKLMEVEGGEIIKFLQDTLDALFNIMMETSEEETYDTLVFNALVFIISLIGDIKFQHFNPVLETYINKHFSATLAYQKLTKVLNYFVGHAEDSTHTERLYAALKAFKYLFRFIVQSRVLYLR-FYGKSEDGGQFQ---DSIRTLFLSISILMDRPLDEGVKIKGAILKYLPTIINDLQKVFDAVELSVQLSKFIESIPDFQMVRQKLGCLVKIVESNLFKQPDCRDVLLPLITDQL 885          

HSP 2 Score: 138.658 bits (348), Expect = 5.132e-32
Identity = 119/453 (26.27%), Postives = 203/453 (44.81%), Query Frame = 1
Query: 3355 GDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDR--------ENKKTELITQIDQAMESAYSNYCEEMTKAF--KQVLSSNTKYAFDSQ----LVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNKRN--VSEMSIDLNSQFEYTTVERKYPEPED--FASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIE 4644
            GD+R S   +++++W +L   K +F         + T +   ++R   +   FD++  +         +  + ELIT++DQ +E    +   E  K    K +L    ++ + SQ    L   +   + N+       +D SP   M    NL  FY E  R DI  RYL+KL  +H   +NY+E   TLL  +   +WS +      +P +      + ++K +L +E +   +K   WEK IE+ K+L+K +     DFI+L  +  + ++  + IM   RP+   + + Y G+GFP F+ +   K  + R K    + + S+ L SQF           P D   +S  + I    VKP     P+ ++ K + ++IL YY   E+++F Y R     E+DP        I+    +   + P IL    VKS+    I P   A+  +E
Sbjct: 1075 GDMRKSIGFKLRDMWYNLGPQKMKFIPAMVGPILEATLVPEPELRKATIPIFFDMMQCEHHFTTNHTFQKFENELITKLDQEVEGGRGD---EQYKILLEKTLLEHCRRHRYLSQPGEALALLLSSLLENLLAYRTFTHDESPELRMSCTVNLLNFYKEKKREDIYIRYLYKLRDLHLVCENYTEAAYTLLLHAELLEWSEKPCSPHLIPGDAAQVWTQQELKERLFQEIMCNLDKGKMWEKAIEMAKQLVKLHENQMFDFIELGQLLKQQAQYYENIMHAMRPQPEYFAVGYYGQGFPSFLRN---KMFIYRGKEYEWLEDFSLKLLSQFPNAVRMTSTSPPADNICSSTGQHIQCFTVKPV-LNLPSHFKDKGLPEQILNYYRTNEVDKFQYSRPFRKGEKDPDNEFATMWIERTTFITAYRFPGILKWFEVKSMSVEEISPLDNAIETME 1520          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Zebrafish
Match: dock1 (dedicator of cytokinesis 1 [Source:ZFIN;Acc:ZDB-GENE-080108-5])

HSP 1 Score: 117.857 bits (294), Expect = 1.217e-25
Identity = 138/527 (26.19%), Postives = 234/527 (44.40%), Query Frame = 1
Query:   73 AIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKI---------LSNDIYP-------ELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERR--YDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQ----------REYESSR------RVSKLSDSTIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYG----KSQKIFLVFHFIRKGPMCL---TKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQ---IGIQLITRD-ECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDIS----------DRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNK---VVMPSFDWRGFDEYSSVIYYHNAKPKWCEVI--CIPLFEKFSKFPPHTHIRFIIWHRSLND 1461
            A+YNY   +++ + L+ GD + I E Y GWYRG++  +     VFP  +I +             + P       E+   +  W    RD Y+      F+ + + I   I  R       + + ++ E  +R +  KMD   K L L    R++ G  +D +  S ++L+  H+          +E +S +      R++K + ST  + +L++ L NV  +  + A+ ++    +LY   + K   ISE Y  R +      D+ + + +       G    K +KI  V   +R G M L     K +  G+  RRP GV+V++VT+++T  +D E +   I  Q +  + + L++   K+I    +N +     + ++L    P DI           DR+  V   +G  +   P    + RN +Y+ L   + DK  K +  N EV +S+ D  G K   V+ P     G  EY SVIYY   +P+W E I   IP+ E  ++    +H+RF   HRS  D
Sbjct:    1 AVYNYDARSNEELSLQIGDTVHILETYEGWYRGYRLRRKSKKGVFPACYIHLKEATVEGSGQKETVIPTELPLVHEVTTTLREWAAIWRDLYVGDKREMFNTVRDMIYDLIEWRSQILSGTLPQDELTELKQR-VTSKMDYGNKYLDLDLVVRDKDGNILDPDLTSTVNLFRAHETASKQIEARIQEEKSQKQNLDLNRLAKFA-STPSF-ALFVTLKNVVCKIGEDAEVLM----SLYDPIESKF--ISENYLVRWSSSGLVKDIDQLHNLRAVFTDLGSEDLKREKISFVCQIVRVGRMELRDNNTKKLTSGL--RRPFGVAVMDVTDIITGKMDDEDKQHFIPFQPVAGESDFLQSVINKVIAAKEVNHKGQGLWVTLKL---LPGDIHQIRKDFPHLVDRSTAVARKMGFPEIIMPG---DVRNDIYVTLVQGDFDKGSKTTPKNVEVTMSVHDEDGKKLESVIFPGAGDEGILEYKSVIYYQVKQPRWYETIKVAIPI-EDVNR----SHLRFTFKHRSSQD 505          

HSP 2 Score: 108.612 bits (270), Expect = 6.700e-23
Identity = 187/891 (20.99%), Postives = 350/891 (39.28%), Query Frame = 1
Query: 2059 HKQIFRELINNKPESDSNILRATDWFIKIAVK---SFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGLIINALIPVCQPIGMARLVNN-LLKSCSDLDANMKSELTMNCMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSC-VAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCE-----ARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIV----HLDR--ENKKTELITQIDQAMESAYSNYCEEMTKAFKQVLSSNT-KYAFDSQLVENIIVQMNNIEECSHH----LNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKEDWEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYT-TVERKYPEPEDFA-SADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDP----SKRIIDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIE 4644
            H  + R LI  K        RA D  + + V    SF+ YE +  G  D       L  S+  ++   A       ++   L+    I+N L  V  P  +++L +  +LK         K    ++ ++S LF    CR I+LP  T  +         K++ E   +    L++ C  + + +++  R       ++     +  II  K+LR+    ++S G +                    S+I +F++ ++  L      +Q DD  +        +  TD  D +ME F +  +L    V+P                                      W+ M  +Q++ FL  + Q   ++ K +    L Q                  + +L  +      + +TQ  L LE   S    ++         D+R     +I+++W +L   K +F         ++T +   ++R   +   FD++    H  R  +  + E+IT++D  +E    +  E+    F+++L  +  K+ + ++  E  +  +  + E        ++D +  N M    N+  FY E+ R ++  RYL+KL  +H++  NY+E G TLL  +   +WS E         +      + Q+K +L +E + YF+K    +   +      G   +      L    ++  E + K++   RP+ + + + Y G GFP F+ +   K  + R K      +    L +QF     ++   P  ED   S+ + I    VKP     P K++ K V ++I+ +Y   E+++F Y R +   E+DP    S   I+    +   KLP IL    V S+    I P + A+  ++
Sbjct:  703 HIGVCRPLIQMK--------RAPDRLLFVCVCVCFSFRLYENK--GESDFMESLRNLFASFNAMMNSGAEGTGG--VKGAALKYVPTIVNDLKLVFDPKELSKLFSEFILKVPLGRLVKQKLHCMIDIVHSDLFTQHDCREILLPLMTDQL---------KLHLENHEE----LESCCQLLSDILEVLYRK------DVGPTQWHVQIIMEKLLRTINRTVISMGRD-------------------SSLIGSFVACMTGTL------RQMDDYHYTHLISTFGKMRTDVVDFLMETFIMFKDLIGKNVYPG------------------------------------DWVIMNMMQNKVFLRAINQYAAVLSKKF----LDQT---------------NFELQLWNNYFHLAVAFLTQESLQLENFSSDKRAKIFHKY----QDMRRQIGFEIRDMWYNLGPHKIKFIPEMVGPILEMTLVPEIELRKATIPIFFDMMQCEFHFRRCFQTFENEIITKLDHEVEGGRGD--EQYKILFQKILLEHCRKHKYLAKTGETFVTLVVRLLERLLDYRTIMHDENKENRMSCTVNVLNFYKEIEREEMYIRYLYKLCDLHKECDNYTEAGYTLLLHAKLLKWSEEACAAHLTQRDGYQASTQGQLKDQLYQEIINYFDKGKLFRESILNTAQTAGTNPHVTAERLLRRKQAQFYESIVKVI---RPKPDYFAVGYNGLGFPSFLRN---KMFIYRGKEYERWEDFEARLLTQFPNAEKMKTTTPPSEDIRNSSGQYIQCFTVKP-LLELPPKFQNKPVSEQIVSFYTVNEVQKFQYSRPVRKGEKDPDNEFSNMWIERTTYVTAYKLPGILRWFEVLSVSAEEISPLENAMETMQ 1469          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Zebrafish
Match: DOCK4 (si:dkey-81e3.1 [Source:ZFIN;Acc:ZDB-GENE-120703-34])

HSP 1 Score: 105.916 bits (263), Expect = 4.303e-22
Identity = 171/781 (21.90%), Postives = 314/781 (40.20%), Query Frame = 1
Query:   52 EGDCFAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKI----------------LSNDIYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQ--LAISERRYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKLSDSTIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYGKS---QKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQIGIQLITRDECLENNAEKLITDYRINK--REYS-----STINIQLKTIRPE---------DISDRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGN---KVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPL-FEKFSKFPPHTHIRFIIWHRSLNDRS-KNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYK----MDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNLPDSENQLDKFIQDTM---HFDVHKQIFRELIN------------NKPESDSNILRATDWFIKIAVKSFQNYEREMLGNIDE 2199
            E + + + + N++      + L  GD + I E   GWYRGF    P +  +FP S+I +                  + +  E+   +  W T  +  Y+  +   F ++   +   L + ++    ++   ++ +  ++ +  ++D   + LGL    R +    +D + +S+ +LY    R  E   R  +         SL+   L +    S    E L++  ++Y  + R++  ISE +  R+  +       +        +  G S   + +++V H  R G M   +K       Y+RP G +VI V +++T +   +  + I       C   +    I D  I K    YS     + +N+ L+ +  +          +  RNV +   LG  D   P   RN    LY+ L   E +K  K    N EV + +    G     +V       G DE+ S + YH+  P+W E I +P+  E F      TH+RF + H S  ++  K   G +++ L  DD   +      D  H L ++K     D++ + R   L            +S  +  P   + + NS       K++ ++Q+ +CST+ T +  + ++    +    I+  L      +K+ID  E+ KF    L+ +LD +    D+S   +  L++   +   I  L DS+ QL K + D     HF      +R+LI                E    +L+A+++  K  V+S + Y     G  +E
Sbjct:    6 EHEKYGVVLANFRGMVQHGLPLEIGDTVQILEKCEGWYRGFITKNPNVKGIFPSSYIHLKNAHVKNKGQFETVIPTEDSVITEITMTLRDWGTMWKQLYMRNEGDLFHRLWHVMNEILELRQQVLVGHLTHDRLSDI-KQHITARLDWGNEQLGLDLVPRRD-FSMVDPDDISITELY----RLMERRHRRREAPPQ----ASLHHLFLQMKSMMSSSLGEELEVFFSVY--DSREMRPISERFFVRLNKQGLPKSPEKTERQCTLFVDLGSSDLRKDVYVVAHIFRIGRMVAGEKKNVSNTQYKRPYGCAVISVADLLTADFKDDHLLKIY-----SCNAESEWYQIHDSIIRKVSSRYSHIGSNTGLNVSLQLLHGDMEQIRKDYMRLFTRNVSITKRLGFSDIIIPGEMRND---LYVTLERGEFEKGGKSVARNVEVTVYLLGADGQLLKGLVCCGSGEPGVDEHHSFVLYHSNSPRWAEQIKLPIPLEMFRG----THLRFELRHCSTKEKGEKKLFGFSFVPLMQDDGRPL-----PDGTHELIVHKCEETADLQDLARYLKLP-----------FSKASLQPGNNQTIKNS-------KESFWIQSSLCSTKLTQNGDMLDLLKWRVHPDRIIDCLSK----LKDIDGTEIVKF----LQDTLDTLFGILDESP-QRYGLKVFDCLVHVINLLQDSKFQLFKPVMDNYIENHF-AGALSYRDLIRVLKWYVDRIIDAEHQEQIQQVLKASEYLFKYIVQSRRLYAAATGGQNEE 729          

HSP 2 Score: 73.559 bits (179), Expect = 2.794e-12
Identity = 125/577 (21.66%), Postives = 228/577 (39.51%), Query Frame = 1
Query: 3280 QPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKT--------ELITQIDQAMESA----------------YSNYCEEMTKAFKQVL--SSNTKYAFDSQLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFY-NEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYTTVERKYPEPED-FASADKKIFYM----PVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRYV--SPVSGGVTKLVEMIPNND--DNFSYTSEVVNQVLSLIYQYLQAFE 4881
            QP L LE  P S   +++E      GD+R+    +I ++WQ L   K          F ++T +    +R + +    D+  +D E +++        +LI ++D  M                   +  Y   + K  ++    S  +  A  ++L+E ++    +  +C      +    G  V  NL  FY  E+ + ++  RY+ KL  +H K +NY+E   TLL      +W+   +   FL    +    E+Q K  L    +  F++   WE  I +C+EL   Y  Y+ D+  LS +    +    KIM + R E   + + + GK FP F+ +   K  V R      +      + S+F +    +   +P+     AD +   +    PV  ++ +   + +G  V   I  +Y    I  F Y R  +   +D         ++   +   + LP I     V+  E + + P + A   IE +  +   L      A  + RQ L+     + L  V  + V+GG+ +  E     D   N     E + ++  L+++     E
Sbjct: 1016 QPCLQLEMFPPSKRKKVLEKY----GDMRVMIGCEIFSMWQHLGDYKLNLIPTLIGPFMEVTLVPQMDLRNVLIPIFHDM--MDCEQRRSGNFKQVEAKLIDKLDGLMSEGKGDETYRELFNNIIPLFGPYPSLLKKIERETWRESGVSHIATVTRLMERLL----DYRDCMKIGEVDGKTMGCTV--NLLNFYKTELNKEEMYIRYIHKLYELHLKAQNYTEASYTLLLYDELLEWTERPL-REFLSYPMQS---EWQRKECLHLTIIHNFDRGKCWENCIILCRELANQYEAYY-DYRNLSKMRMMEASFYDKIMNQQRLEPEFFRVGFYGKKFPFFLRN---KEFVCRGNDYERLEAFQQRMLSEFPHAIAMQHANQPDQTIHQADAQYLQIYAVSPVPENQDVL--QRDG--VPNNIKSFYKVNHIWRFRYDRPFHKGTKDKENEFKSLWVERTTLTLAQSLPGISRWFEVEKRELVEMSPLENASEVIENKTLQLRTL-----IAQCQMRQMLNINPLTMCLNGVIDAAVNGGLARYQEAFFAKDYIANHPEDGEKITRLRELMFEQAHILE 1563          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Zebrafish
Match: dock4b (dedicator of cytokinesis 4b [Source:ZFIN;Acc:ZDB-GENE-060130-74])

HSP 1 Score: 98.5969 bits (244), Expect = 7.931e-20
Identity = 165/760 (21.71%), Postives = 308/760 (40.53%), Query Frame = 1
Query:   52 EGDCFAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPM-------SHIK--------ILSND-IYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERR--YDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKLSDSTIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGC----DLIRANAIIMKDIQYGKSQK-IFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQIGIQLITRD----ECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDISDRNVMVL---GL---------DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGN---KVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPLFEKFSKFPPHTHIRFIIWHRSLNDRS-KNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNLPDSENQLDKFIQDTM---HFDVHKQIFRELIN------------NKPESDSNILRATDWFIKIAVKS 2157
            E + + + +  ++      + L  GD + I E   GWYRGF    P    +FP        +HIK        + S D +  E+ + +  W    +  ++  +   F+++   +   +  RR     ++   +M +  ++ +  ++D   + LGL    R E    +D + +SV +LY    R  E   R  K + + +    L++ L ++    S L +E   + +  +  + R+   +SE +   V +   G     +       +  D+     +K +++V H IR G M   +K     V YRRP G +V+ + +++T +   +  + +     +    +  +N  +K+ + Y ++       + +QL     E +  R  MVL   G+         D   P   RN    LY+ L   E +K  K    N E+ I   D  G      V       G DEY + + YHN  P+W E I +P+     +    +H+RF   H S  D+  K   G +++ L  +D   +      D  H L ++K +    + A    C           S   + P     +  + +     K++L++ + +CST+ T +  + ++       + I   L      +K ID +E+ KF    L+ +LD +    D+S   +  L++   +   I  L DS+ Q  K + DT    HF      +R+LI             ++ E    +L+AT++  K  V+S
Sbjct:    8 EHEKYGVVLAGFRGTVQHGLPLEIGDTVQILEKCEGWYRGFVLKNPNAKGIFPCCYIHLKNAHIKNKGQFETVVPSEDSVITEMTSTLRDWGAMWKQLFVKNEGDLFNRLWHVMNEILDLRRQVLVGHLTHDRMRDV-KQHITARLDWGNEQLGLDLVPRRE-FSMVDPDDISVTELY----RLMEHRHR-KKETPAPVSTHHLFVHLKSLM--SSNLGEE---LEVFFFIYDSRENRPLSERFF--VKLNKNGLPKFPEKTERQCTLFVDLGSSDLRKDVYIVVHIIRIGRMGAGEKKNLCNVQYRRPFGCAVVSIADLLTADSKDDHLLKVYACNTESDWSQIHDNIIKKVNSRYNLSGSNTGLAVALQLLHGDIEQLR-REYMVLFTRGVSITKKLGFSDVIMPGEMRND---LYMTLEKGEFEKGGKSVARNVEITIYALDADGQILKGFVAVGSGEPGGDEYHTFVLYHNNSPRWAEQIKLPIPVDMFR---GSHVRFEFRHCSTKDKGEKKLFGFSFVPLMQEDGRTL-----PDGTHELIVHKCE----ENANLQDC-----------SRYLKLPFSKSNLPGNNQTVKGTKESLWITSFLCSTKLTQNGDMLDLLKWRAHPERISDSLSK----LKEIDGSEIVKF----LQDTLDTLFGILDESS-QRYALKVFDCLVHIINLLQDSKFQHFKPVMDTYIESHF-AGALSYRDLIKVLKWYVDRIIDADRQEHIQQVLKATEYIFKYIVQS 716          

HSP 2 Score: 73.559 bits (179), Expect = 3.516e-12
Identity = 78/327 (23.85%), Postives = 139/327 (42.51%), Query Frame = 1
Query: 3280 QPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKT--------ELITQIDQAMESAYSN--YCEEMTKAFKQVLSSNTKYAFDSQLVENIIVQMNNIEECSHHLN----DNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFI 4215
            Q  L LE   +S   +++E      GD+R+    +I ++WQ+L   K  F       F ++T +    +R + +    D+  +D E +++        +LI ++D  M     +  Y E       + +   T       L+  +   M  + +    +     D   I   + + N  K   E+ + ++  RY+ KL  +H K +NY+E   TLL      +WS   +   FL    +    E+Q K  L    ++ F++   WE GI +C+EL   Y  Y+ D+  LS +    +    KIM + R E   + + + GK FP F+
Sbjct: 1018 QTCLQLETFSASKKKKILEKY----GDMRVMMGCEIFSMWQNLGEHKLNFIPAMIGPFLEVTLVPQPDLRNVMIPIFHDM--MDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSILLKKIERETWRESGISLIATVTRLMERLLDYRDCMKLGEVDGKKIGCTVSLLNFYK--TELNKEEMYIRYIHKLYDLHLKAQNYTEASYTLLLYDELLEWSERPL-REFLSYPMQS---EWQRKEYLHLTIIQNFDRGKCWENGILLCRELADQYESYY-DYRNLSKMRMMEASFYDKIMDQQRLEPEFFRVGFYGKKFPFFL 1331          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Zebrafish
Match: dock4b (dedicator of cytokinesis 4b [Source:ZFIN;Acc:ZDB-GENE-060130-74])

HSP 1 Score: 98.5969 bits (244), Expect = 7.961e-20
Identity = 165/760 (21.71%), Postives = 308/760 (40.53%), Query Frame = 1
Query:   52 EGDCFAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPM-------SHIK--------ILSND-IYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERR--YDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKLSDSTIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGC----DLIRANAIIMKDIQYGKSQK-IFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQIGIQLITRD----ECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDISDRNVMVL---GL---------DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGN---KVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPLFEKFSKFPPHTHIRFIIWHRSLNDRS-KNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNLPDSENQLDKFIQDTM---HFDVHKQIFRELIN------------NKPESDSNILRATDWFIKIAVKS 2157
            E + + + +  ++      + L  GD + I E   GWYRGF    P    +FP        +HIK        + S D +  E+ + +  W    +  ++  +   F+++   +   +  RR     ++   +M +  ++ +  ++D   + LGL    R E    +D + +SV +LY    R  E   R  K + + +    L++ L ++    S L +E   + +  +  + R+   +SE +   V +   G     +       +  D+     +K +++V H IR G M   +K     V YRRP G +V+ + +++T +   +  + +     +    +  +N  +K+ + Y ++       + +QL     E +  R  MVL   G+         D   P   RN    LY+ L   E +K  K    N E+ I   D  G      V       G DEY + + YHN  P+W E I +P+     +    +H+RF   H S  D+  K   G +++ L  +D   +      D  H L ++K +    + A    C           S   + P     +  + +     K++L++ + +CST+ T +  + ++       + I   L      +K ID +E+ KF    L+ +LD +    D+S   +  L++   +   I  L DS+ Q  K + DT    HF      +R+LI             ++ E    +L+AT++  K  V+S
Sbjct:    8 EHEKYGVVLAGFRGTVQHGLPLEIGDTVQILEKCEGWYRGFVLKNPNAKGIFPCCYIHLKNAHIKNKGQFETVVPSEDSVITEMTSTLRDWGAMWKQLFVKNEGDLFNRLWHVMNEILDLRRQVLVGHLTHDRMRDV-KQHITARLDWGNEQLGLDLVPRRE-FSMVDPDDISVTELY----RLMEHRHR-KKETPAPVSTHHLFVHLKSLM--SSNLGEE---LEVFFFIYDSRENRPLSERFF--VKLNKNGLPKFPEKTERQCTLFVDLGSSDLRKDVYIVVHIIRIGRMGAGEKKNLCNVQYRRPFGCAVVSIADLLTADSKDDHLLKVYACNTESDWSQIHDNIIKKVNSRYNLSGSNTGLAVALQLLHGDIEQLR-REYMVLFTRGVSITKKLGFSDVIMPGEMRND---LYMTLEKGEFEKGGKSVARNVEITIYALDADGQILKGFVAVGSGEPGGDEYHTFVLYHNNSPRWAEQIKLPIPVDMFR---GSHVRFEFRHCSTKDKGEKKLFGFSFVPLMQEDGRTL-----PDGTHELIVHKCE----ENANLQDC-----------SRYLKLPFSKSNLPGNNQTVKGTKESLWITSFLCSTKLTQNGDMLDLLKWRAHPERISDSLSK----LKEIDGSEIVKF----LQDTLDTLFGILDESS-QRYALKVFDCLVHIINLLQDSKFQHFKPVMDTYIESHF-AGALSYRDLIKVLKWYVDRIIDADRQEHIQQVLKATEYIFKYIVQS 716          

HSP 2 Score: 73.559 bits (179), Expect = 3.222e-12
Identity = 78/327 (23.85%), Postives = 139/327 (42.51%), Query Frame = 1
Query: 3280 QPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKT--------ELITQIDQAMESAYSN--YCEEMTKAFKQVLSSNTKYAFDSQLVENIIVQMNNIEECSHHLN----DNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFI 4215
            Q  L LE   +S   +++E      GD+R+    +I ++WQ+L   K  F       F ++T +    +R + +    D+  +D E +++        +LI ++D  M     +  Y E       + +   T       L+  +   M  + +    +     D   I   + + N  K   E+ + ++  RY+ KL  +H K +NY+E   TLL      +WS   +   FL    +    E+Q K  L    ++ F++   WE GI +C+EL   Y  Y+ D+  LS +    +    KIM + R E   + + + GK FP F+
Sbjct: 1018 QTCLQLETFSASKKKKILEKY----GDMRVMMGCEIFSMWQNLGEHKLNFIPAMIGPFLEVTLVPQPDLRNVMIPIFHDM--MDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSILLKKIERETWRESGISLIATVTRLMERLLDYRDCMKLGEVDGKKIGCTVSLLNFYK--TELNKEEMYIRYIHKLYDLHLKAQNYTEASYTLLLYDELLEWSERPL-REFLSYPMQS---EWQRKEYLHLTIIQNFDRGKCWENGILLCRELADQYESYY-DYRNLSKMRMMEASFYDKIMDQQRLEPEFFRVGFYGKKFPFFL 1331          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Xenopus
Match: afg3l1p (AFG3-like AAA ATPase 1, pseudogene [Source:Xenbase;Acc:XB-GENE-1014910])

HSP 1 Score: 271.552 bits (693), Expect = 1.854e-72
Identity = 408/1773 (23.01%), Postives = 716/1773 (40.38%), Query Frame = 1
Query:   64 FAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMS--HIKILSND-------------IYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERR--YDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRV--------SKLS-----DSTIDYV----SLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAI--IMKDIQYGK--SQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVM-------------------TENLDSEKQI------GIQLITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDIS----------DRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQG---NKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEV--ICIPLFEKFSKFPPHTHIRFIIWHRSLN---DRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHP--EYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTMHFDVHKQIFRELINN-----KPESDSNILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGL-----IINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNCMN----SKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQ-DQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKT--------ELITQIDQAMESAYSNYCEEMTKAFKQVLSSNT---KYAFDSQLVENIIVQ--MNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYT-TVERKYPEPEDFASADKK-IFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRYVSP-VSGGVT---------KLVEMIPNNDDNFSYTSEVVNQVLSLIYQYLQ--AFEIYDTLDN-YMIFVSAFQNLCSSVSR 4953
            F +AIYN++  + + + L+ GD + I E Y GWYRGF         +FP +  H+K ++ D             +  EL A +  W       ++      F +I E + L +  R       + K  + E  R+ +  K+D   + LGL    R+E G  +D +  S+I LY  H+    +SRR+        S+L       S I ++    SLY+ L N      + A+ ++    +LY  +D +   ISE +  R        D+ + N +  +  D+        +I LV   +R G M L K   K     RRP GV+V+++++V+                    ENL S++Q+        + I  +E L     K+I    +N +     I+++L    P D++          DR+  V   +G  +   P    + RN +Y+ L   E DK +KK+  N EV +S+ D  G    K + P     G  EY SV+YY   +P W E   + IP+ E  S    H H+RF   HRS     D+S+   G+ +++L   D   +      D  H L IYK D +K   A+     P  + E D +  S +    + T             KD+  + T++CST+ T +  L  + N     + +   L      +  +D  E+ KF    L++  +++ +  D       + + L  +   I ++      P  E  + K    T+ ++   ++    + +     + E   + L+A  +  +  V+S   Y R   G  +    FN   DS   +   L    D+P+ +++ ++ A L     IIN L  V  P+ ++ L    ++S   + A+     T+ CM+    S LF+  +CR  + P     +++  + QL+  Y + + +    LL NI    IE +Q  E            +L  +LI+E  + R    ++      +SR   +       +   V+ +   L  + D  +++ +            R   D  D +ME F L  +L    V+P                                    + WM M   Q++ FL  + +   ++ K +    L ++   +Q    F H                  S +T   L L +       +++       GD+R    ++I+++W +L   K +F  +      ++T      +R   +   FD++  +     +        ELIT++DQ +E    +   +     +++L  N    KY   S  V  ++V   + N+ +     ND S  N M    NL  FY E  R DI  RYL+KL  +H + +NY+E    LL  +   QWS +      L  +      + ++K +L  E + +F+K   WE+ I   KEL+  Y      +  LS + +K +   + IM   R +S  + + Y G+GFP F+ +   K  + R K    + + ++ L +QF     +    P  ++  ++ K+ +    VKP     P++Y+ K+V ++IL YY   E++ F Y R     E+DP        I+        KLP IL    VK  +   I P + A+  +E    K   L Q +    S     L   +  I    V P V GG +         + ++  P + D      +++   + L+ Q ++    ++ D L   +   VS F++L S V +
Sbjct:   12 FGVAIYNFQVTHEEELSLQVGDTVQILETYEGWYRGFTLRNKSKKGIFPSTYVHVKEVTEDKGLHDQAVPSELPLVQELTATLREWGNLWHSLFVHNSRLQFSQIQEMMFLLMEWRSQILSGTLPKDDLAEL-RKKVTAKIDYGNRILGLDLVVRDENGNILDPDETSIITLYRSHE---SASRRIDERIQEEKSQLQPLDSRSSAILHMAHTYSLYVNLKNFVCNMGEDAELLM----SLYDPDDSRF--ISENFLVRWGSSGMPKDIEKLNNLPAVFTDLSCSDLIRPRISLVCQIVRVGHMEL-KDGKKHTCGLRRPFGVAVMDISDVIHGKVDDEEKQHFIPFQQMNKENLISQRQLIMSPLMASRAIAENEPLTAIYNKVIAAKEVNHKGQGLWISLKL---LPGDLAQVQKEYSHLVDRSSAVARKMGFPEIILPG---DVRNDIYITLIQGEFDKGKKKTPKNVEVTLSVHDPDGALIEKAIHPGAGHEGLTEYKSVVYYQVKQPCWYETVKVSIPI-EDVS----HCHLRFTFRHRSSQESRDKSEKVFGMGFVRLMNPDGTTL-----RDRIHDLIIYKGDSKKSDDAKLYLLLPGTKEEEDEDGRSQRGHSASITPT-----------KDSFQIGTLICSTKLTQNVDLLGLLNWRSNSRPVSQALRK----LMEVDGGEIMKFLQDTLDALFNIMMETPDKESCDVLVFDALVFIISLIADIKFQHFNPVLETYITKHFSTTLAYERLIKVLSWYVRSADDPCRQEMLFSSLKAIKYLFRFIVQSRILYLR-FYGQGEGRDQFN---DSIRQLFLSLNELMDRPLDKAVKIKAAALKYLPGIINDLKTVFDPVELSVLFAKFVQS---VPADQLVHQTLTCMSKVVESDLFLQPECRDALQPL----LIDQLSGQLDDNYAKPDHEACGHLLSNI----IEVLQSKEVGE--------TSLHIQLIMERLLRRINRTVIG-----MSRQSPH-------IGCFVACMTALLRQMDDYHYDYYI---------STFRTRQDIIDFLMETFILFKDLIGKRVYP------------------------------------KDWMLMTMTQNKVFLRAMTRFAAVLNKLF----LDESSFELQLWNNFFH---------------LAVSFLTHESLQLHRFSEEKRKKILSKY----GDMRKEIGLKIRDMWYNLGPHKIKFIPSMVGPILEVTLTPETDLRKATIPIFFDMMQHEHNFSGSGHFHMFENELITRLDQEVEGGRGD--RQYKDLLERLLLENCRKHKYLSGSGEVFTLLVSSLLENLLDYRTIANDESEENRMSCTVNLLNFYKEKKREDIYIRYLYKLRDLHLRKENYTEAAYALLLHAELLQWSEKPCAPHLLQRDSYTVYTQQELKERLYHEIISFFDKGKMWEQAIIHSKELLDMYENQIFHYEALSVLLNKQAGFYQNIMRSLRLQSEYFAVGYYGQGFPSFLRN---KIFIYRGKEYERLEDFNLWLLNQFPNGEKLSSSSPPGDEIRNSTKQYVQCFSVKP-LMNLPSRYKEKLVPEQILGYYRYNEVQRFSYSRPFRRGEKDPDNEFATMWIERTTFTTAYKLPGILKWFEVKHFDTEEISPLQNAIETMELTNEKISHLVQQHRADQSLPLHPLSMLLSGI----VDPAVMGGFSNYEKAFFTERYLQEHPMDQDKLELLKQLIALQMPLLAQGIRIHGEKLTDNLRPLHERLVSCFKDLRSKVEK 1629          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Xenopus
Match: DOCK1 (dedicator of cytokinesis 1 [Source:NCBI gene;Acc:100497783])

HSP 1 Score: 242.662 bits (618), Expect = 1.385e-63
Identity = 373/1637 (22.79%), Postives = 679/1637 (41.48%), Query Frame = 1
Query:   28 IMKWLNYEEGDCFAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMS--HIKILSND-------IYP-------ELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERRYD--SNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQH-----------QREYESSRRVSKLSD-STIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAI--IMKDIQYG--KSQKIFLVFHFIRKGPMCLTKKTIKE-GVPYRRPKGVSVIEVTNVMTENLDSEKQ---IGIQLITRD-ECLENNAEKLITDYRINKREYSSTINIQL-----KTIRPE--DISDRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNK---VVMPSFDWRGFDEYSSVIYYHNAKPKWCEV--ICIPLFEKFSKFPPHTHIRFIIWHRSLN---DRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFD----KLLANICNQSLEDQTI--LHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTMHFDVHKQIFRELIN--NKPESDSNI---LRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKP-ILRSLVLRKAGLIINALIPVCQPIGMARLVNN-LLKSCSDLDANMKSELTMNCMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSC-VAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKT------ELITQIDQAMESAYSNYCEEMTKAFKQVLSSNT-KYAFDSQLVEN----IIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYTTVERKYPEPEDFA--SADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIE 4644
            + +W+  +  + + +AIYNY       + L+ GD + I E + GWYRG+   +     +FP S  H+K    D       I P       E+   +  W T  R  Y + D  D  K    +   + E R    S       ++  ++ +  ++D   + L L    R+E G  +D +  S + L+  H           Q E      +S+ +  +     +L++ L NV  +  + A+ ++    +LY   + K   ISE Y  R +      D+ + + +  +  D+     K  +I  V   +R G M L     K+  +  RRP GV+V++VT+++T  +D E +   I  Q +  + + L+    K+I    +N +     + ++L       IR E   + DR+  V   +G  +   P    + RN +Y+ L   + D+  K +  N EV +S+ D  G +   V+          EY SV+YY   +P+W E   + IP+ E  ++    +H+RF   HRS     D+++ P  VA++KL   D   +      D  H L +YK + +K +        P  + + E    +  H T  + M+N      + KD+  + T+VCST+ T +     LL    N +L  Q +  L K+  EE++          KF    L++  ++I + ++       + + L  +   I +       P  E  + K    T+ +    ++ +  +   +KP+    +   ++A ++  K  V+S   +  ++  N  EA     L   +  I E  ++  D+  I++   L+    IIN +  V  P  +++L    +L    +     K    +  ++S LF   +CR I+LP     +++   F L +  +E+     QLL NI  EM     L+ +    +   I        II  K+LR+    ++S G +    SE  G          V+ +   L  + D  +  +++       F + R  TD  D +ME F +   L    V+PS                                     W+ M  +Q++ FL  + Q  +++ K +    L Q                  + +L  +      + +TQ  L LE   S+   +++       GD+R     +I+++W +L   K +F         ++T I   ++R   +   FD++  +  + ++      E+IT++D  +E    +  E+    F+++L  +  K+ + ++  EN    ++  M  + +    ++D +  N M    N+  FY E+ R ++  RYL+KL  +H++  NY+E   TLL  +   +WS E         +      + Q+K +L +E + YF+K   WE+ I + KEL + Y     D+ +LS +  K ++  + I+   RP+ + + + Y G+GFP FI +   K  + R K      +    L +QF      +    P D    S  + I    VKP     P K++ K V ++I  +Y   E+  F Y R     E+DP        I+        KLP IL    VKSI  + I P + A+  ++
Sbjct:    1 MTRWVPTKREEKYGVAIYNYDAKGPDELCLQIGDTVHILETHEGWYRGYSLRKKSKKGIFPASFVHLKEAVIDGKGQHETIVPCEIPLVQEVTTTLREWSTIWRQLY-IQDNRDMFKCVRNMIYDLVEWRSQILSGTLPQDELKELKKKITARIDYGNRILDLDLVVRDEDGNILDPDQTSTLSLFRAHEIASKQVEERIQEEKSQKNDISRQAKFAATPSFALFVNLKNVVCKIGEDAEVLM----SLYDASESKF--ISENYLVRWSSSGLPKDIDKLHYLRSVFTDLGSKDVKRDRISFVCQIVRVGRMDLRDNNTKKLTLGLRRPFGVAVMDVTDIITGKVDDEDKQYFIPFQPVAGESDFLQAVINKVIVAKEVNHKGQGLWVTMKLLPGDIHQIRKEFPHLVDRSTAVARKMGFPEIIMPG---DVRNDIYVTLIQGDFDRGNKTAQKNVEVSLSVFDEDGKRLENVIYLGAGDEPISEYKSVVYYQVKQPRWFETVKVAIPI-EDVNR----SHLRFSFRHRSSQDSKDKTEKPFAVAFVKLMRYDGTTL-----RDGEHDLIVYKAEAKKQEDVATYLGLPSTKIELE----ERGHYTSGKTMVN-LGNWTISKDSFQISTLVCSTKLTQNVDLLGLLKWRSNTNLLQQNLRQLMKVDGEEVV----------KFLQDTLDALFNIIMENSESETYDILVFDALVFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTKLTKVLKNYVESADKPQVMDQLFKAMKALEYIFKFIVRSRVLFN-QLYENKGEAEFTESLIQLFKSINEMTSTITDQTVIVKGAALKYLPAIINDVKLVFDPKELSKLFTEFILNIPKERLVRQKLYCLIEIVHSDLFSQLECRDILLP----MMIDQLKFHLER--HEEPEACCQLLSNIL-EM-----LYRKDVGPTQRHI-------QIIMEKLLRTVNRTVISMGRD----SELIGN--------FVASMTGILRQMEDYHYGHLIKT------FGKMR--TDVVDFLMETFIMFKNLIGKNVYPS------------------------------------DWVIMNMMQNKVFLRAINQYADMLNKKF----LDQ---------------ANFELQLWNNYFHLAVAFLTQESLQLENFSSAKRNKILNKY----GDMRRQIGFEIRDMWYNLGQHKIKFIPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHSTRSFQMFENEIITKLDHEVEGGRGD--EQYKVLFEKILLEHCRKHKYLAKNGENFVTLVVRLMERLLDYRTIMHDENKENRMSCTVNVLNFYKEIEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEEACAAHLTQRDGYQATTQGQLKDQLYQEIIHYFDKGKMWEEAITLGKELAEQYENEMFDYEQLSELLKKQAQFFENIVKVIRPKPDYFAVGYYGQGFPTFIRN---KMFMYRGKEYERREDFEARLLTQFPNAEKMKTSSPPGDDIKNSVGQYIQCFTVKP-LLELPPKFQNKSVSEQIQSFYRVNEVIRFQYSRPFRKGEKDPDNEFANMWIERTTFSIAYKLPGILRWFEVKSIYTVEISPLENAIETMQ 1497          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Xenopus
Match: afg3l1p (AFG3-like AAA ATPase 1, pseudogene [Source:Xenbase;Acc:XB-GENE-1014910])

HSP 1 Score: 238.424 bits (607), Expect = 2.806e-62
Identity = 400/1760 (22.73%), Postives = 706/1760 (40.11%), Query Frame = 1
Query:  115 LRSGDYLFIREHYPGWYRGFKYTQPCILK----VFPMS--HIKILSND-------------IYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERR--YDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRV--------SKLS-----DSTIDYV----SLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAI--IMKDIQYGK--SQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVM-------------------TENLDSEKQI------GIQLITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDIS----------DRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQG---NKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEV--ICIPLFEKFSKFPPHTHIRFIIWHRSLN---DRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHP--EYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTMHFDVHKQIFRELINN-----KPESDSNILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGL-----IINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNCMN----SKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQ-DQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKT--------ELITQIDQAMESAYSNYCEEMTKAFKQVLSSNT---KYAFDSQLVENIIVQ--MNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYT-TVERKYPEPEDFASADKK-IFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRYVSP-VSGGVT---------KLVEMIPNNDDNFSYTSEVVNQVLSLIYQYLQ--AFEIYDTLDN-YMIFVSAFQNLCSSVSR 4953
            L+ GD + I E Y G +        C+ K    +FP +  H+K ++ D             +  EL A +  W       ++      F +I E + L +  R       + K  + E  R+ +  K+D   + LGL    R+E G  +D +  S+I LY  H+    +SRR+        S+L       S I ++    SLY+ L N      + A+ ++    +LY  +D +   ISE +  R        D+ + N +  +  D+        +I LV   +R G M L K   K     RRP GV+V+++++V+                    ENL S++Q+        + I  +E L     K+I    +N +     I+++L    P D++          DR+  V   +G  +   P    + RN +Y+ L   E DK +KK+  N EV +S+ D  G    K + P     G  EY SV+YY   +P W E   + IP+ E  S    H H+RF   HRS     D+S+   G+ +++L   D   +      D  H L IYK D +K   A+     P  + E D +  S +    + T             KD+  + T++CST+ T +  L  + N     + +   L      +  +D  E+ KF    L++  +++ +  D       + + L  +   I ++      P  E  + K    T+ ++   ++    + +     + E   + L+A  +  +  V+S   Y R   G  +    FN   DS   +   L    D+P+ +++ ++ A L     IIN L  V  P+ ++ L    ++S   + A+     T+ CM+    S LF+  +CR  + P     +++  + QL+  Y + + +    LL NI    IE +Q  E            +L  +LI+E  + R    ++      +SR   +       +   V+ +   L  + D  +++ +            R   D  D +ME F L  +L    V+P                                    + WM M   Q++ FL  + +   ++ K +    L ++   +Q    F H                  S +T   L L +       +++    ++G D+R    ++I+++W +L   K +F  +      ++T      +R   +   FD++  +     +        ELIT++DQ +E    +   +     +++L  N    KY   S  V  ++V   + N+ +     ND S  N M    NL  FY E  R DI  RYL+KL  +H + +NY+E    LL  +   QWS +      L  +      + ++K +L  E + +F+K   WE+ I   KEL+  Y      +  LS + +K +   + IM   R +S  + + Y G+GFP F+ +   K  + R K    + + ++ L +QF     +    P  ++  ++ K+ +    VKP     P++Y+ K+V ++IL YY   E++ F Y R     E+DP        I+        KLP IL    VK  +   I P + A+  +E    K   L Q +    S     L   +  I    V P V GG +         + ++  P + D      +++   + L+ Q ++    ++ D L   +   VS F++L S V +
Sbjct:    5 LQVGDTVQILETYEGTWITETLHLNCMGKMGVGIFPSTYVHVKEVTEDKGLHDQAVPSELPLVQELTATLREWGNLWHSLFVHNSRLQFSQIQEMMFLLMEWRSQILSGTLPKDDLAEL-RKKVTAKIDYGNRILGLDLVVRDENGNILDPDETSIITLYRSHE---SASRRIDERIQEEKSQLQPLDSRSSAILHMAHTYSLYVNLKNFVCNMGEDAELLM----SLYDPDDSRF--ISENFLVRWGSSGMPKDIEKLNNLPAVFTDLSCSDLIRPRISLVCQIVRVGHMEL-KDGKKHTCGLRRPFGVAVMDISDVIHGKVDDEEKQHFIPFQQMNKENLISQRQLIMSPLMASRAIAENEPLTAIYNKVIAAKEVNHKGQGLWISLKL---LPGDLAQVQKEYSHLVDRSSAVARKMGFPEIILPG---DVRNDIYITLIQGEFDKGKKKTPKNVEVTLSVHDPDGALIEKAIHPGAGHEGLTEYKSVVYYQVKQPCWYETVKVSIPI-EDVS----HCHLRFTFRHRSSQESRDKSEKVFGMGFVRLMNPDGTTL-----RDRIHDLIIYKGDSKKSDDAKLYLLLPGTKEEEDEDGRSQRGHSASITPT-----------KDSFQIGTLICSTKLTQNVDLLGLLNWRSNSRPVSQALRK----LMEVDGGEIMKFLQDTLDALFNIMMETPDKESCDVLVFDALVFIISLIADIKFQHFNPVLETYITKHFSTTLAYERLIKVLSWYVRSADDPCRQEMLFSSLKAIKYLFRFIVQSRILYLR-FYGQGEGRDQFN---DSIRQLFLSLNELMDRPLDKAVKIKAAALKYLPGIINDLKTVFDPVELSVLFAKFVQS---VPADQLVHQTLTCMSKVVESDLFLQPECRDALQPL----LIDQLSGQLDDNYAKPDHEACGHLLSNI----IEVLQSKEVGE--------TSLHIQLIMERLLRRINRTVIG-----MSRQSPH-------IGCFVACMTALLRQMDDYHYDYYI---------STFRTRQDIIDFLMETFILFKDLIGKRVYP------------------------------------KDWMLMTMTQNKVFLRAMTRFAAVLNKLF----LDESSFELQLWNNFFH---------------LAVSFLTHESLQLHRFSEEKRKKILS---KYG-DMRKEIGLKIRDMWYNLGPHKIKFIPSMVGPILEVTLTPETDLRKATIPIFFDMMQHEHNFSGSGHFHMFENELITRLDQEVEGGRGD--RQYKDLLERLLLENCRKHKYLSGSGEVFTLLVSSLLENLLDYRTIANDESEENRMSCTVNLLNFYKEKKREDIYIRYLYKLRDLHLRKENYTEAAYALLLHAELLQWSEKPCAPHLLQRDSYTVYTQQELKERLYHEIISFFDKGKMWEQAIIHSKELLDMYENQIFHYEALSVLLNKQAGFYQNIMRSLRLQSEYFAVGYYGQGFPSFLRN---KIFIYRGKEYERLEDFNLWLLNQFPNGEKLSSSSPPGDEIRNSTKQYVQCFSVKP-LMNLPSRYKEKLVPEQILGYYRYNEVQRFSYSRPFRRGEKDPDNEFATMWIERTTFTTAYKLPGILKWFEVKHFDTEEISPLQNAIETMELTNEKISHLVQQHRADQSLPLHPLSMLLSGI----VDPAVMGGFSNYEKAFFTERYLQEHPMDQDKLELLKQLIALQMPLLAQGIRIHGEKLTDNLRPLHERLVSCFKDLRSKVEK 1609          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Xenopus
Match: afg3l1p (AFG3-like AAA ATPase 1, pseudogene [Source:Xenbase;Acc:XB-GENE-1014910])

HSP 1 Score: 235.728 bits (600), Expect = 1.752e-61
Identity = 375/1640 (22.87%), Postives = 661/1640 (40.30%), Query Frame = 1
Query:  412 RRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRV--------SKLS-----DSTIDYV----SLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAI--IMKDIQYGK--SQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVM-------------------TENLDSEKQI------GIQLITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDIS----------DRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQG---NKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVI--CIPLFEKFSKFPPHTHIRFIIWHRSLN---DRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHP--EYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTMHFDVHKQIFRELINN-----KPESDSNILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGL-----IINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNCMN----SKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQ-DQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKT--------ELITQIDQAMESAYSNYCEEMTKAFKQVLSSNT---KYAFDSQLVENIIVQ--MNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYT-TVERKYPEPEDFASADKK-IFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRYVSP-VSGGVT---------KLVEMIPNNDDNFSYTSEVVNQVLSLIYQYLQ--AFEIYDTLDN-YMIFVSAFQNLCSSVSR 4953
            R+ +  K+D   + LGL    R+E G  +D +  S+I LY  H+    +SRR+        S+L       S I ++    SLY+ L N      + A+ ++    +LY  +D +   ISE +  R        D+ + N +  +  D+        +I LV   +R G M L K   K     RRP GV+V+++++V+                    ENL S++Q+        + I  +E L     K+I    +N +     I+++L    P D++          DR+  V   +G  +   P    + RN +Y+ L   E DK +KK+  N EV +S+ D  G    K + P     G  EY SV+YY   +P W E +   IP+ E  S    H H+RF   HRS     D+S+   G+ +++L   D   +      D  H L IYK D +K   A+     P  + E D +  S +    + T             KD+  + T++CST+ T +  L  + N     + +   L      +  +D  E+ KF    L++  +++ +  D       + + L  +   I ++      P  E  + K    T+ ++   ++    + +     + E   + L+A  +  +  V+S   Y R   G  +    FN   DS   +   L    D+P+ +++ ++ A L     IIN L  V  P+ ++ L    ++S   + A+     T+ CM+    S LF+  +CR  + P     +++  + QL+  Y + + +    LL NI    IE +Q  E            +L  +LI+E  + R    ++      +SR   +       +   V+ +   L  + D  +++ +            R   D  D +ME F L  +L    V+P                                    + WM M   Q++ FL  + +   ++ K +    L ++   +Q    F H                  S +T   L L +       +++       GD+R    ++I+++W +L   K +F  +      ++T      +R   +   FD++  +     +        ELIT++DQ +E    +   +     +++L  N    KY   S  V  ++V   + N+ +     ND S  N M    NL  FY E  R DI  RYL+KL  +H + +NY+E    LL  +   QWS +      L  +      + ++K +L  E + +F+K   WE+ I   KEL+  Y      +  LS + +K +   + IM   R +S  + + Y G+GFP F+ +   K  + R K    + + ++ L +QF     +    P  ++  ++ K+ +    VKP     P++Y+ K+V ++IL YY   E++ F Y R     E+DP        I+        KLP IL    VK  +   I P + A+  +E    K   L Q +    S     L   +  I    V P V GG +         + ++  P + D      +++   + L+ Q ++    ++ D L   +   VS F++L S V +
Sbjct:  102 RKKVTAKIDYGNRILGLDLVVRDENGNILDPDETSIITLYRSHE---SASRRIDERIQEEKSQLQPLDSRSSAILHMAHTYSLYVNLKNFVCNMGEDAELLM----SLYDPDDSRF--ISENFLVRWGSSGMPKDIEKLNNLPAVFTDLSCSDLIRPRISLVCQIVRVGHMEL-KDGKKHTCGLRRPFGVAVMDISDVIHGKVDDEEKQHFIPFQQMNKENLISQRQLIMSPLMASRAIAENEPLTAIYNKVIAAKEVNHKGQGLWISLKL---LPGDLAQVQKEYSHLVDRSSAVARKMGFPEIILPG---DVRNDIYITLIQGEFDKGKKKTPKNVEVTLSVHDPDGALIEKAIHPGAGHEGLTEYKSVVYYQVKQPCWYETVKVSIPI-EDVS----HCHLRFTFRHRSSQESRDKSEKVFGMGFVRLMNPDGTTL-----RDRIHDLIIYKGDSKKSDDAKLYLLLPGTKEEEDEDGRSQRGHSASITPT-----------KDSFQIGTLICSTKLTQNVDLLGLLNWRSNSRPVSQALRK----LMEVDGGEIMKFLQDTLDALFNIMMETPDKESCDVLVFDALVFIISLIADIKFQHFNPVLETYITKHFSTTLAYERLIKVLSWYVRSADDPCRQEMLFSSLKAIKYLFRFIVQSRILYLR-FYGQGEGRDQFN---DSIRQLFLSLNELMDRPLDKAVKIKAAALKYLPGIINDLKTVFDPVELSVLFAKFVQS---VPADQLVHQTLTCMSKVVESDLFLQPECRDALQPL----LIDQLSGQLDDNYAKPDHEACGHLLSNI----IEVLQSKEVGE--------TSLHIQLIMERLLRRINRTVIG-----MSRQSPH-------IGCFVACMTALLRQMDDYHYDYYI---------STFRTRQDIIDFLMETFILFKDLIGKRVYP------------------------------------KDWMLMTMTQNKVFLRAMTRFAAVLNKLF----LDESSFELQLWNNFFH---------------LAVSFLTHESLQLHRFSEEKRKKILSKY----GDMRKEIGLKIRDMWYNLGPHKIKFIPSMVGPILEVTLTPETDLRKATIPIFFDMMQHEHNFSGSGHFHMFENELITRLDQEVEGGRGD--RQYKDLLERLLLENCRKHKYLSGSGEVFTLLVSSLLENLLDYRTIANDESEENRMSCTVNLLNFYKEKKREDIYIRYLYKLRDLHLRKENYTEAAYALLLHAELLQWSEKPCAPHLLQRDSYTVYTQQELKERLYHEIISFFDKGKMWEQAIIHSKELLDMYENQIFHYEALSVLLNKQAGFYQNIMRSLRLQSEYFAVGYYGQGFPSFLRN---KIFIYRGKEYERLEDFNLWLLNQFPNGEKLSSSSPPGDEIRNSTKQYVQCFSVKP-LMNLPSRYKEKLVPEQILGYYRYNEVQRFSYSRPFRRGEKDPDNEFATMWIERTTFTTAYKLPGILKWFEVKHFDTEEISPLQNAIETMELTNEKISHLVQQHRADQSLPLHPLSMLLSGI----VDPAVMGGFSNYEKAFFTERYLQEHPMDQDKLELLKQLIALQMPLLAQGIRIHGEKLTDNLRPLHERLVSCFKDLRSKVEK 1587          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Xenopus
Match: afg3l1p (AFG3-like AAA ATPase 1, pseudogene [Source:Xenbase;Acc:XB-GENE-1014910])

HSP 1 Score: 235.343 bits (599), Expect = 2.060e-61
Identity = 375/1640 (22.87%), Postives = 661/1640 (40.30%), Query Frame = 1
Query:  412 RRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRV--------SKLS-----DSTIDYV----SLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAI--IMKDIQYGK--SQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVM-------------------TENLDSEKQI------GIQLITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDIS----------DRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQG---NKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVI--CIPLFEKFSKFPPHTHIRFIIWHRSLN---DRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHP--EYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTMHFDVHKQIFRELINN-----KPESDSNILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGL-----IINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNCMN----SKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQ-DQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKT--------ELITQIDQAMESAYSNYCEEMTKAFKQVLSSNT---KYAFDSQLVENIIVQ--MNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYT-TVERKYPEPEDFASADKK-IFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRYVSP-VSGGVT---------KLVEMIPNNDDNFSYTSEVVNQVLSLIYQYLQ--AFEIYDTLDN-YMIFVSAFQNLCSSVSR 4953
            R+ +  K+D   + LGL    R+E G  +D +  S+I LY  H+    +SRR+        S+L       S I ++    SLY+ L N      + A+ ++    +LY  +D +   ISE +  R        D+ + N +  +  D+        +I LV   +R G M L K   K     RRP GV+V+++++V+                    ENL S++Q+        + I  +E L     K+I    +N +     I+++L    P D++          DR+  V   +G  +   P    + RN +Y+ L   E DK +KK+  N EV +S+ D  G    K + P     G  EY SV+YY   +P W E +   IP+ E  S    H H+RF   HRS     D+S+   G+ +++L   D   +      D  H L IYK D +K   A+     P  + E D +  S +    + T             KD+  + T++CST+ T +  L  + N     + +   L      +  +D  E+ KF    L++  +++ +  D       + + L  +   I ++      P  E  + K    T+ ++   ++    + +     + E   + L+A  +  +  V+S   Y R   G  +    FN   DS   +   L    D+P+ +++ ++ A L     IIN L  V  P+ ++ L    ++S   + A+     T+ CM+    S LF+  +CR  + P     +++  + QL+  Y + + +    LL NI    IE +Q  E            +L  +LI+E  + R    ++      +SR   +       +   V+ +   L  + D  +++ +            R   D  D +ME F L  +L    V+P                                    + WM M   Q++ FL  + +   ++ K +    L ++   +Q    F H                  S +T   L L +       +++       GD+R    ++I+++W +L   K +F  +      ++T      +R   +   FD++  +     +        ELIT++DQ +E    +   +     +++L  N    KY   S  V  ++V   + N+ +     ND S  N M    NL  FY E  R DI  RYL+KL  +H + +NY+E    LL  +   QWS +      L  +      + ++K +L  E + +F+K   WE+ I   KEL+  Y      +  LS + +K +   + IM   R +S  + + Y G+GFP F+ +   K  + R K    + + ++ L +QF     +    P  ++  ++ K+ +    VKP     P++Y+ K+V ++IL YY   E++ F Y R     E+DP        I+        KLP IL    VK  +   I P + A+  +E    K   L Q +    S     L   +  I    V P V GG +         + ++  P + D      +++   + L+ Q ++    ++ D L   +   VS F++L S V +
Sbjct:  102 RKKVTAKIDYGNRILGLDLVVRDENGNILDPDETSIITLYRSHE---SASRRIDERIQEEKSQLQPLDSRSSAILHMAHTYSLYVNLKNFVCNMGEDAELLM----SLYDPDDSRF--ISENFLVRWGSSGMPKDIEKLNNLPAVFTDLSCSDLIRPRISLVCQIVRVGHMEL-KDGKKHTCGLRRPFGVAVMDISDVIHGKVDDEEKQHFIPFQQMNKENLISQRQLIMSPLMASRAIAENEPLTAIYNKVIAAKEVNHKGQGLWISLKL---LPGDLAQVQKEYSHLVDRSSAVARKMGFPEIILPG---DVRNDIYITLIQGEFDKGKKKTPKNVEVTLSVHDPDGALIEKAIHPGAGHEGLTEYKSVVYYQVKQPCWYETVKVSIPI-EDVS----HCHLRFTFRHRSSQESRDKSEKVFGMGFVRLMNPDGTTL-----RDRIHDLIIYKGDSKKSDDAKLYLLLPGTKEEEDEDGRSQRGHSASITPT-----------KDSFQIGTLICSTKLTQNVDLLGLLNWRSNSRPVSQALRK----LMEVDGGEIMKFLQDTLDALFNIMMETPDKESCDVLVFDALVFIISLIADIKFQHFNPVLETYITKHFSTTLAYERLIKVLSWYVRSADDPCRQEMLFSSLKAIKYLFRFIVQSRILYLR-FYGQGEGRDQFN---DSIRQLFLSLNELMDRPLDKAVKIKAAALKYLPGIINDLKTVFDPVELSVLFAKFVQS---VPADQLVHQTLTCMSKVVESDLFLQPECRDALQPL----LIDQLSGQLDDNYAKPDHEACGHLLSNI----IEVLQSKEVGE--------TSLHIQLIMERLLRRINRTVIG-----MSRQSPH-------IGCFVACMTALLRQMDDYHYDYYI---------STFRTRQDIIDFLMETFILFKDLIGKRVYP------------------------------------KDWMLMTMTQNKVFLRAMTRFAAVLNKLF----LDESSFELQLWNNFFH---------------LAVSFLTHESLQLHRFSEEKRKKILSKY----GDMRKEIGLKIRDMWYNLGPHKIKFIPSMVGPILEVTLTPETDLRKATIPIFFDMMQHEHNFSGSGHFHMFENELITRLDQEVEGGRGD--RQYKDLLERLLLENCRKHKYLSGSGEVFTLLVSSLLENLLDYRTIANDESEENRMSCTVNLLNFYKEKKREDIYIRYLYKLRDLHLRKENYTEAAYALLLHAELLQWSEKPCAPHLLQRDSYTVYTQQELKERLYHEIISFFDKGKMWEQAIIHSKELLDMYENQIFHYEALSVLLNKQAGFYQNIMRSLRLQSEYFAVGYYGQGFPSFLRN---KIFIYRGKEYERLEDFNLWLLNQFPNGEKLSSSSPPGDEIRNSTKQYVQCFSVKP-LMNLPSRYKEKLVPEQILGYYRYNEVQRFSYSRPFRRGEKDPDNEFATMWIERTTFTTAYKLPGILKWFEVKHFDTEEISPLQNAIETMELTNEKISHLVQQHRADQSLPLHPLSMLLSGI----VDPAVMGGFSNYEKAFFTERYLQEHPMDQDKLELLKQLIALQMPLLAQGIRIHGEKLTDNLRPLHERLVSCFKDLRSKVEK 1587          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Mouse
Match: Dock2 (dedicator of cyto-kinesis 2 [Source:MGI Symbol;Acc:MGI:2149010])

HSP 1 Score: 235.343 bits (599), Expect = 1.709e-61
Identity = 389/1794 (21.68%), Postives = 725/1794 (40.41%), Query Frame = 1
Query:   67 AIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKI--------------------LSNDIYPELWAEMFSW----ITYIRDSYLLVDTTDFDKITEAIQLAISERRYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQRE-YESSRRVSK-LSDSTIDYV-----------SLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYGKSQ----KIFLVFHFIRKGPMCL---TKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQIGIQLITRDECLENNAEKLITDYRINKREYSSTIN------------IQLKTIRPEDISDRNVMVLGLDPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQG----NKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVI--CIPLFEKFSKFPPHTHIRFIIWHRSL---NDRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATD----DSYLGKNILELLGEMFKAIKNLPDSENQLDKFIQDTMHFDV---HKQIFREL-----INNKPESDSNILR---ATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGL-IINALIPVCQPIGMARLVNNLLK---SCSDLDANMKSEL-TMN-CMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENK------KTELITQIDQAMESAYSNYCEEMTKAFKQVLSSNT-KYAFDSQLVENIIVQMNNIEE----CSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYTTVERKYPEPEDFA--SADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRYVSP-VSGGVTKLVEMI---------PNNDDNFSYTSEVVNQVLSLIYQYLQAFE--IYDTLDNYMIFVSAFQNLCSSVSRSLDL-VSEEYNVKILPDLYSKSKKRETNFTATIRRPSV-ALRVRHDD 5088
             +AIYN++ + +QH+ L+ GD + I+E    WYRG+         +FP S I +                    L+ ++   LW     W    +   ++ +L V +  +D +    QL          + K ++ E  ++ +  K+D   K L L    R+E G  +D +  SVI L+  H+   Y+ + R+ + +S    DY            SLY+ + N      + A+    + ++LY  +  K T ISE Y  R   + +  ++   N + +     G       KIFL+   +R G M L     K   +G+  RRP GV+V+++T+++    +S+++    +       EN+    +    I  +  S                IQ++   P  +    V+   L         + RN +Y+ L   + DK  K +  N EV + +    G    N + + + D +  +EY SV+YY   +P+W E +   +P+ E   +     H+RF+  HRS     D+ +    ++Y+KL  +D   +     +D YH L + K D +K++ A      P Y      + ++N+  T +    +     V  +D   + T+VCST+ T +  L  +    ++ Q +   L      +K +D  E+ KF    L++  +++ + +     D  +   ++ ++G +  A +        L+ +IQ   HF     +K++   L      +++ E    ILR   A ++  K  V+S     R +   + E     E  +S   + E + +        +++L+ A L  I +++   + +  A+L++ LL    +C       K ++ +MN  + S LF   +CR I+LP  TK + EL          +++  Q Q     C E++  I L   S Q +      + + E++++  +LR+    V T    + R        H  +   V+ +   L  + D+ + F +   +           +D  D +ME F +  +L    V+P                                      WM M  VQ+R FL  + +         +   ++Q      S           +F+L  +      + ITQ  L LE+   +   +++       GD+R      I+++W  L   K  F         ++T I   ++R   +   FD++  + +        + E+I ++D  +E    +  E+  +  + +L   T ++   ++ VEN +  +  + E        + D S  N M    NL  FY +  R ++  RYL+KL  +H   +NY+E   TLL  +   +WS E      + +  +  +   Q+K  L E  + YF+K   WE+ I +CKEL + Y     D+  LS   ++ ++  + IM   R + + + + Y G+GFP F+ +   K  + R K      +  + L SQF           P D    +  + I    V+P     P +++ K V  +I+ +Y +  +++F Y R +   + DP        I+    L   KLP IL    V  + +  I P + A+  +     K  M+   Y++ +S     L   +  I    V P V GG  K  +           P + D  S+  +++   +  +   ++  E  + D L         F +      ++L + V +EY V+ +PD   +   R  +   + R+ SV +L   H D
Sbjct:   13 GVAIYNFQGSEAQHLTLQIGDVVRIQETCGDWYRGYLIKHKLSQGIFPTSFIHLKEVTVEKRRNIENIIPAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFLQVQSMMYDLMEWRSQL------LSGTLPKDELKELKQK-VTSKIDYGNKILELDLIVRDEDGNILDPDKTSVISLFHAHEEATYKITERIKEEMSKDQPDYGVYSRISSSPTHSLYVFVRNFVCRIGEDAE----LFMSLY--DPHKQTVISENYLVRWGSKGFPKEIEMLNNLKVVFTDLGNKDLNRDKIFLICQIVRIGKMDLKDINAKKCTQGL--RRPFGVAVMDITDIIKGKAESDEEKQHFIPFHPVSAENDFLHSLLGKVIASKGDSGGQGLWVTMKMLVGDIIQIRKDYPHLVDRTTVVARKLGFPEIIMPGDVRNDIYITLLQGDFDKYTKTTQRNVEVIMCVCTEDGKVLPNAICVGAGD-KAMNEYHSVVYYQVKQPRWMETVKVAVPI-EDMQRI----HLRFMFRHRSSLESKDKGEKNFAMSYVKLMKEDGTTL-----HDGYHELVVLKGDSKKMEDASAYLTLPSYR-----HPVENKGATLSRSSSSVGGLSVSSRDVFSISTLVCSTKLTQNVGLLGLLKWRMKPQLLQENLEK----LKIVDGEEVVKFLQDTLDALFNIMMEHSQSNEYDILVFDALIYIIGLI--ADRKFQHFNTVLEAYIQQ--HFSATLAYKKLMTVLKTYLDTSSRGEQCEPILRTLKALEYVFKFIVRS-----RTLFSQLYEGKEQMEFEESMRRLFESINNLMKSQYKTTILLQVAALKYIPSVLHDVETVFDAKLLSQLLYEFYTCIPPVKLQKQKVQSMNEIVQSNLFKKQECRDILLPVITKELKELLE--------QRDDGQHQAEKKHCVELLNSI-LEVLSCQDAA--FTYDHIQEIMVQ--LLRTVNRTVIT----MGRD-------HALISHFVACMTAILDQMGDQHYSFYIETFQTS---------SDLVDFLMETFIMFKDLIGKNVYPG------------------------------------DWMAMSMVQNRVFLRAINK---------FAETMNQKFLEHTS----------FEFQLWNNYFHLAVAFITQDSLQLEQFTHAKYNKILNKY----GDMRRLIGFSIRDMWYKLGQNKICFIPGMVGPILEMTLIPEAELRKATIPIFFDMMLCEYQRTGAFKKFENEIILKLDHEVEGGRGD--EQYMQLLESILMECTAEHPTIAKSVENFVSLVKGLLEKLLDYRGVMTDESKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCENYTEAAYTLLLHTWLLKWSDEQCASQVMQTGQQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLTQQAKFYENIMKILRTKPDYFAVGYYGQGFPSFLRN---KVFIYRGKEYERREDFQMQLLSQFPNAEKMNTTSAPGDDVRNAPGQYIQCFTVQPVLDEHP-RFKNKPVPDQIINFYKSNYVQKFHYSRPVRRGKVDPENEFASMWIERTSFLTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTVNEKILMMINQYQSDESLPINPLSMLLNGI----VDPAVMGGFAKYEKAFFTEEYSREHPEDQDKLSHLKDLIAWQIPFLGAGIKIHEKRVSDNL-------RPFHDRMEECFKNLKMKVEKEYGVREMPDFEDRRVGRPRSMLRSYRQMSVISLASMHSD 1653          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Mouse
Match: Dock5 (dedicator of cytokinesis 5 [Source:MGI Symbol;Acc:MGI:2652871])

HSP 1 Score: 179.874 bits (455), Expect = 1.507e-44
Identity = 223/943 (23.65%), Postives = 397/943 (42.10%), Query Frame = 1
Query:   64 FAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKILSNDI----------------YPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERR--YDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKLSD----------------STIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAI--IMKDIQYGK--SQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSE--------KQIGIQ-----------------LITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDIS----------DRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGN---KVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPL-FEKFSKFPPHTHIRFIIWHRSLN---DRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIK-NRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTM-HFDVHKQIFRELINNKPESDSNI----LRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGL-----IINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNCMN----SKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNI 2577
            + +AIYNY  +    + L+ GD + I E Y GWYRG+         +FP ++I +    +                  EL   +  W    R  Y+    T F ++ +     I  R       + K ++ E  ++ +  K+D   + LGL    R++ G  +D +  S + L+  H  E  S R   K+ +                ST+    LY+   N      + A+    + I LY  +  + T ISE Y  R        ++ + N +  +  D+        +I LV   +R G M L K+  K     RRP GV+V+++++++   +D E        +QI ++                 +I  +E L +   K+I    +N +     ++++L    P D++          DR+  +   +G  +   P    + RN +Y+ L H E DK +KK+  N EV +S+ D +GN   K + P   + G  EY SV+YY   +P W E + + +  E+ ++     HIRF   HRS     D+S+   GVA++KL   D   +      D  H L +YK D +K++ A+Y    P  + + E   ++ +++P+      +ST      KD+  + T++CST+ T +  L  + N     Q I H L      +  +D  E+ KF    L++  +++ + +D+      + + L  +   I ++      P  E  + K    T+ H  + K +   + N +  S + +    L+A  +  +  ++S   Y R   G  ++   FN   DS   +     +  D+P+  ++ ++ A L     IIN +  V  P+ ++ L    ++S  D   N      +NCM     S LF  ++CR ++LP  T  +    +    K  +E      QLL NI
Sbjct:   12 YGVAIYNYNASQDVELSLQIGDTVHILEMYEGWYRGYALQNRSKKGIFPETYIHLKEATVEDGGQHETVIPGELPLVQELTNTLREWAVIWRKLYVNNKVTLFRQLQQMTYSLIEWRSQILSGTLPKDELAELKKK-VTAKIDHGNRMLGLDLVVRDDNGNILDPDETSTVALFRAH--EVASKRIEEKIQEEKSILQNLDLRGQAIFSTVHTYGLYVNFKNFVCNIGEDAE----LFIALY--DPDQSTFISENYLIRWGSNGMPKEIEKLNNLQAVFTDLSSTDLIRPRISLVCQIVRVGRMEL-KEGKKHTCGLRRPFGVAVMDISDIVHGKVDDEEKQHFIPFQQIAMETYIRQRQLIMSPLITSHVIGENEPLTSVLNKVIAAKEVNHKGQGLWVSLKL---LPGDLTQVQKNFSHLVDRSTAIARKMGFPEIILPG---DVRNDIYVTLIHGEFDKGKKKTPKNVEVTMSVFDEEGNLLEKAIHPGAGYEGVSEYKSVVYYQVKQPCWYETVKVFIAIEEVTR----CHIRFTFRHRSSQESRDKSERAFGVAFVKLMNADGTTL-----QDGRHDLVVYKGDNKKMEDAKYYLTLPGTKAELEEKELQASKNPSVFTPSKDST------KDSFQIATLICSTKLTQNVDLLGLLNWRSNSQNIKHNLKK----LMEVDGGEIVKFLQDTLDALFNIMMEMSDNETYDFLVFDALVFIISLIGDIKFQHFNPVLETYIYKHFSATLAHVKLSKVLNFYVANAEDPSKTELLFAALKALKYLFRFIIQSRVLYLR-FYGQSEDGDEFN---DSIRQLFLAFNTLMDRPLEEAVKIKGAALKYLPSIINDVKLVFDPMELSVLFCKFIQSIPD---NQLVRQKLNCMTKIVESSLFQQAECREVLLPLLTDQLSGQLDDHSTKPDHEA---SSQLLSNI 909          

HSP 2 Score: 132.88 bits (333), Expect = 3.198e-30
Identity = 123/461 (26.68%), Postives = 202/461 (43.82%), Query Frame = 1
Query: 3355 GDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLD---RENK-----KTELITQIDQAMESAYSN-------------YCEEMTKAFKQVLSSNTKYAF-DSQLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYT-TVERKYPEPEDFASADKKIFY-MPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIE 4644
            GD+R     +I+++W +L   K +F  +      ++T     ++R   +   FD++  +     N      + ELIT++DQ +E    +             +C    +  K + +S   +AF  S L+EN++     I      ++D S  N M    N+  FY +  R DI  RYL+KL  +H   +NY+E   TLL  +   QWS +      L  +      + ++K KL +E + YF+K   WEK I++ KEL + Y     D+  L ++  K +   + I+   RP+   + + Y G+GFP F+ +   K  + R K      + S+ L +QF     +    P  ED  S+ K+      VKP     P  Y+ K V ++IL YY   E+++F Y R     E+DP        I+          P IL     K I    I P + A+  +E
Sbjct: 1077 GDMRKEIGFRIRDMWYNLGPHKIKFIPSMVGPILEVTLTPEVELRKATIPIFFDMMQCEFNLSGNGNFHMFENELITKLDQEVEGGRGDEQYKVLLEKLLLEHC----RKHKYLANSGEAFAFLVSSLLENLLDYRTII------IHDESKENRMSCTVNVLNFYKDKKREDIYIRYLYKLRDLHRDCENYTEAAYTLLLHAELLQWSDKPCVPHLLQRDSYYVYTQQELKEKLYQEIISYFDKGKMWEKAIKLSKELAETYESKVFDYEGLGSLLKKRALFYENIIKAMRPQPEYFAVGYYGQGFPSFLRN---KIFIYRGKEYERREDFSLRLLTQFPNAEKMTSTTPPGEDIKSSPKQYLQCFTVKPV-MSLPPSYKDKPVPEQILNYYRANEVQQFSYSRPFRKGEKDPENEFATMWIERTTYRTAYTFPGILKWFEAKEISVEEISPLENAIETME 1523          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Mouse
Match: Dock1 (dedicator of cytokinesis 1 [Source:MGI Symbol;Acc:MGI:2429765])

HSP 1 Score: 157.147 bits (396), Expect = 1.396e-37
Identity = 204/901 (22.64%), Postives = 376/901 (41.73%), Query Frame = 1
Query:   28 IMKWLNYEEGDCFAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHI--------------KILSND--IYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISER-RYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQ---REYESSRRVSKLSDSTIDY-----------VSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYG----KSQKIFLVFHFIRKGPMCLT-KKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQ---IGIQLIT-RDECLENNAEKLITDYRINKREYSSTINIQL-----KTIRPE--DISDRNVMVLGLDPYYPA--TNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNK---VVMPSFDWRGFDEYSSVIYYHNAKPKWCEV--ICIPLFEKFSKFPPHTHIRFIIWHRSLN---DRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKN------IDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTMHFDVHKQIFRELINN--KPESDSNI---LRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILR--SLVLRKAGLIINALIPVCQPIGMARLVNN-LLKSCSDLDANMKSELTMNCMNSKLFVDSQCRSIILPETTKNI 2499
            + +W+  +  + + +A YNY    +  + L+ GD + I E Y GWYRG+   +     +FP S+I               ++  D  +  E+   +  W T  R  Y+  +   F  +   I   I  R +  S       ++  ++ +  K+D   + L L    R+E G  +D    S I L+  H+   ++ E   +  K     +D            ++L++ L NV  +  + A+ ++    +LY   + K   ISE Y  R +      D+ R + +       G    K +KI  V   +R G M L    T K     RRP GV+V++VT+++   +D E +   I  Q +   ++ L+    K+I    +N +     + ++L       IR E   + DR   V      +P      + RN +Y+ L   + DK  K +  N EV +S+ D  G +   V+ P        EY SVIYY   +P+W E   + IP+ E  ++    +H+RF   HRS     D+S+    +A++KL   D   +      D  H L +YK + +K++ A      P  +G+     ++ +  + T + M S     + KD+  + T+VCST+ T          Q+++   +L    N  ++ +N      +D  E+ KF    L++  +++ + ++       + + L  +   I +       P  E  + K    T+ +    ++ R  + +  KP  +  +   ++A ++  K  V+S   +  ++  N  EA     L   +  I  D+ SS  +  +R     L+    I+N +  V  P  ++++    +L   + L    K    +  ++S LF    CR I+LP  T  +
Sbjct:    1 MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIFPASYIHLKEAIVEGKGQHETVIPGDLPLIQEVTTTLREWSTIWRQLYVQDNREMFRSVRHMIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTSTISLFRAHEVASKQVEERLQEEKSQKQNMDINRQAKFAATPSLALFVNLKNVVCKIGEDAEVLM----SLYDPMESKF--ISENYLVRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQIVRVGRMELRDSNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQAVAGENDFLQTVINKVIAAKEVNHKGQGLWVTLKLLPGDIHQIRKEFPHLVDRTTAV-ARKTGFPEIIMPGDVRNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKSVIYYQVKQPRWFETLKVAIPI-EDVNR----SHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYDGTTL-----RDGEHDLIVYKAEAKKLEDAATYLSLPSTKGE-----LEEKGHSATGKGMQSLGSCTISKDSFQISTLVCSTKLT----------QNVDLLGLLKWRSNTNLLQQNLRQLMKVDGGEVVKFLQDTLDALFNIMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTKLTKVLRTYVASAEKPGVNEQLYKAIKALEYIFKFIVRSRVLFN-QLYENKGEADFVESLLQLFRSI-NDMMSSLSELTVRVKGAALKYLPTIVNDVKLVFDPKELSKMFTEFILNVPAGLLTVQKLSCLIEIVHSDLFTQHDCREILLPMMTDQL 867          

HSP 2 Score: 129.028 bits (323), Expect = 4.398e-29
Identity = 117/476 (24.58%), Postives = 217/476 (45.59%), Query Frame = 1
Query: 3277 TQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKT------ELITQIDQAMESAYSNYCEEMTKAFKQVLSSNT---KYAFDS--QLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYTTVERKYPEPED--FASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIE 4644
            TQ  L LE   S+   +++       GD+R     +I+++W +L   K +F         ++T I   ++R   +   FD++  +  + ++      E+IT++D  +E    +  E+    F ++L  +    KY   +    V+ ++  M  + +    ++D +  N M    N+  FY E+ R ++  RYL+KL  +H++  NY+E   TLL  +   +WS ++        +      + Q+K +L +E + YF+K   WE+ I + KEL + Y     D+ +LS +  K ++  + I+   RP+ + + + Y G+GFP F   L  K  + R K      +    L +QF      +    P D    S  + I    VKP +   P ++  + V ++I+ +Y   E++ F Y R +   E++P        I+  I     KLP IL    VKS+  + I P + A+  ++
Sbjct: 1034 TQESLQLENFSSAKRAKILNKY----GDMRRQIGFEIRDMWYNLGQHKIKFIPEMVGPILEMTLIPETELRKATLPIFFDMMQCEFHSTRSFQMFENEIITKLDHEVEGGRGD--EQYKVLFDKILLEHCRKHKYLAKTGETFVKLVVRLMERLLDYRTIMHDENKDNRMSCTVNVLNFYKEIEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEDVCAAHLTQRDGFQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKELAEQYETEMFDYEQLSELLKKQAQFYENIVKVIRPKPDYFAVGYYGQGFPSF---LRGKVFIYRGKEYERREDFEARLLTQFPNAEKMKTTSPPGDDIKTSPGQYIQCFTVKP-KLDLPPRFH-RPVSEQIVSFYRVNEVQRFEYSRPIRKGEKNPDNEFANMWIERTIYTTAYKLPGILRWFEVKSVFMVEISPLENAIETMQ 1498          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Mouse
Match: Dock1 (dedicator of cytokinesis 1 [Source:MGI Symbol;Acc:MGI:2429765])

HSP 1 Score: 144.821 bits (364), Expect = 1.398e-34
Identity = 159/636 (25.00%), Postives = 272/636 (42.77%), Query Frame = 1
Query:   28 IMKWLNYEEGDCFAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHI--------------KILSND--IYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISER-RYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQ---REYESSRRVSKLSDSTIDY-----------VSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYG----KSQKIFLVFHFIRKGPMCLT-KKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQ---IGIQLIT-RDECLENNAEKLITDYRINKREYSSTINIQL-----KTIRPE--DISDRNVMVLGLDPYYPA--TNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNK---VVMPSFDWRGFDEYSSVIYYHNAKPKWCEV--ICIPLFEKFSKFPPHTHIRFIIWHRSLN---DRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYT 1764
            + +W+  +  + + +A YNY    +  + L+ GD + I E Y GWYRG+   +     +FP S+I               ++  D  +  E+   +  W T  R  Y+  +   F  +   I   I  R +  S       ++  ++ +  K+D   + L L    R+E G  +D    S I L+  H+   ++ E   +  K     +D            ++L++ L NV  +  + A E+L   ++LY   + K   ISE Y  R +      D+ R + +       G    K +KI  V   +R G M L    T K     RRP GV+V++VT+++   +D E +   I  Q +   ++ L+    K+I    +N +     + ++L       IR E   + DR   V      +P      + RN +Y+ L   + DK  K +  N EV +S+ D  G +   V+ P        EY SVIYY   +P+W E   + IP+ E  ++    +H+RF   HRS     D+S+    +A++KL   D   +      D  H L +YK + +K++ A      P  +G+ E      +  + T + M S     + KD+  + T+VCST+ T
Sbjct:    1 MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIFPASYIHLKEAIVEGKGQHETVIPGDLPLIQEVTTTLREWSTIWRQLYVQDNREMFRSVRHMIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTSTISLFRAHEVASKQVEERLQEEKSQKQNMDINRQAKFAATPSLALFVNLKNVVCKIGEDA-EVL---MSLYDPMESKF--ISENYLVRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQIVRVGRMELRDSNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQAVAGENDFLQTVINKVIAAKEVNHKGQGLWVTLKLLPGDIHQIRKEFPHLVDRTTAV-ARKTGFPEIIMPGDVRNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKSVIYYQVKQPRWFETLKVAIPI-EDVNR----SHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYDGTTL-----RDGEHDLIVYKAEAKKLEDAATYLSLPSTKGELE-----EKGHSATGKGMQSLGSCTISKDSFQISTLVCSTKLT 614          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Mouse
Match: Dock2 (dedicator of cyto-kinesis 2 [Source:MGI Symbol;Acc:MGI:2149010])

HSP 1 Score: 142.51 bits (358), Expect = 2.467e-33
Identity = 205/922 (22.23%), Postives = 392/922 (42.52%), Query Frame = 1
Query:   67 AIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKI--------------------LSNDIYPELWAEMFSW----ITYIRDSYLLVDTTDFDKITEAIQLAISERRYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQRE-YESSRRV-SKLSDSTIDYV-----------SLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYGKSQ----KIFLVFHFIRKGPMCL---TKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQIGIQLITRDECLENNAEKLITDYRINKREYSSTIN------------IQLKTIRPEDISDRNVMVLGLDPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQG----NKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPL-FEKFSKFPPHTHIRFIIWHRSL---NDRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATD----DSYLGKNILELLGEMFKAIKNLPDSENQLDKFIQDTMHFDV---HKQIFREL-----INNKPESDSNILR---ATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGL-IINALIPVCQPIGMARLVNNLLK---SCSDLDANMKSEL-TMN-CMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNI 2577
             +AIYN++ + +QH+ L+ GD + I+E    WYRG+         +FP S I +                    L+ ++   LW     W    +   ++ +L V +  +D +    QL          + K ++ E  ++ +  K+D   K L L    R+E G  +D +  SVI L+  H+   Y+ + R+  ++S    DY            SLY+ + N      + A+    + ++LY  +  K T ISE Y  R   + +  ++   N + +     G       KIFL+   +R G M L     K   +G+  RRP GV+V+++T+++    +S+++    +       EN+    +    I  +  S                IQ++   P  +    V+   L         + RN +Y+ L   + DK  K +  N EV + +    G    N + + + D +  +EY SV+YY   +P+W E + + +  E   +     H+RF+  HRS     D+ +    ++Y+KL  +D   +     +D YH L + K D +K++ A      P Y      + ++N+  T +    +     V  +D   + T+VCST+ T +  L  +    ++ Q +   L      +K +D  E+ KF    L++  +++ + +     D  +   ++ ++G +  A +        L+ +IQ   HF     +K++   L      +++ E    ILR   A ++  K  V+S     R +   + E     E  +S   + E + +        +++L+ A L  I +++   + +  A+L++ LL    +C       K ++ +MN  + S LF   +CR I+LP  TK + EL   + +  +  +++   +LL++I
Sbjct:   13 GVAIYNFQGSEAQHLTLQIGDVVRIQETCGDWYRGYLIKHKLSQGIFPTSFIHLKEVTVEKRRNIENIIPAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFLQVQSMMYDLMEWRSQLL------SGTLPKDELKELKQK-VTSKIDYGNKILELDLIVRDEDGNILDPDKTSVISLFHAHEEATYKITERIKEEMSKDQPDYGVYSRISSSPTHSLYVFVRNFVCRIGEDAE----LFMSLY--DPHKQTVISENYLVRWGSKGFPKEIEMLNNLKVVFTDLGNKDLNRDKIFLICQIVRIGKMDLKDINAKKCTQGL--RRPFGVAVMDITDIIKGKAESDEEKQHFIPFHPVSAENDFLHSLLGKVIASKGDSGGQGLWVTMKMLVGDIIQIRKDYPHLVDRTTVVARKLGFPEIIMPGDVRNDIYITLLQGDFDKYTKTTQRNVEVIMCVCTEDGKVLPNAICVGAGD-KAMNEYHSVVYYQVKQPRWMETVKVAVPIEDMQRI----HLRFMFRHRSSLESKDKGEKNFAMSYVKLMKEDGTTL-----HDGYHELVVLKGDSKKMEDASAYLTLPSYR-----HPVENKGATLSRSSSSVGGLSVSSRDVFSISTLVCSTKLTQNVGLLGLLKWRMKPQLLQENLEK----LKIVDGEEVVKFLQDTLDALFNIMMEHSQSNEYDILVFDALIYIIGLI--ADRKFQHFNTVLEAYIQQ--HFSATLAYKKLMTVLKTYLDTSSRGEQCEPILRTLKALEYVFKFIVRS-----RTLFSQLYEGKEQMEFEESMRRLFESINNLMKSQYKTTILLQVAALKYIPSVLHDVETVFDAKLLSQLLYEFYTCIPPVKLQKQKVQSMNEIVQSNLFKKQECRDILLPVITKELKELLEQRDDGQHQAEKKHCVELLNSI 891          
BLAST of dedicator of cytokinesis protein 5 vs. UniProt/SwissProt
Match: sp|Q14185|DOCK1_HUMAN (Dedicator of cytokinesis protein 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=2)

HSP 1 Score: 259.61 bits (662), Expect = 4.537e-68
Identity = 362/1634 (22.15%), Postives = 671/1634 (41.06%), Query Frame = 1
Query:   28 IMKWLNYEEGDCFAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIK--------------ILSND--IYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISER-RYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQ---REYESSRRVSKLSDSTIDY-----------VSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYG----KSQKIFLVFHFIRKGPMCLT-KKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQ---IGIQLIT-RDECLENNAEKLITDYRINKREYSSTINIQL-----KTIRPE--DISDRNVMVLGLDPYYPA--TNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNK---VVMPSFDWRGFDEYSSVIYYHNAKPKWCEV--ICIPLFEKFSKFPPHTHIRFIIWHRSLN---DRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFD----KLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTMHFDVHKQIFRELINN--KPESDSNI---LRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPI-LRSLVLRKAGLIINALIPVCQPIGMARLVNN-LLKSCSDLDANMKSELTMNCMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSC-VAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKT------ELITQIDQAMESAYSNYCEEMTKAFKQVLSSNT---KYAFDS--QLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYTTVERKYPEPEDFA--SADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIE 4644
            + +W+  +  + + +A YNY    +  + L+ GD + I E Y GWYRG+   +     +FP S+I               ++  D  +  E+   +  W T  R  Y+  +   F  +   I   I  R +  S       ++  ++ +  K+D   + L L    R+E G  +D    S I L+  H+   ++ E   +  K     ID            ++L++ L NV  +  + A+ ++    +LY   + K   ISE Y  R +      D+ R + +       G    K +KI  V   +R G M L    T K     RRP GV+V++VT+++   +D E +   I  Q +   ++ L+    K+I    +N +     + ++L       IR E   + DR   V      +P      + RN +Y+ L   + DK  K +  N EV +S+ D  G +   V+ P        EY SVIYY   +P+W E   + IP+ E  ++    +H+RF   HRS     D+S+    +A++KL   D   +      D  H L +YK + +K++ A      P  + +     ++ +  + T + M S     + KD+  + T+VCST+ T +     LL    N SL  Q +   +         +D  E+ KF    L++  +++ + ++       + + L  +   I +       P  E  + K    T+ +    ++ +  ++   KP  +  +   ++A +   K  V+S   +  ++  N  EA     L   +  I + ++S  D+ + ++   L+    I+N +  V  P  ++++    +L     L    K    +  ++S LF    CR I+LP  T  +         K + E++ D    L+  C  +   +++  R       ++     +  II  K+LR+    ++S G +    SE  G          V+ +   L  + D  +  +++       F + R  TD  D +ME F +   L    V+P                                      W+ M  VQ++ FL  + Q  +++ K +    L Q                  + +L  +      + +TQ  L LE   S+   +++       GD+R     +I+++W +L   K +F         ++T I   ++R   +   FD++  +  + ++      E+IT++D  +E    +  E+    F ++L  +    KY   +    V+ ++  M  + +    ++D +  N M    N+  FY E+ R ++  RYL+KL  +H++  NY+E   TLL  +   +WS ++        +      + Q+K +L +E + YF+K   WE+ I + KEL + Y     D+ +LS +  K ++  + I+   RP+ + + + Y G+GFP F   L  K  + R K      +    L +QF      +    P D    S  + I    VKP +   P K+  + V ++I+ +Y   E++ F Y R +   E++P        I+  I     KLP IL    VKS+  + I P + A+  ++
Sbjct:    1 MTRWVPTKREEKYGVAFYNYDARGADELSLQIGDTVHILETYEGWYRGYTLRKKSKKGIFPASYIHLKEAIVEGKGQHETVIPGDLPLIQEVTTTLREWSTIWRQLYVQDNREMFRSVRHMIYDLIEWRSQILSGTLPQDELKELKKKVTAKIDYGNRILDLDLVVRDEDGNILDPELTSTISLFRAHEIASKQVEERLQEEKSQKQNIDINRQAKFAATPSLALFVNLKNVVCKIGEDAEVLM----SLYDPVESKF--ISENYLVRWSSSGLPKDIDRLHNLRAVFTDLGSKDLKREKISFVCQIVRVGRMELRDNNTRKLTSGLRRPFGVAVMDVTDIINGKVDDEDKQHFIPFQPVAGENDFLQTVINKVIAAKEVNHKGQGLWVTLKLLPGDIHQIRKEFPHLVDRTTAV-ARKTGFPEIIMPGDVRNDIYVTLVQGDFDKGSKTTAKNVEVTVSVYDEDGKRLEHVIFPGAGDEAISEYKSVIYYQVKQPRWFETVKVAIPI-EDVNR----SHLRFTFRHRSSQDSKDKSEKIFALAFVKLMRYDGTTL-----RDGEHDLIVYKAEAKKLEDAATYLSLPSTKAE-----LEEKGHSATGKSMQSLGSCTISKDSFQISTLVCSTKLTQNVDLLGLLKWRSNTSLLQQNLRQLM--------KVDGGEVVKFLQDTLDALFNIMMENSESETFDTLVFDALVFIIGLIADRKFQHFNPVLETYIKKHFSATLAYTKLTKVLKNYVDGAEKPGVNEQLYKAMKALESIFKFIVRSRILFN-QLYENKGEADFVESLLQLFRSINDMMSSMSDQTVRVKGAALKYLPTIVNDVKLVFDPKELSKMFTEFILNVPMGLLTIQKLYCLIEIVHSDLFTQHDCREILLPMMTDQL---------KYHLERQED----LEACCQLLSHILEVLYRK------DVGPTQRHVQIIMEKLLRTVNRTVISMGRD----SELIGN--------FVACMTAILRQMEDYHYAHLIKT------FGKMR--TDVVDFLMETFIMFKNLIGKNVYPF------------------------------------DWVIMNMVQNKVFLRAINQYADMLNKKF----LDQ---------------ANFELQLWNNYFHLAVAFLTQESLQLENFSSAKRAKILNKY----GDMRRQIGFEIRDMWYNLGQHKIKFIPEMVGPILEMTLIPETELRKATIPIFFDMMQCEFHSTRSFQMFENEIITKLDHEVEGGRGD--EQYKVLFDKILLEHCRKHKYLAKTGETFVKLVVRLMERLLDYRTIMHDENKENRMSCTVNVLNFYKEIEREEMYIRYLYKLCDLHKECDNYTEAAYTLLLHAKLLKWSEDVCVAHLTQRDGYQATTQGQLKEQLYQEIIHYFDKGKMWEEAIALGKELAEQYENEMFDYEQLSELLKKQAQFYENIVKVIRPKPDYFAVGYYGQGFPTF---LRGKVFIYRGKEYERREDFEARLLTQFPNAEKMKTTSPPGDDIKNSPGQYIQCFTVKP-KLDLPPKFH-RPVSEQIVSFYRVNEVQRFEYSRPIRKGEKNPDNEFANMWIERTIYTTAYKLPGILRWFEVKSVFMVEISPLENAIETMQ 1498          
BLAST of dedicator of cytokinesis protein 5 vs. UniProt/SwissProt
Match: sp|Q8C3J5|DOCK2_MOUSE (Dedicator of cytokinesis protein 2 OS=Mus musculus OX=10090 GN=Dock2 PE=1 SV=3)

HSP 1 Score: 235.343 bits (599), Expect = 1.195e-60
Identity = 389/1794 (21.68%), Postives = 725/1794 (40.41%), Query Frame = 1
Query:   67 AIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKI--------------------LSNDIYPELWAEMFSW----ITYIRDSYLLVDTTDFDKITEAIQLAISERRYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQRE-YESSRRVSK-LSDSTIDYV-----------SLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYGKSQ----KIFLVFHFIRKGPMCL---TKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQIGIQLITRDECLENNAEKLITDYRINKREYSSTIN------------IQLKTIRPEDISDRNVMVLGLDPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQG----NKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVI--CIPLFEKFSKFPPHTHIRFIIWHRSL---NDRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATD----DSYLGKNILELLGEMFKAIKNLPDSENQLDKFIQDTMHFDV---HKQIFREL-----INNKPESDSNILR---ATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGL-IINALIPVCQPIGMARLVNNLLK---SCSDLDANMKSEL-TMN-CMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENK------KTELITQIDQAMESAYSNYCEEMTKAFKQVLSSNT-KYAFDSQLVENIIVQMNNIEE----CSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYTTVERKYPEPEDFA--SADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRYVSP-VSGGVTKLVEMI---------PNNDDNFSYTSEVVNQVLSLIYQYLQAFE--IYDTLDNYMIFVSAFQNLCSSVSRSLDL-VSEEYNVKILPDLYSKSKKRETNFTATIRRPSV-ALRVRHDD 5088
             +AIYN++ + +QH+ L+ GD + I+E    WYRG+         +FP S I +                    L+ ++   LW     W    +   ++ +L V +  +D +    QL          + K ++ E  ++ +  K+D   K L L    R+E G  +D +  SVI L+  H+   Y+ + R+ + +S    DY            SLY+ + N      + A+    + ++LY  +  K T ISE Y  R   + +  ++   N + +     G       KIFL+   +R G M L     K   +G+  RRP GV+V+++T+++    +S+++    +       EN+    +    I  +  S                IQ++   P  +    V+   L         + RN +Y+ L   + DK  K +  N EV + +    G    N + + + D +  +EY SV+YY   +P+W E +   +P+ E   +     H+RF+  HRS     D+ +    ++Y+KL  +D   +     +D YH L + K D +K++ A      P Y      + ++N+  T +    +     V  +D   + T+VCST+ T +  L  +    ++ Q +   L      +K +D  E+ KF    L++  +++ + +     D  +   ++ ++G +  A +        L+ +IQ   HF     +K++   L      +++ E    ILR   A ++  K  V+S     R +   + E     E  +S   + E + +        +++L+ A L  I +++   + +  A+L++ LL    +C       K ++ +MN  + S LF   +CR I+LP  TK + EL          +++  Q Q     C E++  I L   S Q +      + + E++++  +LR+    V T    + R        H  +   V+ +   L  + D+ + F +   +           +D  D +ME F +  +L    V+P                                      WM M  VQ+R FL  + +         +   ++Q      S           +F+L  +      + ITQ  L LE+   +   +++       GD+R      I+++W  L   K  F         ++T I   ++R   +   FD++  + +        + E+I ++D  +E    +  E+  +  + +L   T ++   ++ VEN +  +  + E        + D S  N M    NL  FY +  R ++  RYL+KL  +H   +NY+E   TLL  +   +WS E      + +  +  +   Q+K  L E  + YF+K   WE+ I +CKEL + Y     D+  LS   ++ ++  + IM   R + + + + Y G+GFP F+ +   K  + R K      +  + L SQF           P D    +  + I    V+P     P +++ K V  +I+ +Y +  +++F Y R +   + DP        I+    L   KLP IL    V  + +  I P + A+  +     K  M+   Y++ +S     L   +  I    V P V GG  K  +           P + D  S+  +++   +  +   ++  E  + D L         F +      ++L + V +EY V+ +PD   +   R  +   + R+ SV +L   H D
Sbjct:   13 GVAIYNFQGSEAQHLTLQIGDVVRIQETCGDWYRGYLIKHKLSQGIFPTSFIHLKEVTVEKRRNIENIIPAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFLQVQSMMYDLMEWRSQL------LSGTLPKDELKELKQK-VTSKIDYGNKILELDLIVRDEDGNILDPDKTSVISLFHAHEEATYKITERIKEEMSKDQPDYGVYSRISSSPTHSLYVFVRNFVCRIGEDAE----LFMSLY--DPHKQTVISENYLVRWGSKGFPKEIEMLNNLKVVFTDLGNKDLNRDKIFLICQIVRIGKMDLKDINAKKCTQGL--RRPFGVAVMDITDIIKGKAESDEEKQHFIPFHPVSAENDFLHSLLGKVIASKGDSGGQGLWVTMKMLVGDIIQIRKDYPHLVDRTTVVARKLGFPEIIMPGDVRNDIYITLLQGDFDKYTKTTQRNVEVIMCVCTEDGKVLPNAICVGAGD-KAMNEYHSVVYYQVKQPRWMETVKVAVPI-EDMQRI----HLRFMFRHRSSLESKDKGEKNFAMSYVKLMKEDGTTL-----HDGYHELVVLKGDSKKMEDASAYLTLPSYR-----HPVENKGATLSRSSSSVGGLSVSSRDVFSISTLVCSTKLTQNVGLLGLLKWRMKPQLLQENLEK----LKIVDGEEVVKFLQDTLDALFNIMMEHSQSNEYDILVFDALIYIIGLI--ADRKFQHFNTVLEAYIQQ--HFSATLAYKKLMTVLKTYLDTSSRGEQCEPILRTLKALEYVFKFIVRS-----RTLFSQLYEGKEQMEFEESMRRLFESINNLMKSQYKTTILLQVAALKYIPSVLHDVETVFDAKLLSQLLYEFYTCIPPVKLQKQKVQSMNEIVQSNLFKKQECRDILLPVITKELKELLE--------QRDDGQHQAEKKHCVELLNSI-LEVLSCQDAA--FTYDHIQEIMVQ--LLRTVNRTVIT----MGRD-------HALISHFVACMTAILDQMGDQHYSFYIETFQTS---------SDLVDFLMETFIMFKDLIGKNVYPG------------------------------------DWMAMSMVQNRVFLRAINK---------FAETMNQKFLEHTS----------FEFQLWNNYFHLAVAFITQDSLQLEQFTHAKYNKILNKY----GDMRRLIGFSIRDMWYKLGQNKICFIPGMVGPILEMTLIPEAELRKATIPIFFDMMLCEYQRTGAFKKFENEIILKLDHEVEGGRGD--EQYMQLLESILMECTAEHPTIAKSVENFVSLVKGLLEKLLDYRGVMTDESKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCENYTEAAYTLLLHTWLLKWSDEQCASQVMQTGQQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLTQQAKFYENIMKILRTKPDYFAVGYYGQGFPSFLRN---KVFIYRGKEYERREDFQMQLLSQFPNAEKMNTTSAPGDDVRNAPGQYIQCFTVQPVLDEHP-RFKNKPVPDQIINFYKSNYVQKFHYSRPVRRGKVDPENEFASMWIERTSFLTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTVNEKILMMINQYQSDESLPINPLSMLLNGI----VDPAVMGGFAKYEKAFFTEEYSREHPEDQDKLSHLKDLIAWQIPFLGAGIKIHEKRVSDNL-------RPFHDRMEECFKNLKMKVEKEYGVREMPDFEDRRVGRPRSMLRSYRQMSVISLASMHSD 1653          
BLAST of dedicator of cytokinesis protein 5 vs. UniProt/SwissProt
Match: sp|Q92608|DOCK2_HUMAN (Dedicator of cytokinesis protein 2 OS=Homo sapiens OX=9606 GN=DOCK2 PE=1 SV=2)

HSP 1 Score: 226.483 bits (576), Expect = 6.095e-58
Identity = 387/1788 (21.64%), Postives = 724/1788 (40.49%), Query Frame = 1
Query:   67 AIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKI--------------------LSNDIYPELWAEMFSW----ITYIRDSYLLVDTTDFDKITEAIQLAISERRYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYE--SSRRVSKLSDSTIDYV-----------SLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYGKSQ----KIFLVFHFIRKGPMCLTKKTIKEGV-PYRRPKGVSVIEVTNVMTENL--DSEKQIGIQ---LITRDECLENNAEKLIT--------DYRINKREYSSTINIQLKTIRPEDISDRNVMVLGLDPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQG----NKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVI--CIPLFEKFSKFPPHTHIRFIIWHRSL---NDRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLD-LIQQATDDSYLGKNILELLGEMFKAIKNLPDSENQ-----LDKFIQDTMHFDV---HKQIFREL-----INNKPESDSNILR---ATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGL-IINALIPVCQPIGMARLVNNLLK---SCSDLDANMKSEL-TMN-CMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLD-NICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSC-VAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIV------HLDRENKKTELITQIDQAMESAYSNYCEEMTKAFKQVL-SSNTKYAFDSQLVENIIVQMNNIEE----CSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYTTVERKYPEPEDFA--SADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRYVSP-VSGGVTK---------LVEMIPNNDDNFSYTSEVVNQVLSLIYQYLQAFE--IYDTLDNYMIFVSAFQNLCSSVSRSLDL-VSEEYNVKILPDLYSKSKKRETNFTATIRRPSV 5064
             +AIYN++ + +  + L+ GD + I+E    WYRG+      +  +FP S I I                    L+ ++   LW     W    +   ++ +L V +  +D +    QL          + K ++ E  ++ +  K+D   K L L    R+E G  +D +  SVI L+  H+   +  + R   ++S    DY            SLY+ + N      + A+    + ++LY  +  K T ISE Y  R   R +  ++   N + +     G       KI+L+   +R G M L     K+     RRP GV+V+++T+++      D EKQ  I    +   ++ L +   K+I            +  +     I IQ++   P  +    V+   L         + RN +Y+ L   + DK  K +  N EV + +    G    N + + + D +  +EY SV+YY   +P+W E +   +P+ E   +     H+RF+  HRS     D+ +    ++Y+KL  +D   +     +D +H L + K D +K++ A      P Y      + ++N+  T +    +     V  +D   + T+VCST+ T +  L  +    ++ Q +   L      +K +D  E+ KF    L++  + +++ +  D Y   +IL +   +   I  + D + Q     L+ +IQ   HF     +K++   L      +++ E    ILR   A ++  K  V+S     R +   + E     E  +S   + E + +        +++L+ A L  I +++   + +  A+L++ LL    +C       K ++ +MN  + S LF   +CR I+LP  TK + EL          +K+  Q Q+L+   C E++  I L   S+Q +      + + E++++  +LR+    +++ G +++  S              V+ +   L+ + D+ + F +   +   +           D +ME F +  +L    V+P                                      WM M  VQ+R FL  + +         +   ++Q          F   T   +F+L  +      + ITQ  L LE+   +   +++       GD+R      I+++W  L   K  F         ++T I   ++R   +   FD++        D +  + E+I ++D  +E    +  E+  +  + +L     ++   ++ VEN +  +  + E        + D S  N M    NL  FY +  R ++  RYL+KL  +H    NY+E   TLL  +   +WS E      + +  +  +   Q+K  L E  + YF+K   WE+ I +CKEL + Y     D+  LS    + ++  + IM   RP+ + + + Y G+GFP F+ +   K  + R K      +  + L +QF           P D    +  + I    V+P     P +++ K V  +I+ +Y +  ++ F Y R +     DP        I+    +   KLP IL    V  + +  I P + A+  +     K  M+   Y++ ++     L   +  I    V P V GG  K          V   P + D  ++  +++   +  +   ++  E  + D L         F +      ++L + V +EY V+ +PD   +   R  +   + R+ S+
Sbjct:   13 GVAIYNFQGSGAPQLSLQIGDVVRIQETCGDWYRGYLIKHKMLQGIFPKSFIHIKEVTVEKRRNTENIIPAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFLQVQSMMYDLMEWRSQL------LSGTLPKDELKELKQK-VTSKIDYGNKILELDLIVRDEDGNILDPDNTSVISLFHAHEEATDKITERIKEEMSKDQPDYAMYSRISSSPTHSLYVFVRNFVCRIGEDAE----LFMSLY--DPNKQTVISENYLVRWGSRGFPKEIEMLNNLKVVFTDLGNKDLNRDKIYLICQIVRVGKMDLKDTGAKKCTQGLRRPFGVAVMDITDIIKGKAESDEEKQHFIPFHPVTAENDFLHSLLGKVIASKGDSGGQGLWVTMKMLVGDI-IQIRKDYPHLVDRTTVVARKLGFPEIIMPGDVRNDIYITLLQGDFDKYNKTTQRNVEVIMCVCAEDGKTLPNAICVGAGD-KPMNEYRSVVYYQVKQPRWMETVKVAVPI-EDMQRI----HLRFMFRHRSSLESKDKGEKNFAMSYVKLMKEDGTTL-----HDGFHDLVVLKGDSKKMEDASAYLTLPSYR-----HHVENKGATLSRSSSSVGGLSVSSRDVFSISTLVCSTKLTQNVGLLGLLKWRMKPQLLQENLEK----LKIVDGEEVVKFLQDTLDALFNIMMEHSQSDEY---DIL-VFDALIYIIGLIADRKFQHFNTVLEAYIQQ--HFSATLAYKKLMTVLKTYLDTSSRGEQCEPILRTLKALEYVFKFIVRS-----RTLFSQLYEGKEQMEFEESMRRLFESINNLMKSQYKTTILLQVAALKYIPSVLHDVEMVFDAKLLSQLLYEFYTCIPPVKLQKQKVQSMNEIVQSNLFKKQECRDILLPVITKELKELLE--------QKDDMQHQVLERKYCVELLNSI-LEVLSYQDAA--FTYHHIQEIMVQ--LLRTVNRTVITMGRDHILISH------------FVACMTAILNQMGDQHYSFYIETFQTSSELV---------DFLMETFIMFKDLIGKNVYPG------------------------------------DWMAMSMVQNRVFLRAINK---------FAETMNQK---------FLEHT-NFEFQLWNNYFHLAVAFITQDSLQLEQFSHAKYNKILNKY----GDMRRLIGFSIRDMWYKLGQNKICFIPGMVGPILEMTLIPEAELRKATIPIFFDMMLCEYQRSGDFKKFENEIILKLDHEVEGGRGD--EQYMQLLESILMECAAEHPTIAKSVENFVNLVKGLLEKLLDYRGVMTDESKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQCASQVMQTGQQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLRN---KVFIYRGKEYERREDFQMQLMTQFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHP-RFKNKPVPDQIINFYKSNYVQRFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTANEKILMMINQYQSDETLPINPLSMLLNGI----VDPAVMGGFAKYEKAFFTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNL-------RPFHDRMEECFKNLKMKVEKEYGVREMPDFDDRRVGRPRSMLRSYRQMSI 1645          
BLAST of dedicator of cytokinesis protein 5 vs. UniProt/SwissProt
Match: sp|B2RY04|DOCK5_MOUSE (Dedicator of cytokinesis protein 5 OS=Mus musculus OX=10090 GN=Dock5 PE=1 SV=2)

HSP 1 Score: 179.874 bits (455), Expect = 1.054e-43
Identity = 223/943 (23.65%), Postives = 397/943 (42.10%), Query Frame = 1
Query:   64 FAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKILSNDI----------------YPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERR--YDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKLSD----------------STIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAI--IMKDIQYGK--SQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSE--------KQIGIQ-----------------LITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDIS----------DRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGN---KVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPL-FEKFSKFPPHTHIRFIIWHRSLN---DRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIK-NRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTM-HFDVHKQIFRELINNKPESDSNI----LRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGL-----IINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNCMN----SKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNI 2577
            + +AIYNY  +    + L+ GD + I E Y GWYRG+         +FP ++I +    +                  EL   +  W    R  Y+    T F ++ +     I  R       + K ++ E  ++ +  K+D   + LGL    R++ G  +D +  S + L+  H  E  S R   K+ +                ST+    LY+   N      + A+    + I LY  +  + T ISE Y  R        ++ + N +  +  D+        +I LV   +R G M L K+  K     RRP GV+V+++++++   +D E        +QI ++                 +I  +E L +   K+I    +N +     ++++L    P D++          DR+  +   +G  +   P    + RN +Y+ L H E DK +KK+  N EV +S+ D +GN   K + P   + G  EY SV+YY   +P W E + + +  E+ ++     HIRF   HRS     D+S+   GVA++KL   D   +      D  H L +YK D +K++ A+Y    P  + + E   ++ +++P+      +ST      KD+  + T++CST+ T +  L  + N     Q I H L      +  +D  E+ KF    L++  +++ + +D+      + + L  +   I ++      P  E  + K    T+ H  + K +   + N +  S + +    L+A  +  +  ++S   Y R   G  ++   FN   DS   +     +  D+P+  ++ ++ A L     IIN +  V  P+ ++ L    ++S  D   N      +NCM     S LF  ++CR ++LP  T  +    +    K  +E      QLL NI
Sbjct:   12 YGVAIYNYNASQDVELSLQIGDTVHILEMYEGWYRGYALQNRSKKGIFPETYIHLKEATVEDGGQHETVIPGELPLVQELTNTLREWAVIWRKLYVNNKVTLFRQLQQMTYSLIEWRSQILSGTLPKDELAELKKK-VTAKIDHGNRMLGLDLVVRDDNGNILDPDETSTVALFRAH--EVASKRIEEKIQEEKSILQNLDLRGQAIFSTVHTYGLYVNFKNFVCNIGEDAE----LFIALY--DPDQSTFISENYLIRWGSNGMPKEIEKLNNLQAVFTDLSSTDLIRPRISLVCQIVRVGRMEL-KEGKKHTCGLRRPFGVAVMDISDIVHGKVDDEEKQHFIPFQQIAMETYIRQRQLIMSPLITSHVIGENEPLTSVLNKVIAAKEVNHKGQGLWVSLKL---LPGDLTQVQKNFSHLVDRSTAIARKMGFPEIILPG---DVRNDIYVTLIHGEFDKGKKKTPKNVEVTMSVFDEEGNLLEKAIHPGAGYEGVSEYKSVVYYQVKQPCWYETVKVFIAIEEVTR----CHIRFTFRHRSSQESRDKSERAFGVAFVKLMNADGTTL-----QDGRHDLVVYKGDNKKMEDAKYYLTLPGTKAELEEKELQASKNPSVFTPSKDST------KDSFQIATLICSTKLTQNVDLLGLLNWRSNSQNIKHNLKK----LMEVDGGEIVKFLQDTLDALFNIMMEMSDNETYDFLVFDALVFIISLIGDIKFQHFNPVLETYIYKHFSATLAHVKLSKVLNFYVANAEDPSKTELLFAALKALKYLFRFIIQSRVLYLR-FYGQSEDGDEFN---DSIRQLFLAFNTLMDRPLEEAVKIKGAALKYLPSIINDVKLVFDPMELSVLFCKFIQSIPD---NQLVRQKLNCMTKIVESSLFQQAECREVLLPLLTDQLSGQLDDHSTKPDHEA---SSQLLSNI 909          

HSP 2 Score: 132.88 bits (333), Expect = 2.237e-29
Identity = 123/461 (26.68%), Postives = 202/461 (43.82%), Query Frame = 1
Query: 3355 GDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLD---RENK-----KTELITQIDQAMESAYSN-------------YCEEMTKAFKQVLSSNTKYAF-DSQLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYT-TVERKYPEPEDFASADKKIFY-MPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIE 4644
            GD+R     +I+++W +L   K +F  +      ++T     ++R   +   FD++  +     N      + ELIT++DQ +E    +             +C    +  K + +S   +AF  S L+EN++     I      ++D S  N M    N+  FY +  R DI  RYL+KL  +H   +NY+E   TLL  +   QWS +      L  +      + ++K KL +E + YF+K   WEK I++ KEL + Y     D+  L ++  K +   + I+   RP+   + + Y G+GFP F+ +   K  + R K      + S+ L +QF     +    P  ED  S+ K+      VKP     P  Y+ K V ++IL YY   E+++F Y R     E+DP        I+          P IL     K I    I P + A+  +E
Sbjct: 1077 GDMRKEIGFRIRDMWYNLGPHKIKFIPSMVGPILEVTLTPEVELRKATIPIFFDMMQCEFNLSGNGNFHMFENELITKLDQEVEGGRGDEQYKVLLEKLLLEHC----RKHKYLANSGEAFAFLVSSLLENLLDYRTII------IHDESKENRMSCTVNVLNFYKDKKREDIYIRYLYKLRDLHRDCENYTEAAYTLLLHAELLQWSDKPCVPHLLQRDSYYVYTQQELKEKLYQEIISYFDKGKMWEKAIKLSKELAETYESKVFDYEGLGSLLKKRALFYENIIKAMRPQPEYFAVGYYGQGFPSFLRN---KIFIYRGKEYERREDFSLRLLTQFPNAEKMTSTTPPGEDIKSSPKQYLQCFTVKPV-MSLPPSYKDKPVPEQILNYYRANEVQQFSYSRPFRKGEKDPENEFATMWIERTTYRTAYTFPGILKWFEAKEISVEEISPLENAIETME 1523          
BLAST of dedicator of cytokinesis protein 5 vs. UniProt/SwissProt
Match: sp|Q9H7D0|DOCK5_HUMAN (Dedicator of cytokinesis protein 5 OS=Homo sapiens OX=9606 GN=DOCK5 PE=1 SV=3)

HSP 1 Score: 178.718 bits (452), Expect = 2.415e-43
Identity = 225/946 (23.78%), Postives = 391/946 (41.33%), Query Frame = 1
Query:   64 FAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKILSNDI----------------YPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERR--YDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKLSD----------------STIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAI--IMKDIQYGK--SQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSE--------KQIGIQ-----------------LITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDIS----------DRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGN---KVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPL-FEKFSKFPPHTHIRFIIWHRS---LNDRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHP----EYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTMHFDVHKQIFRELINNKPESDSN-----ILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGL-----IINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNCMN----SKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNI 2577
            + +AIYNY  +    + L+ GD + I E Y GWYRG+         +FP ++I +    +                  EL + +  W    R  Y+    T F ++ +     I  R       + K ++ E  ++ +  K+D   + LGL    R++ G  +D +  S I L+  H  E  S R   K+ +                STI    LY+   N      + A+    + + LY  +  + T ISE Y  R        ++ + N +  +  D+        ++ LV   +R G M L K+  K     RRP GV+V+++T+++   +D E        +QI ++                 +I  +E L +   K+I    +N +     ++++L    P D++          DR+  +   +G  +   P    + RN +Y+ L H E DK +KK+  N EV +S+ D +G    K + P   + G  EY SV+YY   +P W E + + +  E+ ++     HIRF   HRS     D+S+   GVA++KL   D   +      D  H L +YK D +K++ A++    P    E E + EL + KN        ++  T  K   KD+  + T++CST+ T +  L  + N     Q I H L      +  +D  E+ KF    L++  +++ + +D       + + L  +   I ++      P  E  + K    T+ +    ++    + N  +S         L+A  +  +  ++S   Y R   G   +   FN   +S   +        D+P+  ++ ++ A L     IIN +  V  P+ ++ L    ++S  D   N      +NCM     S LF  S+CR ++LP  T  +    +   NK  +E      QLL NI
Sbjct:   12 YGVAIYNYNASQDVELSLQIGDTVHILEMYEGWYRGYTLQNKSKKGIFPETYIHLKEATVEDLGQHETVIPGELPLVQELTSTLREWAVIWRKLYVNNKLTLFRQLQQMTYSLIEWRSQILSGTLPKDELAELKKK-VTAKIDHGNRMLGLDLVVRDDNGNILDPDETSTIALFKAH--EVASKRIEEKIQEEKSILQNLDLRGQSIFSTIHTYGLYVNFKNFVCNIGEDAE----LFMALY--DPDQSTFISENYLIRWGSNGMPKEIEKLNNLQAVFTDLSSMDLIRPRVSLVCQIVRVGHMEL-KEGKKHTCGLRRPFGVAVMDITDIIHGKVDDEEKQHFIPFQQIAMETYIRQRQLIMSPLITSHVIGENEPLTSVLNKVIAAKEVNHKGQGLWVSLKL---LPGDLTQVQKNFSHLVDRSTAIARKMGFPEIILPG---DVRNDIYVTLIHGEFDKGKKKTPKNVEVTMSVHDEEGKLLEKAIHPGAGYEGISEYKSVVYYQVKQPCWYETVKVSIAIEEVTR----CHIRFTFRHRSSQETRDKSERAFGVAFVKLMNPDGTTL-----QDGRHDLVVYKGDNKKMEDAKFYLTLPGTKMEME-EKELQASKN--------LVTFTPSKDSTKDSFQIATLICSTKLTQNVDLLGLLNWRSNSQNIKHNLKK----LMEVDGGEIVKFLQDTLDALFNIMMEMSDSETYDFLVFDALVFIISLIGDIKFQHFNPVLETYIYKHFSATLAYVKLSKVLNFYVANADDSSKTELLFAALKALKYLFRFIIQSRVLYLR-FYGQSKDGDEFN---NSIRQLFLAFNMLMDRPLEEAVKIKGAALKYLPSIINDVKLVFDPVELSVLFCKFIQSIPD---NQLVRQKLNCMTKIVESTLFRQSECREVLLPLLTDQLSGQLDDNSNKPDHEA---SSQLLSNI 909          

HSP 2 Score: 134.42 bits (337), Expect = 8.138e-30
Identity = 126/463 (27.21%), Postives = 201/463 (43.41%), Query Frame = 1
Query: 3355 GDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENK--------KTELITQIDQAMESAYSN-------------YCEEMTKAFKQVLSSNTKYAF-DSQLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYT-TVERKYPEPEDFASADKKIFYM---PVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIE 4644
            GD+R     +I+++W +L   K +F  +      ++T     ++R   +   FD++  +            + ELIT++DQ +E    +             +C    +  K + SS   +A   S L+EN++     I      + D S  N M    N+  FY E  R DI  RYL+KL  +H   +NY+E   TLL  +   QWS +      L  +      + ++K KL +E + YF+K   WEK I++ KEL + Y     D+  L  +  K +   + I+   RP+   + + Y G+GFP F+ +   K  + R K      + S+ L +QF     +    P  ED  S+ K+  YM    VKP     P  Y+ K V ++IL YY   E+++F Y R     E+DP        I+          P IL    VK I    I P + A+  +E
Sbjct: 1077 GDMRKEIGFRIRDMWYNLGPHKIKFIPSMVGPILEVTLTPEVELRKATIPIFFDMMQCEFNFSGNGNFHMFENELITKLDQEVEGGRGDEQYKVLLEKLLLEHC----RKHKYLSSSGEVFALLVSSLLENLLDYRTII------MQDESKENRMSCTVNVLNFYKEKKREDIYIRYLYKLRDLHRDCENYTEAAYTLLLHAELLQWSDKPCVPHLLQKDSYYVYTQQELKEKLYQEIISYFDKGKMWEKAIKLSKELAETYESKVFDYEGLGNLLKKRASFYENIIKAMRPQPEYFAVGYYGQGFPSFLRN---KIFIYRGKEYERREDFSLRLLTQFPNAEKMTSTTPPGEDIKSSPKQ--YMQCFTVKPV-MSLPPSYKDKPVPEQILNYYRANEVQQFRYSRPFRKGEKDPDNEFATMWIERTTYTTAYTFPGILKWFEVKQISTEEISPLENAIETME 1523          
BLAST of dedicator of cytokinesis protein 5 vs. TrEMBL
Match: A0A087Y9F9 (Dedicator of cytokinesis 5 OS=Poecilia formosa OX=48698 PE=3 SV=2)

HSP 1 Score: 291.197 bits (744), Expect = 2.788e-75
Identity = 378/1664 (22.72%), Postives = 674/1664 (40.50%), Query Frame = 1
Query:   64 FAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIK--------------ILSNDI--YPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERRYDSNIEKSKMIESN----RRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQ--------REYESSRRVSKLS---DSTIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAI--IMKDIQYGK--SQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSE--------KQIGIQ-----------------LITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDIS----------DRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGN---KVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVI--CIPLFEKFSKFPPHTHIRFIIWHRSLND---RSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTMHFDVHKQIFRELINNKPESDS------NILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPI-----LRSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNC--MNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLH-----RPLMVLVSVIITFLSYISDKLWEFI-----VRKQKDDCQFCEA----RRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDR--------ENKKTELITQIDQAMESAYSNYCEEMTKAFKQVLSSNTK---YAFDSQLVENIIVQMNNIEECSHHL--NDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNKRN--VSEMSIDLNSQFEYTTVERKYPEPED--FASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIE 4644
            + +AIYNY P   Q + L+ GD + I E   GWYRG+   +     +FP S+I               I+S D+    E+ A +  W+   +  ++    T F  +    Q+A S   Y S I    + + +    ++ +  K+D   + LGL    R+E G  +D +  S + L+  H+        R  E   R+  L     +    V  Y  L+N+      + ++  ++ ++LY  +  +   ISE +  R        ++ + N +  +  D+       Q++FLV   IR G M L K+  K+    RRP GV+V+++T+V    +D E        +QI ++                 +I  +E L     K+I    +N +     + ++L    P D++          DR+  +   +G  +   P    N RN +Y+ L   E D+ +KK+  N EV +S+ D +GN   K + P   + G  EY SVIYY   +P W E +   IP+ E   +     H+R +  HRS  D   +S+ P G+AY+KL   D   +      D  H L +YK+D++K   A+     P    + E    +   P     ++  T      KD+  + T+ CST+ T +  L  + N     Q +   L      +  ++  E+ KF    L++  +++ + ++       + + L  +   I ++      P  E  + K    T+ +    ++    + + PE  S        L+A  +  +  V+S     R    + D  +  N +   +L       +  D+P+     ++  +L+    IIN +  V  P+ ++ L++  ++S  D    ++ +L   C  + S LF    CR ++LP        L N QL+                         QL + S   S P+      YE         +CV ++ST ++ L R +     +H       L+  V+  +  +   S  +  ++     + KQ DD  +       +   D  D +ME F +  +L M  VFP+                                     WM M  VQ + FL  + Q  +++ K                   F  P    + +L  +      + +T   L LE        +++       GD+R     +I+++W ++   K +F  +      ++T +   ++R   +   FD++  +         E  + ELIT++DQ +E    +  E+     +++L  + +   Y   S     +++        ++    +D SP + M    N+  FY E  R DI  RYL+KL  +H   +NY+E   TLL  +   +WS +      +P + E    + ++K +L +E + Y +K   WEK IE+ K+L K +  +  DF++LS +  K ++  ++IM   RP+   + + Y G GFP F+ +   K  + R K    + + S+ L SQF           P D    S  + I    VKP     P +++ K V ++IL YY + E+++F Y R     E+DP        I+    +     P IL    VKS+    I P   A+  +E
Sbjct:   12 YGVAIYNYDPHGEQELRLQVGDTVHILEKLEGWYRGYTLRKKAQKGIFPASYIHLKEATVEGTGQQEIIISADLPLVQEMGATLREWVQIWQKLFVANKITLFRSVQ---QMAYSLIEYRSQIVSGTLPKDDLVELKKKVTAKIDYGNRILGLDLVVRDEAGNMLDPDQTSTVSLFQAHETASRSVDDRLQEEKTRLQNLEMRRQTLFSSVHTYSLLMNLKNFVCNIGEDA-ELLMSLYDPDQSEF--ISENFLVRWDSMGMPKEIEKLNNLPALFTDLSSSDLMRQRLFLVCQIIRVGSMEL-KEGKKQTGGLRRPFGVAVMDITDVAHGKIDDEDKQHFIPFQQIAMETYIRQRQIIMSPLIPSRVIGENEPLTAVFNKVIATREVNHKGQGLFVTLKL---LPGDLAQVRKDFPHLVDRSTAIVRKMGFPEIILPG---NVRNDIYVTLLQGEFDRGKKKTPKNVEVILSVHDDEGNPMEKAIFPGAGYDGITEYKSVIYYQVKQPCWNETVKVTIPI-EDVCR----CHLRVMFRHRSSQDSRDKSEKPFGMAYVKLMRGDGTTL-----KDGRHELFVYKVDVKKADDAKVYLSLPATSAEVEQIQRQTGKPFHHSGVIPVT------KDSFQIATLTCSTKLTQNVDLLGLLNWRSNSQDLDQILQR----LMEVEGGEIVKFLQDTLDALFNIMMETSEKDTYDTLVFDALVFIITLIGDIKFQHFNPVLETYISKHFSATLAYRKLTKVLNYYVGH-PEEPSLTERLYTALKALKYLFRFIVQSRVLSFRFPENSEDPGAFSNSIRLLFL----SFNTLMDRPLDEGVKIKGAILKYLPSIINDIQTVFDPVELSVLLSKFIESIPD-SQFVRQKLGCMCKIIESDLFKQPDCRDVLLP--------LVNDQLSG------------------------QLDDHS---SKPD------YE---------ACVQLLSTVLDTLDRKDVGPTRVHIQQIMERLLRRVNRTVISMDRASPLIGHYLACMTAILKQMDDTHYTHYISTFKTRQDIIDFLMETFIMFKDL-MGNVFPA------------------------------------DWMVMNLVQMQVFLRAINQYSDVLNK------------------LFLDPVH-FELQLWNNYFHLTVAFLTHKTLQLESFSQEKRTKILNKY----GDMRKDMGFRIRDMWYNIGPHKMKFIPSMVGPILEVTLVPEPELRKDTIPIFFDMMQCEHNFSPARTFETFENELITKLDQEVEGGRGD--EQYKVLLEKILLEHCRRHRYLSHSGEELALLLSSLLENLLAYRTITHDESPEHRMSCTVNVLNFYKEKKREDIYIRYLYKLRDLHLDCENYTEAAYTLLLHAELLEWSDKPCAPHLIPRDGEHVWTQQELKERLFQEIICYLDKGKMWEKAIELGKQLAKMHEIHMFDFMELSELLKKQAKFYEQIMHAMRPQPEYFAVGYYGLGFPSFLRN---KMFIYRGKEYEWLEDFSLKLLSQFPNAVRMTSTAPPGDDICNSPGQHIQCFTVKPV-LTVPQRFKDKGVPEQILNYYRHNEVDQFQYSRPFRKGEKDPDNEFATMWIERTTYITAYHFPGILKWFEVKSVSVEEISPLMNAIETME 1520          
BLAST of dedicator of cytokinesis protein 5 vs. TrEMBL
Match: A0A3P9Q922 (Dedicator of cytokinesis 5 OS=Poecilia reticulata OX=8081 PE=3 SV=1)

HSP 1 Score: 290.426 bits (742), Expect = 3.913e-75
Identity = 383/1664 (23.02%), Postives = 675/1664 (40.56%), Query Frame = 1
Query:   64 FAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIK--------------ILSNDI--YPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERRYDSNIEKSKMIESN----RRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQ--------REYESSRRVSKLS---DSTIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAI--IMKDIQYGK--SQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSE--------KQIGIQ-----------------LITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDIS----------DRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGN---KVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVI--CIPLFEKFSKFPPHTHIRFIIWHRSLND---RSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTMHFDVHKQIFRELINNKPESDS------NILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPI-----LRSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNC--MNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLH------RPLMVLVSVIIT----FLSYISDKLWEFIVRKQKDDCQFCEA----RRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDR--------ENKKTELITQIDQAMESAYSNYCEEMTKAFKQVLSSNTK---YAFDSQLVENIIVQMNNIEECSHHL--NDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNKRN--VSEMSIDLNSQFEYTTVERKYPEPED--FASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIE 4644
            F +AIYNY P   Q + L+ GD + I E   GWYRG+   +     +FP S+I               I+  D+    E+ A +  W+   +  ++    T F  +    Q+A S   Y S I    + + +    ++ +  K+D   + LGL    R+E G  +D +  S + L+  H+        R  E   R+  L     +    V  Y  L+N+      + ++  ++ ++LY  +  +   ISE +  R        ++ + N +  +  D+       Q++FLV   IR G M L K+  K+    RRP GV+V+++T+V    +D E        +QI ++                 +I  +E L     K+I    +N +     + ++L    P D++          DR+  +   +G  +   P    N RN +Y+ L   E D+ +KK+  N EV +S+ D +GN   K + P   + G  EY SVIYY   +P W E +   IP+ E   +     H+R +  HRS  D   +S+ P G+AY+KL   D   +      D  H L +YK+D++K   A+     P    + E    +   P     ++  T      KD+  + T+ CST+ T +  L  + N     Q +   L      +  ++  E+ KF    L++  +++ + ++       + + L  +   I ++      P  E  + K    T+ +    ++    + + PE  S        L+A  +  +  V+S     R    + D  +  N +   +L       +  D+P+     ++  +L+    IIN +  V  P+ ++ L++  ++S  D    ++ +L   C  + S LF    CR ++LP        L N QL+                         QL + S   S P+      YE         +CV ++ST ++ L R +     +H      R L  +   +IT    F+ +    +   +  KQ DD  +       +   D  D +ME F +  +L M  VFP+                                     WM M  VQ + FL  + Q  +++ K                   F  P    + +L  +      + +T   L LE    S +L      +   GD+R     +I+++W ++   K +F  +      ++T +   ++R   +   FD++  +         E  + ELIT++DQ +E    +  E+     +++L  + +   Y + S     +++        ++    +D SP + M    N+  FY E  R DI  RYL+KL  +H   +NY+E   TLL  +   +WS +      +P + E    + ++K KL +E + Y +K   WEK IE+ K+L K +  +  DF++LS +  K ++  ++IM   RP+   + + Y G GFP F+ +   K  + R K    + + S+ L SQF           P D    S  + I    VKP     P +++ K V ++IL YY + E+++F Y R     E+DP        I+    +     P IL    VKS+    I P   A+  +E
Sbjct:    7 FPLAIYNYDPHGKQELRLQVGDTVHILEKLEGWYRGYTLRKKAQKGIFPASYIHLKEATVEGTGQQEIIIPADLPLVQEIGATLREWVQIWQKLFVTNKITLFRSVQ---QMAYSLIEYRSQIVSGTLPKDDLVELKKKVTAKIDYGNRILGLDLVVRDEAGNTLDPDRTSTVSLFQAHETASRSVDDRIQEEKTRLQNLEMRRQTLFSSVHTYSLLMNLKNFVCNIGEDA-ELLMSLYDPDQSEF--ISENFLVRWDSTGMPKEIEKLNNLPALFTDLSSSDLMRQRLFLVCQIIRVGSMEL-KEGKKQTGGLRRPFGVAVMDITDVAHGKIDDEDKQHFIPFQQIAMETYIRQRQIIMSPLIPSRVIGENEPLTAVFNKVIATREVNHKGQGLFVTLKL---LPGDLAQVRKDFPHLVDRSTAIVRKMGFPEIILPG---NVRNDIYVTLLQGEFDRGKKKTPKNVEVILSVHDDEGNPMEKAIFPGAGYDGITEYKSVIYYQVKQPCWNETVKVTIPI-EDVCR----CHLRVMFRHRSSQDSRDKSEKPFGMAYVKLMRGDGTTL-----KDGRHELFVYKVDVKKADDAKVYLSLPATSAEVEQIQRQTGKPFHHSGVIPVT------KDSFQIATLTCSTKLTQNVDLLGLLNWRSNSQDLDQILQR----LMEVEGGEIVKFLQDTLDALFNIMMETSEKDTYDTLVFDALVFIITLIGDIKFQHFNPVLETYISKHFSATLAYRKLTKVLNYYVGH-PEERSLTERLYTALKALKYLFRFIVQSRVLSFRFPENSEDPGAFSNSIRLLFL----SFNTLMDRPLDEGVKIKGAILKYLPTIINDIQTVFDPVELSVLLSKFIESIPD-SQFVRQKLGCMCKIIESDLFKQPDCRDVLLP--------LVNDQLSG------------------------QLDDHS---SKPD------YE---------ACVQLLSTVLDTLDRKDVGPTRVHIQQIMERLLRRVNRTVITRRGPFVGHYLACMTAIL--KQMDDTHYTHYISTFKTRQDIIDFLMETFIMFKDL-MGNVFPA------------------------------------DWMVMNLVQMQVFLRAINQYSDVLNK------------------LFLDPVH-FELQLWNNYFHLTVAFLTHKTLQLE----SFSLEKRTKILNKYGDMRKDMGFRIRDMWYNIGPHKMKFIPSMVGPILEVTLVPEPELRKDTIPIFFDMMQCEHNFSSARTFETFENELITKLDQEVEGGRGD--EQYKVLLEKILLEHCRRHRYLYHSGEELALLLSSLLENLLAYRTITHDESPEHRMSCTVNVLNFYKEKKREDIYIRYLYKLRDLHLDCENYTEAAYTLLLHAELLEWSDKACAPHLIPRDGEHVCTQQELKEKLFQEIICYLDKGKMWEKAIELGKQLAKMHEIHMFDFMELSELLKKQAKFYEQIMHAMRPQPEYFAVGYYGLGFPSFLRN---KMFIYRGKEFEWLEDFSLKLLSQFPNAVRMTSTAPPGDNICNSPGQHIQCFTVKPV-LTVPQRFKDKGVPEQILNYYRHNEVDQFQYSRPFRKGEKDPDNEFATMWIERTTYITAYCFPGILKWFEVKSVSVEEISPLTNAIETME 1513          
BLAST of dedicator of cytokinesis protein 5 vs. TrEMBL
Match: A0A096MDE6 (Dedicator of cytokinesis 5 OS=Poecilia formosa OX=48698 PE=3 SV=1)

HSP 1 Score: 289.271 bits (739), Expect = 1.004e-74
Identity = 380/1666 (22.81%), Postives = 677/1666 (40.64%), Query Frame = 1
Query:   70 IAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIK--------------ILSNDI--YPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERRYDSNIEKSKMIESN----RRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQ--------REYESSRRVSKLS---DSTIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAI--IMKDIQYGK--SQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSE--------KQIGIQ-----------------LITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDIS----------DRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGN---KVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVI--CIPLFEKFSKFPPHTHIRFIIWHRSLND---RSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKL----LANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTMHFDVHKQIFRELINNKPESDS------NILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPI-----LRSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNC--MNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLH-----RPLMVLVSVIITFLSYISDKLWEFI-----VRKQKDDCQFCEA----RRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDR--------ENKKTELITQIDQAMESAYSNYCEEMTKAFKQVLSSNTK---YAFDSQLVENIIVQMNNIEECSHHL--NDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNKRN--VSEMSIDLNSQFEYTTVERKYPEPED--FASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIE 4644
            +AIYNY P   Q + L+ GD + I E   GWYRG+   +     +FP S+I               I+S D+    E+ A +  W+   +  ++    T F  +    Q+A S   Y S I    + + +    ++ +  K+D   + LGL    R+E G  +D +  S + L+  H+        R  E   R+  L     +    V  Y  L+N+      + ++  ++ ++LY  +  +   ISE +  R        ++ + N +  +  D+       Q++FLV   IR G M L K+  K+    RRP GV+V+++T+V    +D E        +QI ++                 +I  +E L     K+I    +N +     + ++L    P D++          DR+  +   +G  +   P    N RN +Y+ L   E D+ +KK+  N EV +S+ D +GN   K + P   + G  EY SVIYY   +P W E +   IP+ E   +     H+R +  HRS  D   +S+ P G+AY+KL   D   +      D  H L +YK+D++K   A+     P    + E    +   P     ++  T      KD+  + T+ CST+ T + +    L N  + S +   IL +L         ++  E+ KF    L++  +++ + ++       + + L  +   I ++      P  E  + K    T+ +    ++    + + PE  S        L+A  +  +  V+S     R    N ++   F   ++S   +     +  D+P+     ++  +L+    IIN +  V  P+ ++ L++  ++S  D    ++ +L   C  + S LF    CR ++LP        L N QL+                         QL + S   S P+      YE         +CV ++ST ++ L R +     +H       L+  V+  +  +   S  +  ++     + KQ DD  +       +   D  D +ME F +  +L M  VFP+                                     WM M  VQ + FL  + Q  +++ K                   F  P    + +L  +      + +T   L LE        +++       GD+R     +I+++W ++   K +F  +      ++T +   ++R   +   FD++  +         E  + ELIT++DQ +E    +  E+     +++L  + +   Y   S     +++        ++    +D SP + M    N+  FY E  R DI  RYL+KL  +H   +NY+E   TLL  +   +WS +      +P + E    + ++K +L +E + Y +K   WEK IE+ K+L K +  +  DF++LS +  K ++  ++IM   RP+   + + Y G GFP F+ +   K  + R K    + + S+ L SQF           P D    S  + I    VKP     P +++ K V ++IL YY + E+++F Y R     E+DP        I+    +     P IL    VKS+    I P   A+  +E
Sbjct:   12 LAIYNYDPHGEQELRLQVGDTVHILEKLEGWYRGYTLRKKAQKGIFPASYIHLKEATVEGTGQQEIIISADLPLVQEMGATLREWVQIWQKLFVANKITLFRSVQ---QMAYSLIEYRSQIVSGTLPKDDLVELKKKVTAKIDYGNRILGLDLVVRDEAGNMLDPDQTSTVSLFQAHETASRSVDDRLQEEKTRLQNLEMRRQTLFSSVHTYSLLMNLKNFVCNIGEDA-ELLMSLYDPDQSEF--ISENFLVRWDSMGMPKEIEKLNNLPALFTDLSSSDLMRQRLFLVCQIIRVGSMEL-KEGKKQTGGLRRPFGVAVMDITDVAHGKIDDEDKQHFIPFQQIAMETYIRQRQIIMSPLIPSRVIGENEPLTAVFNKVIATREVNHKGQGLFVTLKL---LPGDLAQVRKDFPHLVDRSTAIVRKMGFPEIILPG---NVRNDIYVTLLQGEFDRGKKKTPKNVEVILSVHDDEGNPMEKAIFPGAGYDGITEYKSVIYYQVKQPCWNETVKVTIPI-EDVCR----CHLRVMFRHRSSQDSRDKSEKPFGMAYVKLMRGDGTTL-----KDGRHELFVYKVDVKKADDAKVYLSLPATSAEVEQIQRQTGKPFHHSGVIPVT------KDSFQIATLTCSTKLTQNVVDLLGLLNWRSNSQDLDQILQRL-------MEVEGGEIVKFLQDTLDALFNIMMETSEKDTYDTLVFDALVFIITLIGDIKFQHFNPVLETYISKHFSATLAYRKLTKVLNYYVGH-PEEPSLTERLYTALKALKYLFRFIVQSRVLSFRRFPENSEDPGAF---SNSIRLLFLSFNTLMDRPLDEGVKIKGAILKYLPSIINDIQTVFDPVELSVLLSKFIESIPD-SQFVRQKLGCMCKIIESDLFKQPDCRDVLLP--------LVNDQLSG------------------------QLDDHS---SKPD------YE---------ACVQLLSTVLDTLDRKDVGPTRVHIQQIMERLLRRVNRTVISMDRASPLIGHYLACMTAILKQMDDTHYTHYISTFKTRQDIIDFLMETFIMFKDL-MGNVFPA------------------------------------DWMVMNLVQMQVFLRAINQYSDVLNK------------------LFLDPVH-FELQLWNNYFHLTVAFLTHKTLQLESFSQEKRTKILNKY----GDMRKDMGFRIRDMWYNIGPHKMKFIPSMVGPILEVTLVPEPELRKDTIPIFFDMMQCEHNFSPARTFETFENELITKLDQEVEGGRGD--EQYKVLLEKILLEHCRRHRYLSHSGEELALLLSSLLENLLAYRTITHDESPEHRMSCTVNVLNFYKEKKREDIYIRYLYKLRDLHLDCENYTEAAYTLLLHAELLEWSDKPCAPHLIPRDGEHVWTQQELKERLFQEIICYLDKGKMWEKAIELGKQLAKMHEIHMFDFMELSELLKKQAKFYEQIMHAMRPQPEYFAVGYYGLGFPSFLRN---KMFIYRGKEYEWLEDFSLKLLSQFPNAVRMTSTAPPGDDICNSPGQHIQCFTVKPV-LTVPQRFKDKGVPEQILNYYRHNEVDQFQYSRPFRKGEKDPDNEFATMWIERTTYITAYHFPGILKWFEVKSVSVEEISPLMNAIETME 1520          
BLAST of dedicator of cytokinesis protein 5 vs. TrEMBL
Match: A0A3B4XQB9 (Dedicator of cytokinesis 5 OS=Seriola lalandi dorsalis OX=1841481 PE=3 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 1.603e-74
Identity = 388/1662 (23.35%), Postives = 690/1662 (41.52%), Query Frame = 1
Query:   73 AIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIK--------------ILSNDI--YPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERRYDSNIEKSKMIESN----RRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQ--------REYESSRRVSKLS---DSTIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAI--IMKDIQYGK--SQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSE--------KQIGIQ-----------------LITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDIS----------DRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGN---KVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVI--CIPLFEKFSKFPPHTHIRFIIWHRSLND---RSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAE-YLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICN--QSLED-QTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATD-DSY--LGKNILELLGEMFKAIKNL---PDSENQLDKFIQDTMHFDVHKQIFRELINNKPESDSN-----ILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPI-----LRSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNC--MNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQ-----DQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEA----RRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXX--XXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDR--------ENKKTELITQIDQAMESAYSNYCEEMTKAF--KQVLSSNTKYAFDSQLVENIIVQMNNIEECSHH----LNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNKRN--VSEMSIDLNSQFEYTTVERKYPEPED--FASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIE 4644
            AIYNY P+  Q + L+ GD + I E   GWYRG+   +     +FP S+I               I+  D+    EL A +  W       +++  TT F  +    Q+A S   Y S I    + + +    ++ +  K+D   + LGL    R+E G  +D +  S + L+  H+        R  E   R+  L     +    V  Y  L+N+      + ++  ++ ++LY  +  +   ISE +  R        ++ + N +  +  D+       Q++FLV   IR G M L K+  K     RRP GV+V+++T+      D E        +QI ++                 +I  +E L     K+I    +N +     +++ L    P D++          DR+  +   +G  +   P    N RN +Y+ L   E D+ +KK+  N EV +++ D +GN   K + P   + G  EY SVIYY   +P W E +   IP+ E   +    +H+R +  HRS  D   +S+ P G+A+++L   D   +      D  H L +YK+DM+K + A+ YLT    ++       ++ +     +Q  +S    V  KD+  + T+ CST+ T +  L  + N   + ED   IL +L         ++  E+ KF    L++  +++   ++ D+Y  L  N L  +  +   IK     P  E  ++K    T+ +     +    + +  E          L+A  +  +  V+S   Y R    + D  + FN +   +L       +  D+P+     ++  +L+    IIN +  V  P+ ++ L+   ++S  D    ++ +L   C  + S LF    CR ++LP  T  +    + QL+   ++ + +        +LDN+  + +   + H                 +LI+E  + R    ++S     + RS S   L+   L  + +++                 KQ DD  +       +   D  D +ME F +  +L M  +FP+                                     WMNM  VQ + FL  + Q ++ +L  Y+L                    ++  FEL +  +      + +T   L LE        +++       GD+R +   +I+++W +L   K +F         ++T +   ++R   +   FD++  +         E  + ELIT++DQ +E    +   E  K    K +L    ++ + SQ  E + + ++++ E         +D SP + M    N+  FY E  R DI  RYL+KL  +H   +NY+E   TLL  +   +WS +      +P + +    + ++K +L +E + Y +K   WEK IE+ K+L K +  +  DF++LS +  K ++  + IM   RP+   + + Y G GFP F+ +   K  + R K    + + S+ L SQF           P D   +S  + I    VKP     P +++ K V ++IL YY   E+++F Y R     E+DP        I+    +   + P IL    VKS+    I P + A+  +E
Sbjct:   12 AIYNYDPSGEQELCLQVGDTVHILEKLEGWYRGYTLRKKSHKGIFPSSYIHLKEATVEGIGQQEIIIPADLPLVQELGATLREWAQIWHKLFVVNKTTLFRSVQ---QMAYSLIEYRSQIVSGTLPKDDLVELKKKVTAKIDYGNRILGLDLVVRDEAGNTLDPDWTSTVSLFRAHETASRSVDDRIQEEKTRLQNLEMRRQTLFSTVHTYSLLMNLKNFVCNIGEDA-ELLMSLYDPDQSEF--ISENFLVRWDSMGMPKEIEKLNNLPALFTDLSSSDLMRQRLFLVCQIIRVGSMEL-KEGKKHTGGLRRPFGVAVMDITDTAHGKTDDEDKQHFIPFQQIAMETYIRQRQLIMSPLMPSRVIGENEPLTAVFNKVIATREVNHKGQGCMLSVSL---LPGDLAQVRKDYPHFVDRSTAIVRKMGFPEIILPG---NVRNDIYITLLQGEFDRGKKKTPKNVEVILTVHDDEGNPMEKAIFPGAGYDGITEYKSVIYYQVKQPCWNETVKVTIPI-EDVCR----SHLRVMFRHRSSQDSRDKSEKPFGMAFVRLMRGDGTTL-----KDGRHELIVYKVDMKKAEDAKVYLTLPATWD------EVEEKEKQTGKQFHHSGLIPVT-KDSFQIATLTCSTKLTQNVDLLGLLNWRSNPEDLDQILQRL-------MEVEGGEIVKFLQDTLDALFNIMMDTSEKDTYDTLVFNALVFIITLIGDIKFQHFNPVLETYINKHFSATLAYMKLTGVLNYYVGHAEEPILTERLYVALKALKYLFRFIVQSRVLYLRFYGNSEDGDAFFNSIRTLFL----SFNTLMDRPLDEGVKIKGAILKYLPSIINDIQTVFDPVELSILLAKFIESIPD-SQLVRQKLGCMCKMVESDLFRQPDCRDVLLPLVTDQL----SGQLDDHSSKPDHEACVQLLSTVLDNLDRKDVGPTRGH----------------VQLIMERLLRRVNRTVIS-----MDRSSS---LIGHYLACMTAIL-----------------KQMDDMHYAHYISTFKTRQDIIDFLMETFIMFKDL-MGNIFPA------------------------------------DWMNMNLVQMQVFLRAINQ-YSDVLNMYFL--------------------DQAHFELQLWNNYFHLTVAFLTHKTLQLESFSQEKRNKILNKY----GDMRKTIGFKIRDMWYNLGPHKMKFIPAMVGPMLEVTLVPQPELRKATIPIFFDMMQCEHNFSPGRTFETFENELITKLDQEVEGGRGD---EQYKVLLEKTLLEHCRRHRYLSQSGEELALLLSSLLENLLAYRTITHDESPEHRMSCTVNVLNFYKEKKREDIYIRYLYKLRDLHLDCENYTEAAYTLLLHAELLEWSDKTCAPHLIPRDGQHVWTQQELKERLFQEIICYLDKGKMWEKAIELGKQLAKMHESHMFDFMELSQLLKKQAQFYENIMHAMRPQPEYFAVGYYGLGFPSFLRN---KMFIYRGKEYEWLEDFSLKLLSQFPNAVRMTSTAAPGDDISSSPGQHIQCFTVKPV-LTVPRQFKDKGVPEQILNYYRTNEMDQFQYSRPFRKGEKDPDNEFATMWIERTTYITAYRFPGILKWFEVKSVSVEEISPLENAVETME 1517          
BLAST of dedicator of cytokinesis protein 5 vs. TrEMBL
Match: M3ZNG4 (Dedicator of cytokinesis 5 OS=Xiphophorus maculatus OX=8083 PE=3 SV=2)

HSP 1 Score: 283.878 bits (725), Expect = 3.910e-73
Identity = 377/1662 (22.68%), Postives = 672/1662 (40.43%), Query Frame = 1
Query:   70 IAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIK--------------ILSNDI--YPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERRYDSNIEKSKMIESN----RRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQ--------REYESSRRVSKLS---DSTIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAI--IMKDIQYGK--SQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSE--------KQIGIQ-----------------LITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDIS----------DRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGN---KVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVI--CIPLFEKFSKFPPHTHIRFIIWHRSLND---RSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTMHFDVHKQIFRELINNKPESDS------NILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPI-----LRSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNC--MNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLH-----RPLMVLVSVIITFLSYISDKLWEFI-----VRKQKDDCQFCEA----RRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKT--------ELITQIDQAMESAYSNYCEEMTKAFKQVLSSNTK---YAFDSQLVENIIVQMNNIEECSHHL--NDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNKRN--VSEMSIDLNSQFEYTTVERKYPEPED--FASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIE 4644
            +AIYNY P   Q + L+ GD + I E   GWYRG+   +  I   FP S+I               I+  D+    E+ A +  W+   +  ++    T F  +    Q+A S   Y S I    + + +    ++ +  K+D   + LGL    R+E G  +D +  S + L+  H+        R  E   R+  L     +    V  Y  L+N+      + ++  ++ ++LY  +  +   ISE +  R        ++ + N +  +  D+       Q++FLV   IR G M L K+  K+    RRP GV+V+++T+V    +D E        +QI ++                 +I  +E L     K+I    +N +     + ++L    P D++          DR+  +   +G  +   P    N RN +Y+ L   E D+ +KK+  N EV +S+ D +GN   K + P   + G  EY SVIYY   +P W E +   IP+ E   +     H+R +  HRS  D   +S+ P G+AY+KL   D   +      D  H L +YK D++K   A+     P      E    +   P     ++  T      KD+  + T+ CST+ T +  L  + N     Q ++  L      +  ++  E+ KF    L++  +++ + ++       + + L  +   I ++      P  E  + K    T+ +     +    + + PE  S        L+A  +  +  V+S     R    + D  +  N +   +L       +  D+P+     ++  +L+    IIN +  V  P+ ++ L++  ++S  D    ++ +L   C  + S LF    CR ++LP        L N QL+                         QL + S   S P+      YE         +CV ++ST ++ L R +     +H       L+  V+  +  +   S  +  ++     + KQ DD  +       +   D  D +ME F +  +L M  VFP+                                     WM M  VQ + FL  + Q  +++ +                   F  P    + +L  +      + +T   L LE        +++       GD+R S   +I+++W ++   K +F  +      ++T +   ++R   +   FD++  +     +        ELIT++DQ +E    +  E+     +++L  + +   Y   S     +++        ++    +D SP + M    N+  FY E  R DI  RYL+KL  +H   +NY+E   TLL  +   +WS +      +P + E    + ++K +L +E ++Y +K   WEK IE+ K+L K +  +  DF++LS +  K ++  ++IM   RP+   + + Y G GFP F+ +   K  + R K    + + S+ L SQF           P D    S  + I    VKP     P +++ K V ++IL YY + E+++F Y R     E+DP        I+    +   + P IL    VKS+    I P   A+  +E
Sbjct:   12 LAIYNYDPRGEQELRLQVGDTVHILEKLEGWYRGYTLRKKGI---FPASYIHLKEATVEGIGKQEIIIPADLPLVQEIGATLREWVQIWQKLFVANKITLFRSVQ---QMAYSLIEYRSQIVSGTLPKDDLVELKKKVTAKIDYGNRILGLDLVVRDEAGNTLDPDRTSTVSLFQAHETASRSVDDRIQEEKTRLQNLEMRRQTLFSSVHTYSLLMNLKNFVCNIGEDA-ELLMSLYDPDQSEF--ISENFLVRWDSTGMPKEIEKLNNLPALFTDLSSSDLMRQRLFLVCQIIRVGSMEL-KEGKKQTGGLRRPFGVAVMDITDVARGKIDDEDKQHFIPFQQIAMETYIRQRQIIMSPLIPSRVIGENEPLTAVFNKVIATREVNHKGQGLFVTLKL---LPGDLAQVRKDFPHLVDRSAAIVRKMGFPEIILPG---NVRNDIYVTLLQGEFDRGKKKTPKNVEVILSVHDDEGNPMEKAIFPGAGYDGITEYKSVIYYQVKQPCWNETVKVTIPI-EDVCR----CHLRVMFRHRSSQDSRDKSEKPFGMAYVKLMRGDGTTL-----KDGRHELFVYKADVKKADDAKVYLSQPATRAAVEQIQRQTGKPFHHSGVIPVT------KDSFQIATLTCSTKLTQNVDLLGLLNWRSNSQDLVQILQR----LMEVEGGEIVKFLQDTLDALFNIMMETSEKDTYDTLVFDALVFIITLIGDIKFQHFNPVLETYISKHFSATLAYRKLTIVLNYYVGH-PEEPSLTERLYTALKALKYLFRFIVQSRVLSFRFPENSEDPDAFSNSIRLLFL----SFNTLMDRPLDEGVKIKGAILKYLPSIINDIQTVFDPVELSVLLSKFIESIPD-SQFVRQKLGCMCKIIESDLFKQPDCRDVLLP--------LVNDQLSG------------------------QLDDHS---SKPD------YE---------ACVQLLSTVLDTLDRKDVGPTRVHFQQIMERLLRRVNRTVISMDRTSPLIGHYLACMTAILKQMDDKHYTHYISTFKTRQDIIDFLMETFIMFKDL-MGNVFPA------------------------------------DWMVMNLVQMQVFLRAMNQYSDVLNR------------------LFLDPVH-FELQLWNNYFHLTVAFLTHKTLQLESFSQEKRTKILNKY----GDMRKSMGFRIRDMWYNIGPHKMKFIPSMVGPILEVTLVPEPELRKDTIPIFFDMMQCEHNFSSSRTFQMFENELITKLDQEVEGGRGD--EQYKVLLEKILLEHCRRHRYLSQSGEELALLLSSLLENLLAYRTITHDESPEHRMSCTVNVLNFYKEKKREDIYIRYLYKLRDLHLDCENYTEAAYTLLLHAELLEWSDKPCAPHLIPRDGEQVWTQQELKERLFQEIIRYLDKGKMWEKAIELGKQLAKMHEIHMFDFMELSELLKKQAKFYEQIMHAMRPQPEYFAVGYYGLGFPSFLRN---KMFIYRGKEYEWLEDFSLKLLSQFPNAVRMTSTAPPGDDICNSPGQHIQCFTVKPV-LTVPQRFKDKGVPEQILNYYRHNEVDQFQYSRPFRKGEKDPDNEFATMWIERTTYITAYRFPGILKWFEVKSVSVEEISPLMNAIETME 1515          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Cavefish
Match: dock1 (dedicator of cytokinesis 1 [Source:ZFIN;Acc:ZDB-GENE-080108-5])

HSP 1 Score: 224.942 bits (572), Expect = 2.164e-58
Identity = 360/1623 (22.18%), Postives = 660/1623 (40.67%), Query Frame = 1
Query:   64 FAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKILSNDI----------------YPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERR--YDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQ----------REYESSRRVSKLSD----STIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYG----KSQKIFLVFHFIRKGPMCL---TKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQ---IGIQLITRD-ECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDISDRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVI--CIPLFEKFSKFPPHTHIRFIIWHRS---LNDRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFD----KLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTMHFDVHKQIFRELINNKPESDSNILRAT---DWFIKIAVKSF----QNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGLIINALIPVCQPIGMARLVNN-LLKSCSDLDANMKSELTMNCMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSC-VAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCE-----ARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIV----HLDRENKK--TELITQIDQAMESAYSNYCEEMTKAFKQVLSSNT---KYAFDS--QLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYTTVERKYPEP-EDF-ASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIE 4644
            + I IYNY   + + + L+ GD + I E Y     G  Y  P I   FP  +I +    +                  E+   +  W +  RD Y+      F+ + + I   I  R       + + ++ E  ++ +  K+D   K L L    R++ G  +D +  S I L+  H+          +E +S ++   LS     ++    +L++ L NV  +  + A+ ++    +LY   + K   ISE Y  R +      D+ + + +       G    K +KI  V   +R G M L     K +  G+  RRP GV+V++VT+++T  +D E +   I  Q +  + + L++   K+I    +N +     I           + DR+  V   +G  +   P    + RN +Y+ L   + DK  K +  N EV +S+ D  G ++        G  EY SVIYY   +P+W E I   IP+ E  ++    +H+RF   HRS     D+S+    ++++KL   D   +      D  H L +YK + +K++ +      P  + + E    K   P  T + M +     + KD+  + T+VCST+ T +     LL    N SL  Q +          +  ++  E+ KF    L++  +++ + +D       + + L  +   I +       P  E  + K    T+ +    ++ +  +++  +    +L+A    ++  K  V+S     Q YE +  G  D       L  S+  ++   A S    +++   L+    I+N +  V  P  +++L    +LK         K    ++ ++S LF    CR I+LP  T  +     F L         +  + L+  C  +   +++  RS      ++ +  ++  II  K+LR+    ++S G + L                   +I +F++ ++  L      +Q DD  +        +  TD  D +ME F +  +L    V+P                                      W+ M  +Q++ FL  + Q   ++ K +    L Q                  + +L  +      + +TQ  L LE   S    ++         D+R     +I+++W +L   K +F         ++T +   ++R   +   FD++    H  R  ++   E+IT++D  +E    +  E+    F+++LS +    KY   S    V  ++  +  + +    ++D +  N M    N+  FY E+ R ++  RYL+KL  +H++  NY+E   TLL  +   +WS E         +      + Q+K +L +E + YF+K   WE+ I + KEL + Y     DF +LSA+  K ++  + I+   RP+ + + + Y G GFP F+ +   K  + R K      +    L +QF      +    P ED   S+ + I    VKP     P K++ K V ++I+ YY   E+ +F Y R +   E+DP        I+    +   KLP IL      S     + P + A+  ++
Sbjct:   21 YRITIYNYDARSEEELSLQIGDTVHILETY----EGESYLIPGI---FPACYIHLKEATVEGSGPKETVIPTELPLVHEVTTTLREWASIWRDLYVGDKREMFNTVRDMIYDLIEWRSQILSGTLPQDELSELKQK-VTSKIDYGNKVLDLDLVVRDKDGNILDPDLTSTISLFRAHEAASRQIEERIQEEKSQKQNMDLSRQAKFASTPSFALFVTLKNVVCKIGEDAEVLM----SLYDHNESKF--ISENYLVRWSSSGLAKDIDQPHNLRAVFTDLGSEDLKREKISFVCQIVRVGRMELRDNNTKKLTSGL--RRPFGVAVMDVTDIITGKMDDEDKQHFIPFQPVAGESDFLQSVINKVIAAKEVNHKGQGLWIRKDFP-----HLVDRSTAVARKMGFPEIIMPG---DVRNDIYVTLVQGDFDKGSKTTPKNVEVTMSVYDEDGKRLEGD----EGISEYKSVIYYQVKQPRWFETIKVAIPI-EDVNR----SHLRFTFKHRSSQDYKDKSEKIFALSFVKLMRYDGTTL-----RDGEHDLIVYKAEAKKLEDSSLYLNLPATKLEMEE---KGHFP--TGKNMPTLGNCTISKDSFQISTLVCSTKLTQNVDLLGLLKWRSNTSLLQQNLRQ--------LMKVEGGEVVKFLQDTLDALFNIMMENSDSDTFDTLVFDALVFIIGLIADRKFQHFNPVLETYIRKHFSATLAYTKLTKVLKNYVDHPEKLTDQLLKAMKALEYIFKFIVRSRVLFNQLYENK--GEADFMESLRNLFTSFSTMMNSDAESTS--MVKGAALKYVPTIVNDVKMVFDPKELSKLFTEFILKVPPGRLVKQKLYCMIDIVHSDLFSQHDCREILLPLMTDQL----KFHL---------EHHEELEACCQLLSNILEVLYRS------DVGHTQLHVQIIMEKLLRTVNRTVISMGRDSL-------------------LIGSFVASMTATL------RQMDDYHYAHLISTFGKMRTDVVDFLMETFIMFKDLIGKNVYPG------------------------------------DWVIMNTMQNKVFLRAINQYAAVLNKKF----LDQT---------------NFELQLWNNYFHLAVAFLTQESLQLENFSSDKRAKIFHRY----QDMRRQIGFEIRDMWYNLGPHKIKFIPEMVGPILEMTLVPEIELRKATIPIFFDMMQCEFHFTRSFQRFENEIITKLDHEVEGGRGD--EQYKILFQKILSEHCRKHKYLAKSGETFVSLVVRLLERLLDYRTIMHDENKENRMSCTVNVLNFYKEIEREEMYIRYLYKLRDLHKECDNYTEAAYTLLLHAKLLKWSEEACAAHLTQRDGYQAVTQGQLKDQLYQEIINYFDKGKMWEEAIILGKELSEQYENEMFDFEQLSALLRKQAQFYENIVKVIRPKPDYFAVGYYGLGFPSFLRN---KMFIYRGKEYERWEDFVARLLTQFPNAEKMKTTTAPSEDLRMSSGQYIQCFTVKP-MLELPPKFQNKPVSEQIVSYYTINEVNKFQYSRPVRKGEKDPDNEFANMWIERTTYVTAYKLPGILRWFEALSTSTEEVSPLENAIETMQ 1479          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Cavefish
Match: DOCK2 (dedicator of cytokinesis 2 [Source:NCBI gene;Acc:103035845])

HSP 1 Score: 189.119 bits (479), Expect = 1.795e-47
Identity = 349/1631 (21.40%), Postives = 653/1631 (40.04%), Query Frame = 1
Query:   64 FAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIK-------------ILSNDIYP---ELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERRYD--SNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYES--SRRVSKLSDSTIDYV------------SLYIKLLNVN---FERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYGKS----QKIFLVFHFIRKGPMCLTKKTIKEGV-PYRRPKGVSVIEVTNVMTENL--DSEKQIGI---QLITRDECLENNAEKLITDYRINKREYSSTINIQ-----LKTIRPE--DISDRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQG----NKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEV--ICIPLFEKFSKFPPHTHIRFIIWHRSLN---DRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKR-AEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLD-LIQQATDDSYLGKNILELLGEMFKAIKNLPDSENQ-----LDKFIQDTMHFD---VHKQIFREL-----INNKPESDSNILR---ATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGL-IINALIPVCQPIGMARLVNNLL---KSCSDLDANMKSELT--MNCMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSC-VAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENK------KTELITQIDQAMESAYSN--YCEEMTKAFKQVLSSNTKYAFDSQ-LVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYTTVERKYPEPEDFA--SADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEAL 4632
            + +  +N+     + + L  G+ ++I+E   GWY+G+          FP S I+             ++++   P   E+   +  W T  +  ++      F ++ + +   + E R    S        +  ++ +  K+D   K L L    R+  G  +D +  SVI L+  H+    +   R   + S+  +D+             SLY+ + N      E S+L   + D N         K   ISE Y  R   + +  D+   N + +     G      +KI+L+   +R G M L   + K+     RRP GV+V+++++++   +  D EKQ  I    ++T ++ L     K +T  R +       + ++     +  IR E   + DR+ +V   LG  +   P    + RN +YL LH  + DK  K +  N EV + + D +G    N + + + D +   EY SVIYY   +P+W E   + IPL E         H+RF+  HRS     D+S+    +A+++L  +D   +      D  H L ++K D ++++  A YL+   E       ++  ++  T      +     V  +D+  + T+VCST+ T +  L  +       + +   L +    +K ID  E+ KF    L++  + +++ +  D Y   +IL +   +   I  + D + Q     L+ +I+   HF     +K++   L     ++++ E+   ILR   A ++  K  V+S     R +   + E     E  DS   + E + +        +L+ + A L  + A++   + +  A+L++ LL    +C   D   K ++      ++S+LF    CR I+LP   K +    +  + +  ++  R+  +LL+NI   +             S  ++     +   I   +LR    A++  G E            H  +  +V+ +   LS + D+ +   +               +D  D +ME F L  +L    V+PS                                     W+ M+ VQ+R FL  +    + +   +    L  N                 + +L  +      + ITQ  L L+    +   +++       GD+R      I+++W  L + K  F         ++T I   ++R   +   FD++  +  +       + E+I ++D  +E    +  Y E +     +          + +  V  +   +  + +    ++D+S  N M    NL  FY ++ R  +  RYL+KL  +H   +N++E   TLL  S   +WS E   H     + +  + + Q+K  L +  + YF+K   WE+ I +CKEL   Y     D+  L     + ++  + IM   RP+ + + + Y G GFP+F+ +   K  + R K      +    L SQF  +        P D    S  + I    V+P   I P + + K V  +I+ +Y +  +++F Y R +   + DP        I+        KLP IL      S+    + P + A+
Sbjct:   12 YGVVKWNFTGKGEKQLSLVVGETVYIQEASEGWYKGYLTRNKDQKGAFPASFIELKEVIIEKRGDDEVVTSAEMPLVKEVTTTLREWGTIWKQLFMANKKERFKQV-QGLMWDLMEWRSQLLSGTLPGDEFKELKQKVTSKIDYGNKILELDLVVRDVNGNILDPDNASVISLFRAHEDATATINERIKEEQSNVQMDHSGVSARIQSSPTHSLYVFVRNFVCRIGEESELFMSLYDPN---------KQVIISENYLVRWGDKGFPKDVEMLNNLKVVFTDLGNKDLNREKIYLICQIVRVGRMDLKDTSTKKFTNGLRRPFGVAVMDISDIIKGKMECDEEKQHFIPVHPVLTENDFLHTLLNK-VTASRGDSGGQGLWVTMKALVGDIVQIRKEYPHLVDRSTVVARKLGFPEIIMPG---DIRNDIYLTLHSGDFDKYNKTTQKNVEVIMLVCDEEGKIVPNAICLGAGD-QPVHEYRSVIYYQIKQPRWMETFKVAIPLEEM-----QRIHLRFMFRHRSSQESKDKSEKNFAMAFVRLMKEDGTVL-----KDGTHDLVVFKGDSKRMEDVASYLSLPSERS-----HTDVHKGSTLMRNNSSVGGLSVSSRDSFTISTLVCSTKLTQNVGLLGLLKWRTRPELLKSNLQD----LKLIDGEEVVKFLQDTLDALFNIMMEHSQTDDY---DIL-VFDALIYIIGLIADRKFQHFNTVLEAYIK--QHFSATLAYKKLMSVLKTYLDVSSRGEACEPILRTLKALEYIFKFIVRS-----RMLYSQLYEGKEQAEFEDSLKGLFESINNLMKSDYTTTLLQQVAALKYLPAVLQDIETVFDAKLLSKLLFDFYTCIPPDKLQKQKVASMTEIVSSRLFQRKDCRDILLPMMLKELSGALS-GVGEGPHDDRRNSVELLNNILEVL-------------SRKDVGQTFQHIQDIVKSLLRDINRAVIMIGRE------------HSLITRVVACMTAILSQMDDRHYSSYIETFGG---------TSDLVDFLMETFLLFKDLIGKHVYPS------------------------------------DWVTMIMVQNRVFLGAINTYADTMNHKF----LDNN---------------DFEVQLWNNYFHLAVAFITQESLQLQHFSPTKRNKILAKY----GDMRRLIGFAIRDMWYKLGVNKICFIPGMVGPMLEMTLIPEEELRRATIPIFFDMMQCEHNHTGHFRKFENEIILKLDHEVEGGGGDVRYMELLQTILLECAQERPPLLAEVRNFVSLVTGLLERLLDYRTVMSDDSRNNRMSCTVNLLNFYKDINREGMYIRYLYKLRDLHLDGENFTEAAYTLLLHSKLLKWSDE---HCAPQLDIQGPQSQRQLKETLYDTIISYFDKGKMWEEAIALCKELSDQYELEVFDYELLGQNLKQQAKFYENIMKILRPKPDYFAVGYYGSGFPQFLRN---KVFIHRGKEYERREDFQGQLMSQFPSSLRLNTTTMPGDDIKNSPQQYIQCFTVQPVLEI-PPRLKNKPVPDQIINFYKSNYVQKFQYSRPVRKGKVDPDNEFASMWIERTTFNTAYKLPGILRWFEATSMTHTTVSPLENAI 1496          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Cavefish
Match: dock5 (dedicator of cytokinesis 5 [Source:ZFIN;Acc:ZDB-GENE-080108-4])

HSP 1 Score: 141.739 bits (356), Expect = 4.371e-33
Identity = 119/451 (26.39%), Postives = 205/451 (45.45%), Query Frame = 1
Query: 3355 GDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKT--------ELITQIDQAMESAYSNYCEEMTKAFKQVLSSNTKYAFDSQLVENIIVQMNNIEECSHH----LNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNKRN--VSEMSIDLNSQFEYTT--VERKYPEPEDFASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIE 4644
            GD+R S   +++++W +L   K +F         K T +   ++R   +   FD++  +     T        ELIT++DQ +E    +   ++    K +L  + ++ + SQ  E +   + ++ E         +D SP   M    N+  FY E  R DI  RYL+KL  +H   +NY+E   TLL  +   QWS +      +P E      + ++K +L ++ +   +K   WEK IE+ K+L K       DF++LS +  + ++  + IM   RP+   + + Y G+GFP F+ +   K  + R K    + + S+ L SQF           P    F S  + I    VKP   + P++++ K V ++IL YY   E+++F Y R     ++DP        I+    +   + P IL    VKS+    I P + A+  +E
Sbjct: 1024 GDMRKSIGFKLRDVWYNLGPHKMKFIPAMVGPILKATLVPEPELRKATIPIFFDMMQCEHHLSPTHTFQTFEQELITKLDQEVEGGGGDGQYKILLE-KTLLEHSRRHRYLSQSGEALAGLLRSLLENLLAYRTITHDESPELRMSCTVNVLNFYKEKKREDIYIRYLYKLRDLHLDCENYTEAAYTLLLHAELLQWSDKPCAPHLIPFEGTPACTQQELKERLFQDIICCLDKGKMWEKAIEMSKQLAKMQENQMFDFMELSQLLKQQAQFYENIMHAMRPQPEYFAVGYYGQGFPSFLRN---KVFIYRGKEYEWLEDFSLKLLSQFPNAVRMTSTAPPGASVFNSPCQHIQCFTVKPVLHL-PSQFKDKGVPEQILNYYRTNEVDQFQYSRPFRKGQKDPDNEFATMWIERTTYITAYRFPGILKWFEVKSVSVDEISPLENAIETME 1469          

HSP 2 Score: 71.633 bits (174), Expect = 1.015e-11
Identity = 133/627 (21.21%), Postives = 251/627 (40.03%), Query Frame = 1
Query:  823 IFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSE--------KQIGIQLITR-----------------DECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDIS----------DRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPLFEKFSKFPPHTHIRFIIWHRSLNDRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATD----DSYLGKN---ILELLGEM-FKAIKNLPDSENQLDKFIQDTM-HFDVHKQIFRELINNKPESDS----NILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASS----KDKPI-----LRSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELT---MNCM----NSKLFVDSQCRSIILPETTKNI 2499
            +FLV   +R G M L K+  K     RRP GV+V+++T++     D +        +QI ++   R                 +E L     K+I    +N +     + ++L    P D++          DR+  +   +G  +   P    N RN LY+ L   E D+ +KK+  N EV +S+ + +GN +               V  +H  K           +    K   H          S  D+S+ P G+A+++L   D   +      D  H L +YK+D+++ + A+     P    + + Y   +  P        ++    V KD+  + T+ CST+ T +  L  + N     + +   L      +  +D  E+ KF    L++  +++ + ++    DS++      I+ L+G++ F+     P  E  ++K    T+ H  + K +   + + +  + S    + L+   +  +  V+S   Y R   G       + E  D +L+ +  L  S     D+P+     ++  +L+    IIN +  V   + ++ L+   ++S  D      S+L    + CM     S LF    CR ++LP  T  +
Sbjct:  268 LFLVCQIVRVGSMEL-KEGKKHTGGLRRPFGVAVMDITDIAHGKADDDEKQHFIPFQQIAMETYIRQRQLIISPLIPSRVMGENEPLTAVFNKVIATRDVNHKGQGLFVTLKL---LPGDLAQVQKNYPHFVDRSTAIVRKMGFPEIILPG---NVRNDLYVTLLQGEFDRGKKKTPKNVEVVMSVLNEEGNPI--------------EVNKHHKLK--------TAAYSDVQKITTHLQTSCSFLFFSARDKSEKPFGMAFVRLMKSDGTTL-----RDGKHDLIVYKVDIKRAEDAKTYLMLPSSWAEVDDYEKHSGKP------FQNSAPIPVTKDSFQINTLTCSTKLTQNVDLLGLLNWRSHTEQLEKTLQR----LMEVDGGEIVKFLQDTLDALFNIMMETSEKDTYDSFVFNALVFIISLIGDIKFQHFN--PVLETYINKHFSATLAHMKLTKVLNYYVSHAEDPAVSERLYSSLKVFKYLFRFIVQSRVLYLR-FYG-------YREDGDEFLYSIRTLFLSVNTLMDRPLDEAVKIKGAILKYLPTIINDIQQVFDQVELSVLLAKFIESIPD------SQLVRQKLGCMVKIVESDLFKLPACRDVLLPLITDQL 834          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Cavefish
Match: dock4b (dedicator of cytokinesis 4b [Source:ZFIN;Acc:ZDB-GENE-060130-74])

HSP 1 Score: 85.8853 bits (211), Expect = 4.757e-16
Identity = 137/608 (22.53%), Postives = 255/608 (41.94%), Query Frame = 1
Query:  796 DIQYGKSQK-IFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQIGIQLITRD----ECLENNAEKLITDYRINKREYSSTINIQL-----KTIRPE--DISDRNVMV---LGLDPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNKV---VMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPLFEKFSKFPPHTHIRFIIWHRSLNDRS-KNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKV-VLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNLPDSENQLDKFIQDTM---HFDVHKQIFRELIN------------NKPESDSNILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLA--SSKDKPI--LRSLVLRKAGLIINALIPVCQPIGMARLVNNLLKS---CSDLDANMKSELTMNCM----NSKLFVDSQCRSIILP 2481
            D+  G  +K +++V H IR G M   +K     V YRRP G +V+ + +++T +   +  + +     +    +  EN  +K+ + Y ++       + +QL     + +R E   I  R V +   LG         R++ + LY+ L   E DK  K    N EV +   D  G  +   V       G DEY + + YHN  P+W E I +P+     +    +H+RF   H S  D+  K   G +++ L  +D   +      D  H L ++K +    + A    C   Y   P           F++  +    + V   K++ ++ + +CST+ T +  + ++       + I   L      +K ID +E+ KF    L+ +LD +    D+S   ++ L++   +   I  L DS+ +  K + DT    HF      +R+LI                E    +L+AT++  K  V+S + +     GN +E      + + ++ I   L+  S    P+   +++ LR    +   L+ +     +A  V   L S    +  D  +++ + + C+     S+L+ + + R I+LP
Sbjct:  250 DLGSGDLRKDVYIVVHIIRIGRMGAGEKKNTCSVQYRRPYGCAVVSIADLLTADSKDDHLLKVYACNTESDWNQIHENIIKKVNSRYNLSGSNTGLAVALQLLHGDIEQLRREYMAIFTRGVSITRKLGFSDVIMPGERDEEH-LYITLEKGEFDKGGKTVARNVEVTVYALDMDGQILRGHVTAGSGEPGADEYHTFVLYHNNSPRWAEQIKLPIPVDMFR---GSHVRFEFRHCSTKDKGEKKLFGFSFVPLMQEDGRTL-----PDGTHELIVHKCE----ENASLQDC-ARYLKLP-----------FSKANLPGNNQAVKATKESFWITSFLCSTKLTQNGDMLDLLKWRAHPERISDSLSK----LKEIDGSEIVKF----LQDTLDTLFGILDES-AQRHGLKVFDCLVHIINLLQDSKFEHFKPVMDTYIESHF-AGALSYRDLIKVLKWYVDRIIEAEHQEHIQQVLKATEYIFKYIVQSRRLFALAT-GNQNEEEFRCCMHELFMSIRFFLSRKSQGTSPVTHTQAVFLRTFPAVYGELLKLFTVREVATFVRETLGSLPATTQADCPLEA-VKLQCIAKTVESQLYTNPESRCILLP 820          

HSP 2 Score: 72.4034 bits (176), Expect = 6.004e-12
Identity = 78/327 (23.85%), Postives = 139/327 (42.51%), Query Frame = 1
Query: 3280 QPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKT--------ELITQIDQAMESAYSN--YCEEMTKAFKQVLSSNTKYAFDSQLVENIIVQMNNIEECSHHLN----DNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFI 4215
            Q  L LE    S   +++E      GD+R+    +I ++WQ+L   K  F       F ++T +    +R + +    D+  +D E +++        +LI ++D  M     +  Y E       + +   T       L+  +   M  + +    +     D   I   + + N  K   E+ + ++  RY+ KL  +H K +N++E   TLL      +WS   +   FL    +    E+Q K  L    ++ F++   WE GI +C+EL   Y  Y+ D+  LS +    + L  KIM + R E   + + + GK FP F+
Sbjct:  996 QSCLQLETFSPSKRKKILEKY----GDMRVMMGCEIFSMWQNLGEHKLNFIPAMIGPFLEVTLVPQPDLRNVMIPIFHDM--MDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSILLKKIERETWRESGISLIATVTRLMERLLDYRDCMKLGEVDGKKIGCTVSLLNFYK--TELNKEEMYIRYIHKLYDLHMKAQNFTEASYTLLLYDELLEWSERPL-REFLNYPMQS---EWQRKEYLHLTIIQNFDRGKCWENGILLCRELADQYESYY-DYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVGFYGKKFPFFL 1309          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Cavefish
Match: si:dkey-81e3.1 (dedicator of cytokinesis 4 [Source:HGNC Symbol;Acc:HGNC:19192])

HSP 1 Score: 82.8037 bits (203), Expect = 4.221e-15
Identity = 153/712 (21.49%), Postives = 288/712 (40.45%), Query Frame = 1
Query:  187 PCILKVFPMSHIK---------ILSNDIYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERR--YDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKLSDSTIDYVSLYI-KLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYGKS---QKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQIGIQLITRD----ECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDISD-------RNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGN---KVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPLFEKFSKFPPH----THIRFIIWHRSLNDRS-KNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNLPDSENQ-----LDKFIQDTMHFDVHKQIFRELIN------------NKPESDSNILRATDWFIKIAVKS 2157
            PC       +HIK          +   +  E+   +  W T  +  Y+  +   F ++   +   +  RR     ++   +M +  ++ +I ++D   + LGL    R +    +D + +SV +LY   +R +   R+      + + ++ L +  LLN +     +A+E+   ++  +  + R++  ISE +  R+  +       +        +  G S   + +++V H  R G M   +K       YRRP G +VI V++++T +   +  + +     +    +  +N   K+ + Y          +++QL     E I         RNV +   LG  D   P   RN    LY+ L   E +K  K    N EV + +    G     +V P     G DE+ S + YH+  P+W E I + +       PP     TH+RF   H S  ++  K   G +++ L  +D   +      D  H + ++K +         L     Y   P  +S  +  P   + M NS       K++ ++ +++CST+ T +  + ++       + I+  L      +K+ID  E+ KF    L+ +LD +    DDS   +  L++   +   I  L DS+ Q     +D +I++  HF      +R+LI                E    +L+A ++  K  V+S
Sbjct:   37 PCSFIHLKHAHIKNKGQFETVIPMEESVITEMTVTLRDWGTMWKQLYVKNEGELFHRLWHVMTEILELRRQVLVGHLTNDRMTDI-KQHIIARLDWGNEQLGLDLVPRRDFS-MVDPDEISVTELYRLMERRH---RKRDFPLQTNMHHLFLQVNSLLNCS-----VAEEL---HVFFFIYDSREMRPISERFFVRLNKQGVPKSPEKTERQCTLFVDLGSSDLRKDVYVVAHIFRIGRMVAGEKKSVSNTQYRRPFGCTVISVSDLLTTDFKDDHLLKVYSCNTESEWYQIHDNIIRKVSSRYSQIGSSTGLAVSLQLLHGNLEQIQKDYMRLFTRNVSITHRLGFSDIIMPGEVRND---LYITLERGEFEKGGKSVARNVEVTVYLLGGDGQVLKGLVCPGSGEPGADEFHSFVLYHSNSPRWSEQIKLVV-------PPELFRATHLRFEFRHCSTKEKGEKKLFGYSFVPLMQEDGRTL-----PDGTHEIIVHKCE-----ETANLQDSSRYLKLP--FSKASLQPGNNQTMKNS-------KESFWIISLLCSTKLTQNGDMLDLLKWRTHPERIMDSLTK----LKDIDGAEIVKF----LQDALDTLFAVLDDS-PQRYGLKVFDCLVHIINLLQDSKFQHFKPVMDNYIEN--HF-AGALSYRDLIRVLKWYVDRIIDAEHQEQIQQVLKAAEYLFKYIVQS 694          

HSP 2 Score: 74.3294 bits (181), Expect = 1.747e-12
Identity = 82/332 (24.70%), Postives = 145/332 (43.67%), Query Frame = 1
Query: 3280 QPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKT--------ELITQIDQAMESAYSNYCEEMTKAFKQVL-----------SSNTKYAFDSQLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFY-NEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKF 4212
            QP L LE  P S   +++E      GD+R+    +I ++WQ+L   K     +    F ++T +    +R + +    D+  +D E +++        +LI +++  M     +  E   + F  +L           S  +  A  ++L+E ++    +  +C      +    G  V  NL  FY  E+ + ++  RY+ KL  +H K +N++E   TLL      +W+   +   FL    +    E+Q K  L    +  F++   WE  I +C+EL   Y  Y+ D+  LS +    + L  KIM + R E   + I + GK FP F
Sbjct:  997 QPCLQLEMFPPSKRKKVLEKY----GDMRVMIGCEIFSMWQNLGDYKVNLIPSLIGSFLEVTLVPQPDLRNVLIPVFHDM--MDSEERRSGNFKQVEAKLIDKLESLMSEGKGD--ETYKELFNNILLKKIERETWRESGVSHIATVTRLMERLL----DYRDCMKIGEVDGKKIGCTV--NLLNFYKTELNKEEMYIRYIHKLYELHLKAQNFTEAAYTLLLYDELLEWTERPL-REFLTYPMQS---EWQRKECLHLTIIHNFDRGKCWENCIILCRELANQYEAYY-DYRNLSKMRLMEASLYDKIMNQQRLEPEFFRIGFYGKKFPFF 1309          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007652.1 (pep scaffold:Pmarinus_7.0:GL478924:2687:150863:1 gene:ENSPMAG00000006889.1 transcript:ENSPMAT00000007652.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 105.531 bits (262), Expect = 1.054e-22
Identity = 247/1223 (20.20%), Postives = 474/1223 (38.76%), Query Frame = 1
Query: 1321 EYSSVIYYHNAKPKWCEVI--CIPLFEKFSKFPPHTHIRFIIWHRSLNDRS-KNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMD-MEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDD-SYLGKNILELLGEMFKAIKNL---PDSENQLDKFIQDTMHFDVHKQIFR--------ELINNKPESDSNILRATDWFIKIAVKSFQNYEREMLGNIDEA--SLFNELADSYLHIL-EDLASSKDKPILRSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSCSDLD--ANMKSELTMNCMN----SKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQ---DQLLDNICNEMIEFIQLHERSWQKSPPEILN--NLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLHRPLMV-LVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGD-IRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKK--------TELITQIDQAMESA-----YSNYCEEMTKAF----------KQVLSSNTKYAFDSQLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFY-NEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYTTVERKYPEPEDFAS-ADK---KIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRYVSPVSGGVTKLVE 4788
            ++ S + YHN  P+W E++   IP+ +KF      +H+RF   H S  ++  K   G A+  L  +D   +     +D  H L +YK +         Y    P  + D    S     P+ +   +   R     K++L++ T++CST+ T ++ L  +    +   T+   L      ++ +   E+ KF   IL++   ++  +T+    L    L  +  + +  K L   P  E  + K     +    +K++ R         L + + E   + LRA ++  K  V+S   Y R   G  +E   +   EL  S   IL +D   ++     +  +L     I   L+ + +   +A LV + L S   +   A     + + C+     SKLF++ + R  +LP    +I         +++ E +++      +L NI + M +             P +    +++ E ++E  ++++   ++S G+ +     +N  L +R      VS +++ L  +SD+ ++ ++        F     + +    ++++F +   L    VFP                                    + WM M  V S   + T+KQ     L P     L QN              E    ++           I QP L LE   S +  + I +    G + +R+  A ++  +WQ L   K  F       F ++T +   ++R + +    ++  +D E +K         E+I ++D  +        Y      +T  F          +Q     +  +F +  V  ++ ++ +  +C     D      +    +L  FY  E+ + ++  RY+ KL  +H + +NY+E G TLL       W    +     P  +   + E++ K  LL + L +F K   WE GI +C+EL   Y E   D+ +LS+V    +     I+ + R E   + + + GK FP F+ +   K  V R      +      + S+F +    +   +P+D  + AD    +IF +   P           + + +RI  +Y    I +F Y R +    +D         ++   ++ ++ LP I     V   E   + P + A+  +E +  +  +L   Y T        L   +  +I    + V+GG+ +  E
Sbjct:   17 DFHSFVLYHNNSPRWGEILKLAIPV-DKFRG----SHLRFEFRHCSTKEKGEKKLFGFAFTPLMREDGTTL-----SDETHELYVYKCEESAGFSNPAYYLSLPCCKDDSGA-SGATVGPSVSTTSLVYPRSH---KESLWISTLLCSTKLTQNEDLLALLKWKVHTDTVQDILGR----LRQVKGEEIVKFLQDILDTLFAILDDSTEKYGPLVFQSLVFVVNLLRDTKFLHFRPVMETYIQKHFAGAL---AYKELLRCMKWYLDRSLDSIRHEHIQDALRAMEYLFKFVVQSRSLYARATGGLEEEEFRAAIRELFHSIKLILCQDGRDNEGLVYTQVTLLTSLPAIYEELLRMFKSREVADLVRDALGSLPTVQHAAPGLDTVRLQCVGRTVESKLFLNPESRRFLLPVVLHHI---------RMHLEHQKEPLVCSGILSNIFSIMKK---------SSGDPRVCEEVDMIVESLLE-VLMKTVAGVMSKGLRHELVVAANHCLFNRAAQGEYVSCLLSLLRQMSDRHYQQLLEN------FSSKESLKE---FVLQIFSVFSILMKQEVFP------------------------------------RDWMVMRMVISSVIVTTMKQ-----LSP----ALHQNFGN-----------ESFDIQIWTFYFSLAVLFINQPSLQLEAF-SPLKRKQILTQYGSGMETMRILMAHEVFRMWQSLGDHKAHFIPGLLGPFLEVTLVPQTELRRVLIPIFHEM--MDCEQRKNGSFKQVEAEIIDKLDSLLSEGRGDEDYRELFSLITPLFGPYPSLLERIEQETWRESGVSFVTS-VTRLMERLLDYRDCMK--GDEVEDKKIGCAVSLLNFYKTEINKEEMYIRYIHKLCDMHLQAQNYTEAGFTLLLYCELLGWDERPLG----PFLHYPAQSEWERKESLLLKILHFFHKGKCWEFGIPLCRELAGQY-EALYDYQRLSSVRKTEAAYYDNIIEQQRLEPEFFKVGFYGKKFPFFLRN---KEFVCRGHDYERLETFQQRMLSEFPHAVPMQHAGQPDDATTHADAQYIQIFAVSPVPG---VSEVLRNERIPERIKSFYRVNNICKFRYDRPLYKGTKDKENEFKNLWVERTTLILKQPLPGICRWFEVDKREVAEMSPLENAIEAVENKNTELRLLIGQYRTQPPHNLNPLSMCLNGVI---NAAVNGGIARYQE 1114          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010350.1 (pep scaffold:Pmarinus_7.0:GL476865:2751:57127:1 gene:ENSPMAG00000009372.1 transcript:ENSPMAT00000010350.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.99 bits (258), Expect = 1.153e-22
Identity = 121/454 (26.65%), Postives = 204/454 (44.93%), Query Frame = 1
Query: 3418 KNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIV----HLDRENKK--TELITQIDQAMESAYSNYCEEMTKAFKQVLS---------SNTKYAFD---SQLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSD--IIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMF--EDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRN----KRNVSEMSIDL---NSQFEYTTVERKYPEPEDF--ASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIEYQIRKDEML 4671
            K RF         ++T +   ++R   +   FD++    H  RE KK   ELIT++D  +E    +  E+    F+++LS         S T  AF    S+L+E ++    +I    +  N  +  N M    NL  FY E+ R +  I  RYL+KL  +H + +N++E   +LL  +   +WS ++     +       +   Q+K  L ++ +KYF+    WE+ I +CKEL + Y     D+ +LS +  K +   +KI+     RP+ + + + Y G  FP F+ +   K  V R     +R   EM I     N++   TT     P  +D   AS  + +    V+P     P +++GK V + ++ +Y N  + +F Y R     E+DP        I+  I +   KLP IL         ++ I P + A+  +   I  DE+L
Sbjct:    4 KIRFIPGMIGPILEMTLVPEMELRKATIPIFFDMMQCEYHYTREFKKFENELITKLDHEVEGGRGD--EQYKVLFERILSDCCRRHKFLSRTGEAFVLLVSRLLERLL-DYRSITSEENKENRENRENRMSCTVNLLNFYKEIEREEMYISLRYLYKLCDLHLESENFTEAAYSLLLHAKLLKWSDDLCVGHEMQRNSHHADTHRQLKESLYQDIIKYFDDGKMWEEAIVLCKELAEQYEMEIFDYEQLSQLLQKQALFYQKIINIKNPRPKRDYFSVGYYGYRFPTFLRN---KVFVHRGGEYERREDFEMRIMTMFPNAEKMKTTS----PPGDDIRNASGQQDVQCFTVQPILEEQP-QFKGKNVPESLMSFYKNNHVHKFSYSRPFRKGEKDPDNEFATMWIERTIFVTAYKLPGILRWFETNRYLQVEISPLENAIEAM--GIANDEIL 444          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010277.1 (pep scaffold:Pmarinus_7.0:GL478006:150137:181148:-1 gene:ENSPMAG00000009296.1 transcript:ENSPMAT00000010277.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 1.760e-21
Identity = 154/664 (23.19%), Postives = 285/664 (42.92%), Query Frame = 1
Query:  679 TLYKLEDRKITR-ISETYSHRVAIRSYG--CDLIRANAIIMKDIQYGKS---QKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENL--DSEKQIGI---QLITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPE---------DISDRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDK-ERKKSDPNFEVEISIRDYQGNKVVMPSFDWRG-----FDEYSSVIYYHNAKPKWCEV--ICIPLFEKFSKFPPHTHIRFIIWHRSLN---DRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNR-HPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYT--FDKL-LANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTMHFDVHKQIFRELINNKPESDSN-----ILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHI---LEDLA--SSKDKPIL-RSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTM-NCMNSKLFVDSQCRSIILPETTKNI 2499
             L  L D K  R +SE Y  R   +      +L+    ++  D+  GK    +K++LV   +R G M L     K  +  RRP GV+V+++T+++  N+  D +KQ      Q+   ++ L+N   K    +   K+  +  + + +K +  +          + DR+  +   +G  +   P    + RN +Y+ L   E DK   K +  N EV + + D  G   ++ +  W G       EY S++YY   +PKW E   + +P+ + +      +H+RF   HRS     DRS+    + ++KL   D   +      D  H L IYK D  K++         E     EL+S + +       +  + +   +  KD   + T+VCST+ T  FD L L    +   E +  L KL        N+D  E+ KF    L++  ++  + ++     + + + L  +   I +       P  E  + +    T+ ++   ++ +  I +    ++      I++A ++  K  V S     R + G + E         S + +   L D+   +S DK +L +   L+    II  L+ V + + +++L+   + S S      + +L M + ++S LF D +CR ++LP  T +I
Sbjct:   40 VLMALYDPKENRFLSENYMVRWGKQGLPKEVELLHNTRVVFTDLG-GKDLAIEKMYLVCQIVRNGCMDLKDNNKKCTIGLRRPFGVAVMDITDIVKGNIETDEDKQHFFPFHQVTAENDFLQNIINK--AHFWQRKQHENQGLWVSMKMLNGDIKQVKKDFPHLIDRSTAIARKMGFPEIIMPG---DVRNDVYITLVQGEFDKGSSKTTQKNVEVTMVVCDDTGK--ILENVIWIGAGDQPITEYKSIVYYQVKQPKWFETVKVAVPIEDVY-----RSHLRFTFRHRSSQDSKDRSEKNFAMCFVKLMRPDGTTL-----QDGNHDLFIYKGDSRKME---------EVSAYQELHSTRMQVEDNVASKACSGSGLSLSSKDRFLISTLVCSTKLTQNFDLLGLLKWRSNPAELEKNLKKL-------MNVDGEEVVKFLQDTLDALFNITMENSESDKYDELVFDALIFIIGLIADRKFQHFNPVLEAYIRQHFSATLAYEKLTKVLKRKITDGTTMENGDHLLKIMKALEYIFKFIVAS-----RILFGQLYEGKGKEAFEKSIMQVFISLNDMLRNASTDKLLLAQGGALKYLPRIIPDLLQVFKEVELSKLLVRFMSSVSPERLIRQKQLCMSDIVHSALFKDHECRQVLLPVMTDHI 664          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008301.1 (pep scaffold:Pmarinus_7.0:GL477297:188469:211033:-1 gene:ENSPMAG00000007508.1 transcript:ENSPMAT00000008301.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.8929 bits (224), Expect = 6.441e-19
Identity = 77/288 (26.74%), Postives = 133/288 (46.18%), Query Frame = 1
Query: 3796 RSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNKRNVSEMSIDLNSQFEYTTVER---KYPEPEDFASA-DKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEAL 4632
            R +I  RYL+KL  +H +  NY+E G TLL  +   +WS +           +    + ++K  L  + + YF+K   WE+ I +CKEL + Y     D+ +LS +  + ++  + I+   RP+ + + + Y G+GFP F+ +   K  + R K        +     ++   E+     P  E+  SA  + I    V+P +   P K++ K V  +IL +Y   E++ F Y R +   ++DP        I+      E +LP IL    V    K+ I P + A+
Sbjct:    2 REEIYIRYLYKLHDLHLQCDNYTEAGYTLLLYTHLLKWSDDPCASHLNLRGAQKGNTQRELKEMLYGDIIGYFDKGKMWEEAIGLCKELAQQYETEIFDYEQLSNILRRQAKFYENIITVMRPKPDYFAVGYFGQGFPSFLRN---KMFIYRGKEYERREDFEARLLAQFPNAEKMKTTSPPGENVRSAPSQNIQCFTVQPLQRDQP-KFKNKSVNDQILNFYKVNEVQCFTYSRPVRKGDKDPDNEFANMWIERTTYSTEYRLPGILRWFEVIETSKVEISPLENAI 285          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Yeast
Match: DCK1 (Dock family protein (Dedicator Of CytoKinesis), homolog of human DOCK1; upstream component for regulation through the small GTPase Rho5p; may form a complex with Lmo1p that acts as a GEF for Rho5p; interacts with Ino4p; cytoplasmic protein that relocates to mitochondria under oxidative stress; implicated in mitophagy; not an essential protein; DOCK proteins act as guanine nucleotide exchange factors [Source:SGD;Acc:S000004414])

HSP 1 Score: 50.8322 bits (120), Expect = 2.400e-6
Identity = 39/143 (27.27%), Postives = 70/143 (48.95%), Query Frame = 1
Query: 3787 EMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQW-SHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEK-EDWEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPK 4209
            E  R ++  + ++ L     + K++ +   +L  L+  Y W S++ +     P   E   FE   K  LL+ES + F + +  EK + V K+LIK Y E   D   L+ VH +++ +  ++   DR     + + ++G GFPK
Sbjct: 1412 EANRPELFHKMIYDLFIHFIQKKDFVQAALSLELLAGTYAWDSNDTLEAISFPPLPEQSSFE--RKEYLLKESARNFSRGQKPEKALAVYKDLIKAYDEINYDLNGLAFVHDQIAGIYTRLQSIDRLVPTYFKVSFMGFGFPK 1552          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Nematostella
Match: EDO48794 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIE1])

HSP 1 Score: 112.849 bits (281), Expect = 1.139e-24
Identity = 114/477 (23.90%), Postives = 207/477 (43.40%), Query Frame = 1
Query: 3277 TQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENK------KTELITQIDQAMESAYSN--YCE-------EMTKAFKQVLSSNTKYA-FDSQLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYTTVERKYPEPED--FASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEAL 4632
            TQ  L LE    +   +++E       D+R+   ++I ++W  L   K +F       F ++T I    +R   +   +D++ ++          +TE+++++D  +E    N  Y E       E+     Q+     ++    +QL+E ++     ++       D +  N M  I N+  FY E+ R ++  RY++KL  +H  I+NY+E   TLL  +   +W  + V   F          + Q+K  L  + + YF+K   WE+ I +CK+L K Y E   D+IKLS + +K ++    I+ + R E   + + + GKGFP F+ D   K  + R K    +S+  + + SQ+    +      PE+    S+ ++I        +  F     G +       +YD   I +F Y R+ +    D         ++  I+  + K P IL    V S +   + P + AL
Sbjct: 1030 TQESLQLEDFSQAKQDKILEKY----SDMRMIIGLKINDMWHSLGSHKIKFIPGLVGPFLEMTLIPQTDLRKATIPIFYDMIEVEHRTTGGFVTVETEMMSKLDVLVEGGKGNADYKELFHQILFELFNRHPQLKEEGLRFVQLLTQLMERLLDYRTVVQ------GDENIDNRMSCIVNVLNFYKEIRREEMFIRYVYKLCDMHLAIENYTEAAFTLLLHADLLEWCDQPV---FTGQGKYQAATQRQLKESLYTDMIDYFDKGKCWEEAISMCKQLSKQYEEQTFDYIKLSHILNKQAKFYDNIITQVRGEPEYFRVAFYGKGFPTFLRD---KVFIYRGKEYERLSDFCVRIQSQYPSAKMLNYLTRPEEDIINSSGQRIL------PQLDFVFNNHGSVNNL----FYDVNSINKFQYSRVFHKGIRDKECEFKTMWLERTILYTKYKFPGILCWFEVISSDLEEVSPIRNAL 1480          

HSP 2 Score: 108.227 bits (269), Expect = 2.575e-23
Identity = 141/677 (20.83%), Postives = 278/677 (41.06%), Query Frame = 1
Query:   64 FAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKILSN-------------DIYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAI-QLAISERRYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQ---HQREY------ESSRRVSKLSDST-----IDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYG--KSQKIFLVFHFIRKGPMCLTKKTIKEGVP-YRRPKGVSVIEVTNVMTENL----DSEKQIGIQLITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRP--EDISDRNVMVLGLDPYYPATNRNQ-----------RNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGN---KVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVI--CIPLFEKFSKFPPHTHIRFIIWHRSLN---DRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQ 1926
            F   IYN+    +  ++L+ G+ + + E   GWYRGF         +FP+S++K+                 +  E+ + +  W    ++ YL  +   F  + + + +L    R+  S       ++  ++ +   +D   + +GL    RN+ G  +D ++  VI+LY +     + Y      E  RRVS   +S        + S +   +N+      + D+  ++ I+LY   D +        +   A      D +    ++  D+     K  ++FLV   IR G M L +   K+     RR  G +V+ ++++M+  +    D E  + + ++  ++ + +  +K+I     + +     I + +K +    E I + N +++     + A  R Q           RN LY+ +   E ++  K ++ N EV + +    G+    V+          EY SVIYYH+ KP+W E I   +P+ E+F +    +H+RF   HRS     D+S+     A+++L   D   +      D  H L ++K +  K+  + YL             S K                     D   ++T++CST+ T +  L  +    L+ + +  KL +  + +  +   E+ KF T   ++   ++ +
Sbjct:    9 FPPVIYNFNEKGAHKLKLQLGETVQVLEENGGWYRGFSLRNKNSRGIFPISYVKLRQQKNGQVRYGVLQEISLVEEMTSVLREWGNMWQNLYLRREDHLFLLVKKQMAELMDWRRQILSETLPGDQLKQLKQKVTSTIDYGNRIIGLDLVVRNDDGNILDPDSTGVIELYRRVSVGHKPYCRTTIIELYRRVSSRDESKKLKREAAFSSTHNIYVNIKNVVCNINDDA-EVFISLYDARDGEFISEQFVVNWDKAGMPKEIDKLYNLTVLFTDLGTKDLKRDRVFLVCQIIRVGRMDLKEPASKKLTKNLRRCFGGAVLNLSDLMSGKVQYEDDKEHFLQLHVVPENQFMHDWIKKMIASQLADSKGTGQGIWVSVKVLEGNEEQIREENPLLMN---KHTAIARKQGFPEVIMPGDVRNDLYVTVLSGEFERGHKTANKNIEVTMHVLSDNGDILENVISYGAGEDLVSEYRSVIYYHSGKPEWHETIKLAVPI-EQFYE----SHLRFTFKHRSSGEEKDKSQKVFAFAFVRLMQRDGTTL-----KDGTHELMVFKCNSTKVLPSTYLQSA----------SFKIEQTLMNPPTKGGADAAAYCNDKFNIKTLLCSTKLTQNLDLLGL----LKWRQMPGKLKDVLVTLMKVSGEEIVKFLTDTFDALFAILNE 657          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Nematostella
Match: EDO31872 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWP8])

HSP 1 Score: 78.9518 bits (193), Expect = 1.483e-14
Identity = 124/561 (22.10%), Postives = 232/561 (41.35%), Query Frame = 1
Query:  376 SNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKLSDSTID-----YVSLYIKLLNVNFERSQLADEILDINITLYK------LEDRKITRISETYSHRVA-----IRSYGCDLIRANAIIMKDIQYGKSQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMT---ENLDSEKQIGIQLITRDECL---ENNAEKLITDYRINKREYSSTINIQLKTIRPEDISDRNVMVLGLDPYYPATNR-----------NQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNKV---VMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPL-FEKFSKFPPHTHIRFIIWHRS-LNDRSKNPRGVA--YMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDD 1938
              + + +M E   +A I  +D     +GL    R   GE +D ++ SV+ LY Q +    + +R  K     +      Y ++   + NV        +E  ++  +LY         +R +  I + +S++       + +  C      ++ ++      S   +LV H IR G M    K +   V YRRP G +V+++ +++    E  +SE  + IQ  +  E L   E+  +KL +   + +      ++++L     E I   N ++    P   A  R           + RN +Y+ +   E +K  K +  N EV +S+    G  +   +      +   EY S IYYHN+ PKW E + + +  +KF      + +RF   H S   ++ K  +  A  ++KL  +D   +      D  H L +YK D      ++     P    +     + N   +  E++  S+      KD+  V+T+VCST+ T +  L  +       Q+ L  + N    +  ID  E+ KF   I ++   ++ ++ ++
Sbjct:   80 GTLTQDQMDEIKEKA-IHNIDWGNSKMGLDLVPRI-NGEMVDADSCSVVHLY-QEEVASGTIKRAPKAKTKNVTTQHHIYFNMNSFMCNV--------EESCEVFFSLYNGKSSKFFSERFMVSIGKHFSNQKVNQLQKVSNSTCVFTDLGSVELR------STDTYLVAHLIRVGKMLPESKKVS-SVSYRRPYGCAVLDIVDLLQGKEEIENSELFMPIQFTSETEFLTIHESIIKKLQSKNGLPESSTGIYVSMRLLHGELEKIQQENPLLF---PEGIAVARKLGFPEIIMPGDVRNDVYVTIEKGEFEKSGKTTAKNVEVSMSVIGANGRLIEDCIYLGAGGKPCTEYESFIYYHNSSPKWNETVKVRIPSDKFVG----SLLRFGFRHVSKFEEKHKELKTFAFSFVKLMGEDETTL-----PDGSHELCMYKFDSNSYFDSKAFINMPSLVSE-----VGNMKYSQMERLSRSS------KDSFSVRTLVCSTKLTQNVDLVGVLK--WRKQSNLQAVVNS---LFKIDGEEIVKFLQDIFDALFSILNESVEE 594          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Medaka
Match: dock1 (dedicator of cytokinesis 1 [Source:NCBI gene;Acc:101155391])

HSP 1 Score: 247.669 bits (631), Expect = 2.336e-65
Identity = 357/1640 (21.77%), Postives = 676/1640 (41.22%), Query Frame = 1
Query:   37 WLNYEEGDCFAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKI--------LSNDIYP-------ELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERR--YDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQ----------REYESSRRVSKLSD----STIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYG----KSQKIFLVFHFIRKGPMCL---TKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQ---IGIQLIT-RDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDIS----------DRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNK---VVMPSFDWRGFDEYSSVIYYHNAKPKWCEVI--CIPLFEKFSKFPPHTHIRFIIWHRSLN---DRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKN------IDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNL------PDSENQLDKFIQDTMHFDVHKQIFRELINNKPESDSNIL---RATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLAS-SKDKPILRSLVLRKAGLIINALIPVCQPIGMARLVNN-LLKSCSDLDANMKSELTMNCMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQD---QLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYY-LTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLD------RENKKTELITQIDQAMESAYSNYCEEMTKAFKQVLSSNT-KYAFDSQLVENII----VQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNKRNVSEMSIDLNSQFEYTTVER---KYPEPEDFASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIE 4644
            WL  +   CF+I  YNY     + + L+ GD + I E Y  WYRG    +     +FP  +I +         S  + P       E+   +  W T  RD Y+      F+ + + I   I  R       + + ++ E  ++ +  K+D   K L L    R++ G  +D    S I L+  H+          +E +S R+   L+     ++    +L++ L NV  +  + A E+L   ++LY   + K   ISE Y  + +      D+ + + +       G    K ++I  V   +R G M L     K +  G+  RRP GV+V++VT+++T  +D E +   I  Q +   ++ L+    K+IT   +N +     + ++L    P DI           DR+  V   +G  +   P    + RN +Y+ L   + DK  K +  N EV +S+ D +G K   V+ P        EY S+IYY   +P+W E I   IP+ E  ++    +H+RF   HRS     D+S+     +++KL   D   +      D  H L +YK + +K++ + +    P  +       ++ +  + T +   +    ++ KD+L + T+VCST+ T          Q+++   +L    N  ++ KN      ++  E+ KF    L++  +++ + +D       + + L  +   I +       P  E  + K    T+ +    ++ +  + N  +    +L   +A ++  K  V+S   +  ++  N  EA     L + +    + + S S++  +++   L+    I+N +  V  P  +++L    +LK  +      K +  ++ ++S LFV+  CR I+LP  T  +         K++ EK+ +     QLL +I  E++    +    W               II  K+LR+    V +    +SR   +       +   V+ +   L  + D  +  ++        F + R  +D  D +ME F +  +L    V+PS                                     W+ M  +Q++ FL  + Q   ++ K +  LT                      + +L  +      + +TQ  L LE   S    ++ +       D+R     +I+++W +L   K +F         ++T +   ++R   +   FD++  +       +  + E+IT++D  +E  + +  E+    F+++L  +  K+ + +++ E  +      +  + +    ++D +  N M    N+  FY E+ R ++  RYL+KL  +H +  NY+E   TLL  +   +WS E         +      + Q+K +L +E + YF+K   WE+ I + KEL + Y     DF +LSA   K ++  + I+   RP  + + + Y G GFP F+ +   K  + R K        +     ++   E+     P  ED  ++  +        +    P K++ K V ++I+ +Y   E+ +F Y R +   E +P        I+        KLP IL    VKS+    I P + A+  ++
Sbjct:    4 WLTTKMFLCFSI--YNYSARGEEELSLQIGDTVHILETYEEWYRGHLLRRKSKKGIFPACYIHLKDATVEGSGSETVIPTELPLVQEVTTTLREWATIWRDLYVGDKREMFNCVRDMIYDLIEWRSQILSGTLPQDELTELKQK-VTSKIDYGNKYLDLDLVVRDKDGNILDPELTSAISLFRAHEAASKQIEDRIQEEKSQRQNIDLTRQAKFASTPSFALFVTLKNVVCKIGEDA-EVL---MSLYDPMESKF--ISENYLVKWSSAGLAKDIDQLHNLRAVFTDLGSEDLKRERISFVCQIVRVGRMELRDNNTKKLTSGL--RRPFGVAVMDVTDIITGKMDDEDKQHFIPFQPVAGENDFLQTVINKVITAKEVNHKGQGLWVTLKL---LPGDIHQIRKDFPHLVDRSTAVARKMGFPEIIMPG---DVRNDIYITLVQGDFDKGSKTTPKNVEVTMSVYDEEGKKLENVIFPGAGESVISEYKSIIYYQVKQPRWFETIKVAIPI-EDVNR----SHLRFTFRHRSSQDSKDKSEKIFAFSFVKLMRFDGTTL-----RDGEHDLIVYKAEAKKLEDSNHYLTLPATK-----VEMEEKGYSTTGKSTQNQGACIITKDSLQISTLVCSTKLT----------QNVDLLGLLKWRSNTSLLEKNLRQLMKVEGGEVVKFLQDTLDALFNIMMENSDSEAFDTLVFDALVFIIGLIADRKFQHFNPVLETYIRKHFSATLAYTKLTKVLKNYVENAEKLTEQLLGAMKALEYIFKFIVRSRVLF-NQLYENKGEAGFMESLRNLFTSFNDMMNSNSENTGMVKGAALKYIPTIVNDVKLVFDPKDLSKLFTEFILKVPAGRLVKQKLDCLIDIVHSDLFVNHDCREILLPLMTDQL---------KLHLEKQEEPKACCQLLSDIL-EVLYRKDVGPTQWHVQ------------IIMEKLLRTINRTVIS----MSRDSPH-------IGSFVACMTATLRQMEDYHYPHLINT------FGKIR--SDVVDFLMETFIMFKDLIGKNVYPS------------------------------------DWIIMNMMQNKVFLRAISQYAAVLNKKFLDLTNF--------------------ELQLWNNYFHLAVAFLTQESLQLENFSSDKRAKIFQKY----QDMRRQIGFEIRDMWYNLGPHKIKFIPEMVGPILEMTLVPEIELRKATIPIFFDMMQCEFHFTCSFQRFENEIITKLDHEVEGGHGD--EQYKLLFQKILLEHCRKHKYLARMGELFVNLVVRLLERLLDYRTIMHDENKENRMSCTVNVLNFYKEIDREEMYIRYLYKLCDLHRECDNYTEAAYTLLLHAKLLKWSDEPCAAHLTQRDGYQAATQGQLKDQLYQEIINYFDKGKMWEEAIILSKELAEQYENEMFDFEQLSASLRKQAQFYENIVKVIRPRPDYFAVGYYGMGFPSFLRN---KMFIYRGKEYERREDFEARLLTQFPNAEKMKTTTPPSEDLKNSSLQYIQCFTVKTILELPAKFQNKPVSEQIVSFYTVNEVHKFQYSRPVRKGENNPDNEFANMWIERTTYTTAYKLPGILRWFEVKSVSTEEISPLENAMETMQ 1494          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Medaka
Match: dock5 (dedicator of cytokinesis 5 [Source:NCBI gene;Acc:101168296])

HSP 1 Score: 239.58 bits (610), Expect = 7.324e-63
Identity = 382/1674 (22.82%), Postives = 672/1674 (40.14%), Query Frame = 1
Query:   52 EGDCFAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIK--------------ILSNDI--YPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERRYDSNIEKSKMIESN----RRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYES-SRRV----SKLSDSTIDYVSL------YIKLLNV-NFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAI--IMKDIQYGK--SQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSE--------KQIGIQ-----------------LITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDIS----------DRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGN---KVVMPSFDWRGFDEYSSVIYYHNAKPKWCEV--ICIPLFEKFSKFPPHTHIRFIIWHRSLN---DRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAE-YLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICN---QSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLI----QQATDDSYLGKN---ILELLGEM-FKAIKNLPDSENQLDKFIQDTMHFDVHKQIFRELINNK-----PESDSNILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPI-----LRSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNC--MNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSR-----SESNGKLLHRPLMVLVSVIITFLSYISDKLWEFI-----VRKQKDDCQFCEA----RRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDR--------ENKKTELITQIDQAMESAYSNYCEEMTKAF--KQVLSSNTKYAFDSQLVENIIVQMNNIEECSHH----LNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKEDWEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNKRN--VSEMSIDLNSQFEYTTVERKYPEPED--FASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIE 4644
            E + +  AIYNY     Q + L+ GD + I E + G  +        +  +FP S+I               I+  D+    EL A +  W       Y+    T F  +    Q+A S   Y S I    + + +    ++ +  K+D   + LGL    R+E G  +  +  S + L+  H+    S   R+    +KL +  + Y +L      Y  L+N+ NF  +   D   ++ ++LY  +  +   ISE +      +    ++ + N +  +  D+       Q++FLV   IR G M L K+  K+    RRP GV+V+++T++    +D E        +QI ++                 +I  +E L     K+I    +N +     + ++L    P D++          DRNV +   +G  +   P    N RN +Y+ L   E D+ +KK+  N EV IS+ D +G    K + P    +G  EY SVIYY   +P W E   + IP+ +       H H+     HRS     D+S+ P G+A+++L   D   +      D  H L +YK D++K + A+ YLT        P  +S        T +    +    V KD+  + T+ CST+ T +  L  + N    S +   IL +L         ++  E+ KF    L++  +++    Q+ T D+ +      I+ L+G++ F+     P  E  + K    T+ +     +    + +       E   + L+A  +  +  V+S   Y R   GN ++    ++  +S   +     S  D+P+     ++  +L+    IIN +  V  P+ ++ L+   ++S  DL   ++ +L   C  + S LF   +CR+++LP  T  +                    QL D+ C                  P+      YE         +CV ++ST ++ L R     +  + +L+   L+  V+  +  +   S  +  ++     + KQ DD  +       +   D  D +ME F +  +L M  VFP+                                     W+ M  VQ + FL  + Q  N +L  Y+L      L+   +    C                   + +T   L LE        +++    ++G D+R +   +I+++W +L   K +F         ++T +   ++R   +   FD++  +         +  + ELI ++DQ +E    +   E  K    K +L    ++ + SQ  E + + ++ + E         +D SP + M    N+  FY E  R DI  RYL+KL  +H   +NY+E   TLL  +   QWS +      +P + E    + ++K +L +E + Y +K              K    YF + I  + +  K +E  +KIM E RP+   + + Y G GFP F+ +   K  + R K    + + S+ L SQF           P D    S  + I    VKP  F  P  ++ K V ++IL YY   E+++F Y R     E+DP        I+    +   + P IL    VK      + P + A+  +E
Sbjct:   12 EREKYGQAIYNYDSNGEQELCLQVGDPVHILEKFEGECKHKTGPNKSLFGIFPASYISLKEARVEGSGQQETIIPADLPLVQELGATLREWAQIWHKLYVANKITLFRSVQ---QMAYSLIEYRSQIVSGTLPKDDLVELKKKVTAKIDHGNRILGLDLVVRDEAGNMLHPDRTSTVSLFRAHETASRSIDERIQEEKTKLQNRKMSYQTLLSSVHTYSLLMNLRNFVCNIGEDS--ELLMSLYDPDQSEF--ISENFLADWDSKGMPKEMTKLNNLPALFTDLSSSDLMRQRLFLVCQIIRVGSMEL-KEGKKQTGGLRRPFGVAVMDITDIAHGTVDDEDKQHFIPFQQIAMETYIRQRQLIMSPLIPSRVIGENEPLTAVFNKVIATREVNHKGQGLFVTLKL---LPGDLAQVRKDYPHFVDRNVAIVRKMGFPEIILPG---NVRNDIYVTLLQGEFDRGKKKTPKNVEVTISVHDEEGRPVEKAIFPGAGCKGMTEYKSVIYYQVKQPCWNETVKVTIPIEDVC-----HCHLIMTFRHRSSQDSRDKSEKPFGMAFVRLMRKDGTTL-----RDGRHDLIVYKADVKKSEDAKVYLTL-------PATWSEVEEKEKQTGKQFQHSGAIPVTKDSFQITTLTCSTKLTQNVDLLGLLNWRSNSEDLDKILRRL-------MEVEGGEIVKFLQDTLDALFNIMMETCQKDTYDTLVFDALVFIITLIGDIKFQHFN--PVLETYISKHFSATLAYLKLTGVLNYYVGHAEDPSLTEKLFSALKALKYLFRFIVQSRVLYLR-FSGNSEDG---DDFLNSIRSLFLSFNSLMDRPLDEGVKIKGAILKYLPSIINDVQTVFDPVELSVLLTKFIESIPDLQL-VRQKLGCMCKMVESDLFKQPECRNVLLPLVTDQL------------------SGQLDDHSCK-----------------PD------YE---------ACVQVLSTLLDNLDRKDVGPTRGHIQLIMERLLRRVNRTVISMDRDSPLIGHYLACMTAILKQMDDMHYTHYISTFKTRQDIIDFLMETFIMFKDL-MGNVFPA------------------------------------DWVIMNMVQMQVFLRAINQYSN-VLNMYFLDPAHFELQLWNNYFNLC------------------VAFLTHKTLQLESFSQERRNKILN---KYG-DMRKTMGFKIRDMWYNLGPHKMKFIPAMVGPILEVTLVPEPELRKATIPIFFDMMQCEHNFNPGRTFQTFENELIMKLDQEVEGGRGD---EQYKVLLEKTLLEHCRRHRYLSQSGEELALLLSTLLENLLAYRTITHDESPEHRMSCTVNVLNFYKEKKREDIYIRYLYKLRDLHLDCENYTEAAYTLLLHAELLQWSDKPCAPHLIPRDREHAWTQQELKERLFQEIICYLDKG-------------KVNLNYF-ELILGTLILKKQAEFFEKIMHEMRPQPEYFAVGYYGLGFPSFLRN---KMFIYRGKEYSFLEDFSLKLLSQFPNAVRMTSTAPPADDICNSPAQYIQCFTVKPV-FTVPQHFKEKGVPEQILNYYRTNEVDQFQYSRPFRKGEKDPDNEFATMWIERTTFITAYRFPGILKWFEVKISSVEELSPLENAIEAME 1509          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Medaka
Match: DOCK2 (dedicator of cytokinesis 2 [Source:NCBI gene;Acc:101168874])

HSP 1 Score: 173.326 bits (438), Expect = 1.154e-42
Identity = 344/1557 (22.09%), Postives = 635/1557 (40.78%), Query Frame = 1
Query:  676 ITLYKLEDRKITRISETYSHRVAIRSYG--CDLIRANAIIMKDIQYG--KSQKIFLVFHFIRKGPMCLTKKTIKE-GVPYRRPKGVSVIEVTNVMTENL--DSEKQIGIQ---LITRDECLENNAEKLITDYRINKREYSSTINIQ-----LKTIRPE--DISDRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQG----NKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEV--ICIPLFEKFSKFPPHTHIRFIIWHRSLN---DRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMD---MEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLD-LIQQATDDSYLGKNILELLGEMFKAIKNLPDSENQ-----LDKFIQDTMHFDV---HKQIFREL-----INNKPESDSNILR---ATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGL-IINALIPVCQPIGMARLVNNLLK---SCSDLDANMKSELT--MNCMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNIC-----NEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDR------ENKKTELITQIDQAMESAYSNYCEEMTKAFKQVL--SSNTKYAFDSQ------LVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNK--RNVSEMSIDLNSQFEYTTVERKYPEPED--FASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRI----IDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRY-------VSPVSGGVTKLVEMIPNNDDNFSYTSEVVN-QVLSLIYQYLQAFEIYDTLDNYMIFVSAFQNLCSSVSRSLDLVSEEYNVKILPDLYSKSKKRETNFTATIRRPSVAL 5070
            ++LY    +KI  ISE Y  R   + +    D++    ++  D+       +KI+L+   +R G M L +   K+  +  RRP GV+V+++T+++   L  D EKQ  I    ++  ++ L +   K +T  R +       + ++     +  IR E   + DR+ +V   LG  +   P    + RN +YL +   + DK  K +  N EV + + D +G    N + + + D +   EY SVIYY   +P+W E   + +PL E         H+RF+  HRS     D+S+    +A+++L  +D   +      D  H L ++K D   ME +     L     +  D       NR    +  M       V  +D+  + T+VCST+ T +  L  +     + + +   L      +K ID  E+ KF    L++  + +++ +  D Y   +IL +   +   I  + D + Q     L+ +I+   HF     +K++   L     ++++ E    ILR   A ++  K  V+S     R +   + E     +  +S   + E + +        +L+LR A L  +  ++   + +  A+L++ LL    SC   +   K ++      ++S+LF   +CR ++LP   + + +      +  ++E+ R+  +LL+NI      N + E  Q H +    S   I+N  V  +  EH ++              SR              +V+ +   LS + D  +   +        F  +   TD  D +ME F L  +L    V+PS                                     WM M+ VQ+R FL  +           Y   ++Q               +  + +L  +      + ITQ  L L+    +   +++   +++G   RL G   I++IW  L   K  F         ++T I + ++R   +   FD++  +       +  + E+I ++D  +E    +  E+  +  + +L   S  +     Q      LV+ ++V++ +       + D+S  N M    NL  FY ++ R  +  RYL+KL  +H + +NY+E   TLL  S   +WS ++    F   E+   + + Q+K  L +  + YF+K   WE+ I +CKEL + Y     D+  LS    K ++  + IM   RP+ + + + + G+G+P F+ +   K  + R K      +    L SQF           P D    S  + I    V+P   I P + + K V  +I+ +Y +  ++ F Y R +     DP        I+        KLP IL               F+  LS +E  I               E  +S ++K+ ++I +Y       ++P+S  +  +V+       + SY  +++  Q + L+   + A       D+   F    +     + +    V +EY V+ LPDL  +   R  +   + R+  +++
Sbjct:  211 MSLYDPIKQKI--ISENYLVRWGSKGFPKEIDMLNNLKVVFTDLGNKDLNREKIYLICQIVRVGRMDLKEINNKKCTLGLRRPFGVAVMDITDIIKGKLECDEEKQFFIPFFPVVAENDFLHSLLNK-VTASRGDSGGQGLWVTMKPLVGDIVQIRKEYPHLVDRSTVVARKLGFPEIIMPG---DVRNDIYLTIQSGDFDKYNKTTQKNVEVIMWVCDEEGKVIQNSICLGAGD-KPVSEYRSVIYYQIKQPRWMETFKVAVPLEEMH-----RIHLRFMFRHRSSQESKDKSEKNFAMAFVRLMKEDGTVL-----QDGLHDLVVFKGDSKRMEDVNSYLSLPSTRNHHSDQHKGVGLNR----SSSMSVGGGLSVSSRDSFTISTLVCSTKLTQNVGLLGLLKWRTKPEFLKENLEK----LKIIDGEEVVKFLQDTLDALFNIMMEHSQTDDY---DIL-VFDALIYIIGLIADRKFQHFNTVLEAYIKQ--HFSATLAYKKLMSVLKRYLDVSSRGEQCEPILRTLKALEYIFKFIVRS-----RMLYSQLYEGKEQTDFEESLKRLFESINNLMRTDYTTTLLLRVAALKYLPTVLHDVEKVFDAKLLSQLLHDFYSCIPPEKLQKQKVASMTEIVSSQLFQKKECRDVLLPMMLRELGKALASMADGPHDER-RNSLELLNNILEVLSRNNVGETFQ-HIQDIVVSLLRIINRTVITMGREHALI--------------SR--------------VVACMTAILSQMDDHHYAKYIET------FAGS---TDLVDFLMESFLLFKDLIGKHVYPS------------------------------------DWMAMIMVQNRVFLRAINT---------YAVTMNQKFLN----------NDDFEVQLWNNYFHLAVAFITQESLQLQHFSPTKRNKIL---VKYGDMRRLIG-FAIRDIWYKLGSHKICFIPGMVGPILEMTLIPDEELRRATIPIFFDMITCEHTQFGNFQKFENEIILKLDHEVEGGGGD--EQYMQLLETILLDCSAERPMLKPQVQHFVSLVKGLLVRLLDYRTV---MGDDSRNNRMSCTVNLLNFYKDINREGMYIRYLYKLRDLHLEGENYTEAAYTLLLHSRLLKWSDDMCSPQF---EFHGSQTQRQLKETLYDTIIDYFDKGKMWEEAITLCKELAEQYENEIFDYELLSKRLEKQAKFYENIMKILRPKPDYFAVGFYGQGYPPFLRN---KVFIHRGKEYERREDFQNHLMSQFPSAVRLNTTTMPGDEYKNSPLQYIQCFTVQPVLEI-PPRLKNKPVPDQIINFYKSNYVQRFHYSRPVRKGPVDPDNEFASMWIERTTFTTVYKLPGILRW-------------FETTLSPLENAI---------------ETMESTNEKILNMINQYQADWSLPINPLSMLLNGIVDPAVMGGLSVSYFLQLIPWQCIPLLGGGI-ALHGKRVTDDLRPFHERMEECFKQLKKK---VEKEYGVRELPDLDERKSTRPRSMLRSFRQSVISI 1589          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Medaka
Match: ENSORLT00000012503.2 (dedicator of cytokinesis protein 3 [Source:NCBI gene;Acc:101165978])

HSP 1 Score: 127.872 bits (320), Expect = 9.072e-29
Identity = 210/901 (23.31%), Postives = 367/901 (40.73%), Query Frame = 1
Query:   37 WLNYEEGDCFAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKI----------------LSNDIYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERR--YDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKLSDSTIDY--------VSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAI--IMKDIQYGKSQK-IFLVFHFIRKGPMCLTKKTIKEGVP---YRRPKGVSVIEVTNVM--TENLDSEKQIGIQLITRD------ECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDISDRNVMV----------LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNK----VVMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPL-FEKFSKFPPHTHIRFIIWHRSLNDRS-KNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKN--LPDSENQLDKFIQDTMHFDVHKQIFRELINN------------KPESDSNILRATDWFIKIAVKSFQNYEREMLGNIDEA--SLFNELADSYLHILE-DLASSKDKPILRSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSCS---DLDANM---KSELTMNCMNSKLFVDSQCRSIILPETTKNI 2499
            W+  EE +   + I N++ +  Q + L  G+ + I E   GWYRG+   +P I  +FP+S++ +                L + I  E  + +  W    +  Y+      F K+   +   I  RR     ++ + +  E  R   + ++D   + LGL    R E  E +D + +SV +LY  H       ++ +  SDS+           VS ++ +   +F  + +++   D ++  +  + R+  +ISE +  R+       +  +A+ +  +  D+     ++ +++V H +R G M L     K+G+P   YRRP G +V+ +++V     +L  EK   +++ T +      +  EN   K  T Y      Y   I++QL     E I   N  V          LG  D   P   RN    LYL L   E ++  K    N EV + +    G+     + + S +     EY S + YHN  P+W E++ +P+  ++F      +H+RF   H S  D+  K   G A+  L  +D   +     +D  H L +YK D       + L     Y   P      N  PT    +          K+T +V TI+CST+ T +  L  + N       IL  L      ++ I   E+ KF   +L++   L+   TD    G  + + L  +   +++         +D +IQ+  HF      ++ELI              + +     +RA ++  K  V+S   Y R   G  +E       EL  S   +L  D  SS++    ++ +L     I + L+ +     +A  V   L S     D+  +M   K +     + S+LF   + RSI+LP    +I
Sbjct:    2 WIPTEE-EKIGVVICNFRSSVCQALILEIGETVQILEKCDGWYRGYSTKKPSIKGIFPISYVHLKKSTVTNRGLCETVVPLEDPIITETTSTLQEWGILWKQLYVKHKVDLFHKLRHVMNELIDLRRQLIQGHLSQEQTREIKRHITV-RLDWGNEHLGLDLVPRKEF-EMVDPDQISVSELYKLHVSSRHCGQQSTNQSDSSKQRHGDGCRVPVSHHLFINLKSFTYNSISE---DADVFFFLYDTREAKQISEKFMVRLNKNGGPKNPEKADRLCALFTDLSSKDLKRDLYIVAHVVRTGRMLLNDS--KKGLPHVQYRRPYGCAVLAMSDVFHTITDLKEEKDFVLKIYTCNNENEWYQIHENIIRKSNTKYSAPSTNYGLIISLQLLRGELEQIRRENQAVFNRALALTRKLGFPDVILPGDIRND---LYLTLERGEFERGGKSVQKNIEVTLYVLYADGDTLKDCISLGSGELNS-SEYRSFVLYHNNSPRWSEMVKLPIPIDRFRG----SHLRFEFRHCSTKDKGEKKLFGFAFTPLMREDGTTL-----SDEIHELYVYKCDENTTFSNQGL-----YLSLPCCKEDFNSCPTLPANLPFQRSP----KETFWVSTILCSTKLTQNVDLLALLNWKAHPDRILDILGR----LRQISGEEIVKFLRDVLDTLFCLLDDNTDK--YGPLVFQSLVYIINLLRDSRFYHFRPVMDAYIQN--HF-AGALAYKELIRCLKWYMDRSAEVVRQDHIQEAMRALEYLFKFIVQSRILYSRATCGREEEQFRVSIQELFQSIRFVLSLDSRSSENLVFTQAALLNSFPDIFDELLQMFTVQEVAEYVRGTLGSMPSTVDIGQSMDVVKLQSIARTVESRLFFFPESRSILLPVVLHHI 863          

HSP 2 Score: 72.0182 bits (175), Expect = 8.081e-12
Identity = 85/350 (24.29%), Postives = 150/350 (42.86%), Query Frame = 1
Query: 3280 QPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKK--------TELITQIDQAMESAYS--NYCE-------------EMTKAFKQVLSSNTKYAFDSQLVENIIVQMNNIEECSHHLN-DNSPINGMIVINNLRKFY-NEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRN 4251
            QP L LE L  +   + ++       D+R+  A ++ ++WQ L   K  F       F  +T +   +IR + +    D+  +D E +K         EL+ ++D  +       N+ E              + +  +Q     T  +F +  V  ++ ++ +  +C      ++  I G +   NL  FY +E+ + D+  RY+ KL  +H + ++++E   TLL      QW    +   FL   +  C+ E+Q K  L  + L YF K   WE GI +C+EL   Y E   D+  LS +    +     I+ + R E   + + + GK FP F+ +   K  V R 
Sbjct: 1046 QPSLQLEALGPAKRKKTLDKY----SDMRVIMAYELCSMWQKLGENKPHFIPGMMGPFLGVTLVPQPEIRNIMIPIFHDM--MDWEQRKNGNFKQVEAELMDKLDSMVSDGKGDDNHRELFSLLTQLFGPYPSLLEKIEQETWRETGISFVTS-VTRLVERILDYRDCMKGDEVESKKIGGSV---NLMNFYKSEVNKEDMYIRYIHKLCDLHLQAEDFTEAAFTLLLYWELLQWEDRPL-RDFL---HYPCQSEWQRKENLSRKILHYFNKGKCWEYGISLCRELAFQY-ETLYDYQSLSWIRKMEAAYYDNIIEQQRIEPEFFKMGFYGKKFPFFLRN---KEFVCRG 1377          
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Medaka
Match: dock4b (dedicator of cytokinesis 4 [Source:NCBI gene;Acc:101157988])

HSP 1 Score: 106.686 bits (265), Expect = 2.199e-22
Identity = 222/1059 (20.96%), Postives = 433/1059 (40.89%), Query Frame = 1
Query:  103 QH-MELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPM-------SHIK---------ILSNDIYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERR--YDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKLSDSTIDYVSLYIK-LLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYGKS---QKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQIGIQLITRD----ECLENNAEKLITDYRINKREYSSTINIQL-----KTIRPEDIS--DRNVMV---LGL-DPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQG-----NKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPLFEKFSKFPPHTHIRFIIWHRSLNDRS-KNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYK----MDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNLPDSENQLDKFIQDTM---HFDVHKQIFRELIN------------NKPESDSNILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPI-----LRSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSC-------SDLDANMKSELTMNCMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLHRPLMVL---------VSVIITFLSYISDKLWEFIVR--KQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKST 3021
            QH + L  GD + I E   GWYRGF    P I  +FP        +H+K          + + +  E+ + +  W    +  Y+  +   F ++   +   +  RR     ++   +M +  ++ +  ++D   + LGL    R E    +D + +SV +LY   +  +   R+    + ++  ++ +++K L++ N        E L++   +Y  + R+   +SE +  R+          +        +  G S   + +++V H IR G M   +K     V YRRP G +V+ + +++T +   +  + +     +    +  EN  +K  + Y ++       + +QL     + +R E +    R V +   LG  D   P   RN    LY+ L   E +K  K    N E+ + + D  G     N     S +  G DEY S++ YHN  P+W E I +P+     +    +H+RF   H S  D+  K   G +++ L  +D   +      D  H L I+K     ++    R   L C             K   P+   Q + ST      K++ ++ + +CST+ T +  + ++       + IL  L      +K ID +E+ KF    L+ +LD +    D++   +  L++   +   I  L DS+ Q  K + DT    HF      +R+LI                +    +L+A+++  K  ++S + +     G  +E   F          +    S ++K I      +++ L+    I + L+ +     +A  V   L S        S L+A +K +     + ++L+++ + R I+LP   + +         + + +++RD   +   I   M+  I+  E   + +  E +     ELI+E  +      ++ T +E  +R +S G     P M L         V+ ++  L  ++D+ ++ +++    KDD        + D    I  +FR++   +M P        +  ++RL +N ++ +T
Sbjct:   22 QHGLPLEIGDTVQILEKCEGWYRGFILKNPNIKGIFPSCFIHLKNAHVKNKGQFETVIPVEDSVITEMTSTLREWGAMWKQLYVKNEGDLFHRLWHVMNEILDLRRQVLVGHLTHDRMRDV-KQHITARLDWGNEQLGLDLVPRQEFS-MVDPDELSVTELYRMMENRH---RKKETPAPASTHHLFVHVKSLMSANL------GEELEVFFHIY--DGREGRPLSERFFVRLNKSGLPKSPEKTERQCTLFVDLGSSDLRKDVYIVVHIIRIGRMGAGEKKNLCSVQYRRPLGCAVVSIADLLTADSKDDHLLKVYTCNTESEWYQIHENIIKKANSRYNLSGSNTGLAVALQLLHGDIEQLRREYMVLFTRGVSITRKLGFSDIIMPGEMRND---LYITLERGEFEKGGKSVARNVEITVYVLDSDGQILKVNHAAAGSGE-PGGDEYHSLVLYHNNSPRWAEQIKLPIPVDMFR---GSHVRFEFRHCSTKDKGEKKLFGYSFVPLMQEDGRTL-----PDGTHELIIHKCEENTNLADCSRYLKLPCS------------KANLPS-NNQTLKST------KESFWITSFLCSTKLTQNGEMLDLLKWRAHPERILDSLSK----LKEIDGSEIVKF----LQDTLDTLFGILDENS-QRYGLKVFDSLVHIINLLQDSKFQHFKPVMDTYIESHF-AGALSYRDLIKVLKWYVDRIVDAEHQDHIQQVLKASEYIFKYIIQSRRLFSLATGGQNEEE--FRMCIHELFMSIRFFLSQENKGISPVAQTQAVFLKTFPAIYSELLKIFTVREVASFVRETLASLPSSVHPESPLEA-VKLQCIAKTVETQLYINPESRCILLPVVLRVL---------QTHMQEQRDL-VMCARILTSMMSLIKKEENGTEPTVSEEV-----ELIVESLL----GVLMRTILEISNRPQSAG-----PAMRLQFQDVTGEFVACLLALLRQMTDRHYQKLLQAFSSKDD--------LRDFLLHIFTVFRILIRPEMFP-------KDWTVMRLVTNNVIITT 984          

HSP 2 Score: 76.6406 bits (187), Expect = 3.466e-13
Identity = 80/327 (24.46%), Postives = 140/327 (42.81%), Query Frame = 1
Query: 3280 QPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKT--------ELITQIDQAMESAYSN--YCEEMTKAFKQVLSSNTKYAFDSQLVENIIVQMNNIEECSHHLN----DNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKED-WEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFI 4215
            QP L LE    S   +++E      GD+R+    +I ++WQ+L   K  F       F ++T +    +R + +    D+  +D E +++        +LI ++D  M     +  Y E       + +   T       L+  +   M  + +    +     D   I   + + N  K   E+ + ++  RY+ KL  +H K +NY+E   TLL      +WS   +   FL    +    E+Q K  L    ++ F++   WE GI +C+EL   Y  Y+ D+  LS +    + L  KIM + R E   + + + GK FP F+
Sbjct: 1019 QPCLQLESFSPSKKKKILEKY----GDMRVMMGCEIFSMWQNLGEHKLNFIPAMIGPFLEVTLVPQPDLRNVMIPIFHDM--MDWEQRRSGNFKQVEAKLIDKLDSLMSEGKGDETYRELFNSILLKKIERETWRESGISLIATVTRLMERLLDYRDCMKLGEVDGKKIGCTVSLLNFYK--TELNKEEMYIRYIHKLYDLHLKAQNYTEASYTLLLYDELLEWSDRPL-REFLNYPMQS---EWQRKEYLHITIIQNFDRGKCWENGIILCRELADQYESYY-DYRNLSKMRMMEASLYDKIMDQQRLEPEFFRVGFYGKKFPFFL 1332          
BLAST of dedicator of cytokinesis protein 5 vs. Planmine SMEST
Match: SMESG000068985.1 (SMESG000068985.1)

HSP 1 Score: 3514.93 bits (9113), Expect = 0.000e+0
Identity = 1756/1756 (100.00%), Postives = 1756/1756 (100.00%), Query Frame = 1
Query:   31 MKWLNYEEGDCFAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKILSNDIYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERRYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKLSDSTIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYGKSQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQIGIQLITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDISDRNVMVLGLDPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPLFEKFSKFPPHTHIRFIIWHRSLNDRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNLPDSENQLDKFIQDTMHFDVHKQIFRELINNKPESDSNILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNCMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKTELITQIDQAMESAYSNYCEEMTKAFKQVLSSNTKYAFDSQLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKEDWEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNKRNVSEMSIDLNSQFEYTTVERKYPEPEDFASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRIIDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRYVSPVSGGVTKLVEMIPNNDDNFSYTSEVVNQVLSLIYQYLQAFEIYDTLDNYMIFVSAFQNLCSSVSRSLDLVSEEYNVKILPDLYSKSKKRETNFTATIRRPSVALRVRHDDDVVSRKWKNNLDTRPEIISERWSNSYXXXXXXXXXXXXXXXXXXTVTSDSRTVXXXXXXXXXXXSRNMTS 5298
            MKWLNYEEGDCFAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKILSNDIYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERRYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKLSDSTIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYGKSQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQIGIQLITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDISDRNVMVLGLDPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPLFEKFSKFPPHTHIRFIIWHRSLNDRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNLPDSENQLDKFIQDTMHFDVHKQIFRELINNKPESDSNILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNCMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELIISSVECISSIITQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKTELITQIDQAMESAYSNYCEEMTKAFKQVLSSNTKYAFDSQLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKEDWEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNKRNVSEMSIDLNSQFEYTTVERKYPEPEDFASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRIIDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRYVSPVSGGVTKLVEMIPNNDDNFSYTSEVVNQVLSLIYQYLQAFEIYDTLDNYMIFVSAFQNLCSSVSRSLDLVSEEYNVKILPDLYSKSKKRETNFTATIRRPSVALRVRHDDDVVSRKWKNNLDTRPEIISERWSNSYDGPISSSDSRESIFSGRSTVTSDSRTVIPGPPPIPPKPSRNMTS
Sbjct:    1 MKWLNYEEGDCFAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKILSNDIYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERRYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKLSDSTIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYGKSQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQIGIQLITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDISDRNVMVLGLDPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPLFEKFSKFPPHTHIRFIIWHRSLNDRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNLPDSENQLDKFIQDTMHFDVHKQIFRELINNKPESDSNILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNCMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELIISSVECISSIITQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKTELITQIDQAMESAYSNYCEEMTKAFKQVLSSNTKYAFDSQLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKEDWEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNKRNVSEMSIDLNSQFEYTTVERKYPEPEDFASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRIIDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRYVSPVSGGVTKLVEMIPNNDDNFSYTSEVVNQVLSLIYQYLQAFEIYDTLDNYMIFVSAFQNLCSSVSRSLDLVSEEYNVKILPDLYSKSKKRETNFTATIRRPSVALRVRHDDDVVSRKWKNNLDTRPEIISERWSNSYDGPISSSDSRESIFSGRSTVTSDSRTVIPGPPPIPPKPSRNMTS 1756          
BLAST of dedicator of cytokinesis protein 5 vs. Planmine SMEST
Match: SMESG000068985.1 (SMESG000068985.1)

HSP 1 Score: 3514.55 bits (9112), Expect = 0.000e+0
Identity = 1758/1763 (99.72%), Postives = 1758/1763 (99.72%), Query Frame = 1
Query:   31 MKWLNYEEGDCFAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKILSNDIYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERRYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKLSDSTIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYGKSQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQIGIQLITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDISDRNVMVLGLDPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPLFEKFSKFPPHTHIRFIIWHRSLNDRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNLPDSENQLDKFIQDTMHFDVHKQIFRELINNKPESDSNILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNCMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELXXXXXXXXXXXXTQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKTELITQIDQAMESAYSNYCEEMTKAFKQVLSSNTKYAFDSQLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKEDWEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNKRNVSEMSIDLNSQFEYTTVERKYPEPEDFASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRIIDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRYVSPVSGGVTKLVEMIPNNDDNFSYTSEVVNQVLSLIYQYLQAFEIYDTLDNYMIFVSAFQNLCSSVSRSLDLVSEEYNVKILPDLYSKSKKRETNFTATIRRPSVALRVRHDDDVVSRKWKNNLDTRPEIISERWSNSYXXXXXXXXXXXXXXXXXXTVTSDSRTVXXXXXXXXXXXSRNMTSYGCYSMP 5319
            MKWLNYEEGDCFAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKILSNDIYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERRYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKLSDSTIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYGKSQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQIGIQLITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDISDRNVMVLGLDPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPLFEKFSKFPPHTHIRFIIWHRSLNDRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNLPDSENQLDKFIQDTMHFDVHKQIFRELINNKPESDSNILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNCMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELIISSVECISSIITQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKTELITQIDQAMESAYSNYCEEMTKAFKQVLSSNTKYAFDSQLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKEDWEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNKRNVSEMSIDLNSQFEYTTVERKYPEPEDFASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRIIDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRYVSPVSGGVTKLVEMIPNNDDNFSYTSEVVNQVLSLIYQYLQAFEIYDTLDNYMIFVSAFQNLCSSVSRSLDLVSEEYNVKILPDLYSKSKKRETNFTATIRRPSVALRVRHDDDVVSRKWKNNLDTRPEIISERWSNSYDGPISSSDSRESIFSGRSTVTSDSRTVIPGPPPIPPKPSRNMTS    S P
Sbjct:    1 MKWLNYEEGDCFAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKYTQPCILKVFPMSHIKILSNDIYPELWAEMFSWITYIRDSYLLVDTTDFDKITEAIQLAISERRYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRNEKGEKIDLNTVSVIDLYAQHQREYESSRRVSKLSDSTIDYVSLYIKLLNVNFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRANAIIMKDIQYGKSQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIEVTNVMTENLDSEKQIGIQLITRDECLENNAEKLITDYRINKREYSSTINIQLKTIRPEDISDRNVMVLGLDPYYPATNRNQRNCLYLNLHHAEIDKERKKSDPNFEVEISIRDYQGNKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVICIPLFEKFSKFPPHTHIRFIIWHRSLNDRSKNPRGVAYMKLFPDDNNAILSKNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTEQMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKLHNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEMFKAIKNLPDSENQLDKFIQDTMHFDVHKQIFRELINNKPESDSNILRATDWFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPILRSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNCMNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNICNEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYLSRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEARRMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQVIQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNLRTMQSGLCFCHPTEKMQFELIISSVECISSIITQPFLNLEKLPSSVALRMIESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNFKIRVLAVECLFDIVHLDRENKKTELITQIDQAMESAYSNYCEEMTKAFKQVLSSNTKYAFDSQLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKFYNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHHSFLPSEYEDCEFEFQVKAKLLEESLKYFEKEDWEKGIEVCKELIKGYTEYFIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPKKSIVIRNKRNVSEMSIDLNSQFEYTTVERKYPEPEDFASADKKIFYMPVKPSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRIIDGRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIEYQIRKDEMLYQDYETADSEKRQSLHQKMKDIILRYVSPVSGGVTKLVEMIPNNDDNFSYTSEVVNQVLSLIYQYLQAFEIYDTLDNYMIFVSAFQNLCSSVSRSLDLVSEEYNVKILPDLYSKSKKRETNFTATIRRPSVALRVRHDDDVVSRKWKNNLDTRPEIISERWSNSYDGPISSSDSRESIFSGRSTVTSDSRTVIPGPPPIPPKPSRNMTSISNQSEP 1763          
The following BLAST results are available for this feature:
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DOCK19.448e-6922.15dedicator of cytokinesis 1 [Source:HGNC Symbol;Acc... [more]
DOCK18.475e-6721.93dedicator of cytokinesis 1 [Source:HGNC Symbol;Acc... [more]
DOCK21.269e-5821.64dedicator of cytokinesis 2 [Source:HGNC Symbol;Acc... [more]
DOCK55.028e-4423.78dedicator of cytokinesis 5 [Source:HGNC Symbol;Acc... [more]
DOCK51.444e-3224.66dedicator of cytokinesis 5 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ced-51.015e-1320.90CED-5 [Source:UniProtKB/TrEMBL;Acc:G5EEN3][more]
ced-51.015e-1320.90CED-5 [Source:UniProtKB/TrEMBL;Acc:G5EEN3][more]
back to top
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbc1.621e-3124.00gene:FBgn0015513 transcript:FBtr0304729[more]
mbc1.635e-3124.00gene:FBgn0015513 transcript:FBtr0084459[more]
spg3.074e-2625.54gene:FBgn0264324 transcript:FBtr0330304[more]
spg3.328e-2625.54gene:FBgn0264324 transcript:FBtr0330303[more]
spg3.328e-2625.54gene:FBgn0264324 transcript:FBtr0336766[more]
back to top
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dock51.407e-3822.46dedicator of cytokinesis 5 [Source:ZFIN;Acc:ZDB-GE... [more]
dock11.217e-2526.19dedicator of cytokinesis 1 [Source:ZFIN;Acc:ZDB-GE... [more]
DOCK44.303e-2221.90si:dkey-81e3.1 [Source:ZFIN;Acc:ZDB-GENE-120703-34... [more]
dock4b7.931e-2021.71dedicator of cytokinesis 4b [Source:ZFIN;Acc:ZDB-G... [more]
dock4b7.961e-2021.71dedicator of cytokinesis 4b [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
afg3l1p1.854e-7223.01AFG3-like AAA ATPase 1, pseudogene [Source:Xenbase... [more]
DOCK11.385e-6322.79dedicator of cytokinesis 1 [Source:NCBI gene;Acc:1... [more]
afg3l1p2.806e-6222.73AFG3-like AAA ATPase 1, pseudogene [Source:Xenbase... [more]
afg3l1p1.752e-6122.87AFG3-like AAA ATPase 1, pseudogene [Source:Xenbase... [more]
afg3l1p2.060e-6122.87AFG3-like AAA ATPase 1, pseudogene [Source:Xenbase... [more]
back to top
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dock21.709e-6121.68dedicator of cyto-kinesis 2 [Source:MGI Symbol;Acc... [more]
Dock51.507e-4423.65dedicator of cytokinesis 5 [Source:MGI Symbol;Acc:... [more]
Dock11.396e-3722.64dedicator of cytokinesis 1 [Source:MGI Symbol;Acc:... [more]
Dock11.398e-3425.00dedicator of cytokinesis 1 [Source:MGI Symbol;Acc:... [more]
Dock22.467e-3322.23dedicator of cyto-kinesis 2 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of dedicator of cytokinesis protein 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q14185|DOCK1_HUMAN4.537e-6822.15Dedicator of cytokinesis protein 1 OS=Homo sapiens... [more]
sp|Q8C3J5|DOCK2_MOUSE1.195e-6021.68Dedicator of cytokinesis protein 2 OS=Mus musculus... [more]
sp|Q92608|DOCK2_HUMAN6.095e-5821.64Dedicator of cytokinesis protein 2 OS=Homo sapiens... [more]
sp|B2RY04|DOCK5_MOUSE1.054e-4323.65Dedicator of cytokinesis protein 5 OS=Mus musculus... [more]
sp|Q9H7D0|DOCK5_HUMAN2.415e-4323.78Dedicator of cytokinesis protein 5 OS=Homo sapiens... [more]
back to top
BLAST of dedicator of cytokinesis protein 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087Y9F92.788e-7522.72Dedicator of cytokinesis 5 OS=Poecilia formosa OX=... [more]
A0A3P9Q9223.913e-7523.02Dedicator of cytokinesis 5 OS=Poecilia reticulata ... [more]
A0A096MDE61.004e-7422.81Dedicator of cytokinesis 5 OS=Poecilia formosa OX=... [more]
A0A3B4XQB91.603e-7423.35Dedicator of cytokinesis 5 OS=Seriola lalandi dors... [more]
M3ZNG43.910e-7322.68Dedicator of cytokinesis 5 OS=Xiphophorus maculatu... [more]
back to top
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dock12.164e-5822.18dedicator of cytokinesis 1 [Source:ZFIN;Acc:ZDB-GE... [more]
DOCK21.795e-4721.40dedicator of cytokinesis 2 [Source:NCBI gene;Acc:1... [more]
dock54.371e-3326.39dedicator of cytokinesis 5 [Source:ZFIN;Acc:ZDB-GE... [more]
dock4b4.757e-1622.53dedicator of cytokinesis 4b [Source:ZFIN;Acc:ZDB-G... [more]
si:dkey-81e3.14.221e-1521.49dedicator of cytokinesis 4 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000007652.11.054e-2220.20pep scaffold:Pmarinus_7.0:GL478924:2687:150863:1 g... [more]
ENSPMAT00000010350.11.153e-2226.65pep scaffold:Pmarinus_7.0:GL476865:2751:57127:1 ge... [more]
ENSPMAT00000010277.11.760e-2123.19pep scaffold:Pmarinus_7.0:GL478006:150137:181148:-... [more]
ENSPMAT00000008301.16.441e-1926.74pep scaffold:Pmarinus_7.0:GL477297:188469:211033:-... [more]
back to top
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DCK12.400e-627.27Dock family protein (Dedicator Of CytoKinesis), ho... [more]
back to top
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO487941.139e-2423.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318721.483e-1422.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of dedicator of cytokinesis protein 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dock12.336e-6521.77dedicator of cytokinesis 1 [Source:NCBI gene;Acc:1... [more]
dock57.324e-6322.82dedicator of cytokinesis 5 [Source:NCBI gene;Acc:1... [more]
DOCK21.154e-4222.09dedicator of cytokinesis 2 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000012503.29.072e-2923.31dedicator of cytokinesis protein 3 [Source:NCBI ge... [more]
dock4b2.199e-2220.96dedicator of cytokinesis 4 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of dedicator of cytokinesis protein 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000068985.10.000e+0100.00SMESG000068985.1[more]
SMESG000068985.10.000e+099.72SMESG000068985.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021567 ID=SMED30021567|Name=dedicator of cytokinesis protein 5|organism=Schmidtea mediterranea sexual|type=transcript|length=6102bp
CGAAGGTTTAAATTTATCAAATATTAAATTATGAAGTGGTTAAATTATGA
GGAAGGCGATTGCTTTGCAATTGCTATCTATAATTACAAGCCAGCTAATT
CTCAGCATATGGAGTTAAGATCTGGCGATTATCTTTTTATTCGTGAACAT
TATCCAGGATGGTATCGAGGATTCAAATATACTCAACCATGCATATTAAA
AGTCTTCCCAATGTCTCACATTAAAATCTTATCTAATGATATCTATCCGG
AATTATGGGCAGAAATGTTTTCATGGATAACATATATTCGTGATTCTTAC
CTGCTGGTCGACACAACGGATTTCGACAAAATTACCGAAGCAATTCAGCT
AGCAATATCTGAAAGACGTTATGATTCAAATATTGAAAAATCCAAAATGA
TTGAATCAAACAGAAGGGCATTGATTCAAAAAATGGATCTAGCAAGAAAA
GCACTCGGCTTGCCTACTGAATCTCGAAATGAGAAGGGAGAAAAAATTGA
TCTCAACACAGTTTCAGTTATTGATCTATATGCTCAACACCAGCGTGAGT
ACGAGAGCAGTCGGAGGGTCTCAAAACTCTCAGATTCGACCATTGATTAT
GTATCTCTTTATATAAAACTATTAAATGTCAATTTTGAACGATCTCAATT
GGCAGATGAAATTTTAGATATTAATATTACTCTCTATAAATTGGAGGATC
GAAAAATCACCCGTATCAGTGAAACCTACTCGCATAGAGTTGCCATTCGT
AGCTACGGGTGTGATCTTATTCGCGCCAACGCCATCATAATGAAGGATAT
TCAATATGGTAAAAGTCAAAAGATTTTCCTAGTCTTTCATTTTATACGGA
AAGGTCCAATGTGTTTAACTAAAAAAACGATTAAAGAAGGAGTACCATAT
CGCCGGCCAAAAGGTGTATCGGTGATTGAAGTGACAAATGTTATGACTGA
AAACCTAGACTCCGAAAAACAAATTGGAATACAATTAATAACGAGAGATG
AATGCTTGGAAAATAATGCTGAGAAATTGATTACTGATTATCGCATAAAT
AAACGAGAATATAGCAGTACGATAAATATTCAACTAAAAACAATAAGACC
GGAAGATATTTCTGATAGAAACGTTATGGTTCTTGGTTTGGACCCATATT
ATCCAGCGACTAATCGAAATCAACGAAATTGTTTATATTTAAATCTCCAC
CATGCAGAAATTGATAAGGAGAGAAAGAAATCAGATCCAAATTTCGAAGT
CGAAATCTCCATTAGAGATTACCAGGGTAACAAAGTAGTCATGCCTTCAT
TCGACTGGCGCGGTTTTGATGAATATTCCAGTGTGATATACTATCACAAT
GCTAAGCCAAAATGGTGTGAAGTAATATGCATTCCTTTATTTGAAAAATT
TTCAAAGTTTCCTCCTCATACTCATATACGTTTTATCATTTGGCATCGGT
CGTTAAATGACAGAAGCAAGAACCCACGTGGTGTTGCCTATATGAAATTA
TTTCCAGATGACAACAATGCTATATTGTCAAAAAATGAAAACGATAATTA
TCATTCTCTTACAATTTATAAAATGGACATGGAGAAGATTAAGCGAGCTG
AATATTTGACCTGCCATCCTGAATATGAGGGGGATCCTGAATTATATTCA
ATTAAAAATCGACATCCAACATTTACCGAGCAAATGATGAATTCTACAAG
AAAAAAAGTAGTTCTCAAAGATACTCTCTTCGTACAAACGATCGTATGTT
CAACCGAATATACGTTTGATAAGCTCCTTGCTAATATATGTAACCAATCC
TTGGAGGATCAAACAATACTCCATAAGCTACATAACGAGGAGATTATCGT
CAAAAATATTGATGTCAATGAACTCAAAAAATTTAGTACGAAAATCTTGG
AATCAAGTTTGGATTTGATTCAACAGGCCACTGATGATTCATATCTTGGT
AAGAATATTCTTGAATTACTGGGGGAAATGTTCAAGGCGATAAAGAATCT
ACCAGATAGTGAAAACCAGTTGGATAAATTCATCCAGGACACGATGCATT
TCGATGTGCACAAACAGATTTTTCGTGAACTTATTAACAATAAACCAGAA
AGTGACAGTAACATCCTTCGGGCAACCGACTGGTTTATCAAGATAGCCGT
TAAATCTTTTCAAAATTATGAGCGAGAAATGCTCGGTAATATAGATGAGG
CGAGTTTATTCAATGAATTGGCCGACAGTTATTTGCACATTCTCGAAGAT
TTGGCCAGCAGCAAAGACAAACCGATTTTGCGAAGCCTCGTGTTACGTAA
GGCAGGTTTAATTATAAATGCGTTGATTCCTGTGTGTCAGCCAATCGGAA
TGGCGAGGCTTGTGAATAATTTGCTGAAAAGCTGTAGCGATCTCGATGCG
AATATGAAATCAGAATTGACAATGAATTGTATGAACTCCAAACTGTTTGT
CGACTCGCAATGCCGATCAATTATTCTTCCAGAAACGACCAAAAACATTT
TAGAACTGTTTAATTTTCAACTCAATAAGATTTACAATGAAAAAGAGAGG
GATCAGGATCAATTATTAGATAATATTTGTAATGAAATGATTGAATTTAT
CCAACTTCATGAACGAAGCTGGCAAAAATCGCCACCGGAAATTTTAAATA
ATCTTGTGTATGAATTAATCATTGAGCATAAAATGCTCCGGTCATGTGTA
GCAATTGTTTCAACGGGAATGGAATACTTATCTAGATCTGAGTCGAACGG
AAAGCTTTTGCATCGGCCATTAATGGTTCTGGTCAGTGTTATCATAACGT
TCTTGTCGTATATCAGTGACAAATTGTGGGAATTTATCGTTAGGAAACAA
AAGGACGATTGTCAGTTTTGTGAAGCCAGGCGAATGACTGACAATTACGA
CATGATCATGGAGTTGTTTAGATTAATTTGTGAGCTTCAGATGAATCCCG
TGTTTCCGAGCTTTAAAGTGGCCGAAAAAGAAATCGTCAGATTGTCGAGC
AACACTATTTTAAAATCTACATCTCAGGTAATTCAGTCGACTTCATCTGC
TTCCAAAGTGAACAGACAAGCTTGGATGAACATGTTGTTTGTTCAAAGTC
GGCAGTTTCTTGCGACTCTGAAACAAATCCACAACATAATTTTGAAACCG
TATTATTTAACAGGCCTCAGTCAGAATCTGCGAACTATGCAAAGCGGGTT
ATGCTTTTGTCATCCGACCGAAAAAATGCAGTTTGAATTAATAATAAGCT
CTGTTGAATGCATCAGTTCAATTATCACACAGCCGTTTTTGAATCTGGAA
AAGTTACCATCATCTGTGGCTTTGAGAATGATAGAGAGTTCAATTGAATG
GGGTGGAGATATTCGTCTGAGTGGTGCTGTTCAAATAAAAAACATTTGGC
AAGATCTTGATATTCTAAAAAATCGGTTTTCGATGAACTTTTTCAACATT
TTCGCCAAGCTGACCACGATTCAAAATTTCAAAATTCGTGTGTTGGCTGT
TGAGTGCTTGTTCGATATTGTCCATTTGGATCGGGAAAACAAGAAAACCG
AGTTAATTACCCAGATTGATCAGGCTATGGAGTCGGCATATTCGAATTAT
TGTGAAGAAATGACAAAGGCATTCAAACAAGTCCTTAGCAGTAACACCAA
ATACGCATTTGACAGTCAGTTGGTGGAGAATATCATTGTGCAAATGAATA
ACATTGAGGAATGTTCCCATCATCTCAATGACAATTCCCCCATCAACGGA
ATGATTGTTATAAATAATTTGCGAAAATTCTATAACGAAATGGGTCGGTC
AGACATCATTGGGAGATATCTGTTCAAGCTGATGACGATACATGAGAAAA
TCAAAAATTATTCAGAAATGGGAAACACTTTGTTAGAATTGAGCTCATTT
TATCAGTGGAGCCATGAAATCGTCCATCATTCGTTTTTGCCTTCAGAGTA
TGAGGACTGTGAGTTTGAATTTCAAGTTAAAGCTAAGTTACTCGAAGAGA
GTTTGAAATATTTCGAAAAAGAAGATTGGGAAAAAGGTATTGAAGTGTGT
AAGGAATTGATTAAAGGATACACTGAATATTTTATTGATTTTATAAAATT
GAGTGCTGTCCATAGCAAAATGTCAGAATTATTAAAGAAAATCATGTTTG
AAGATCGGCCGGAATCAAATATGTATATAATATTTTATTTGGGCAAAGGA
TTTCCTAAATTTATCACGGACCTGCCAAAGAAAAGTATTGTGATTCGAAA
TAAACGAAATGTCAGTGAAATGTCCATTGACTTGAATTCACAATTCGAAT
ACACGACAGTGGAACGGAAATATCCCGAACCTGAAGATTTTGCATCGGCA
GATAAGAAAATATTCTATATGCCTGTTAAGCCATCTAGATTCATATTTCC
GACAAAATATGAAGGAAAGATCGTCAAGCAGAGAATATTGAAATACTACG
ATAACTATGAAATCGAGGAATTCATTTACAAAAGATTGATGAATAATACT
GAGGAAGATCCCAGTAAACGAATCATTGATGGTCGCATAATATTGTGTGA
AGAGAAGTTACCGAATATTTTATCAGTAGGTCCAGTAAAGTCTATAGAAA
AGATTCCCATTGATCCGTTCAAGGAAGCTTTGTCGGATATTGAATATCAA
ATTCGCAAGGACGAAATGCTTTATCAAGATTATGAAACCGCAGATTCAGA
AAAGCGACAATCTCTTCATCAGAAGATGAAAGATATAATTCTTCGATATG
TCTCTCCAGTTTCAGGTGGAGTCACAAAACTTGTTGAAATGATACCCAAC
AATGATGATAACTTTTCGTACACATCAGAAGTTGTGAATCAAGTTCTTTC
GTTGATTTATCAGTATTTGCAAGCTTTCGAAATTTATGACACCTTGGACA
ACTACATGATCTTTGTCAGCGCGTTTCAAAATCTCTGTTCCTCTGTCAGT
CGCAGTTTGGATTTAGTCTCCGAGGAATATAATGTTAAAATTCTCCCGGA
TCTTTACTCAAAGTCAAAGAAGAGAGAAACCAATTTCACAGCCACGATAA
GGAGACCGAGTGTCGCTTTGAGAGTTCGACATGATGATGATGTGGTAAGT
CGCAAATGGAAGAACAATTTGGACACCAGGCCTGAAATCATTTCCGAAAG
ATGGAGCAATTCTTACGATGGTCCGATTTCTTCATCAGATTCTAGGGAAT
CAATATTTTCTGGACGTTCTACAGTTACGTCTGATAGTAGAACTGTCATT
CCTGGTCCGCCGCCTATTCCTCCAAAGCCATCTAGAAATATGACTTCTTA
TGGATGTTATTCAATGCCTTTTTCAAATCATCCTTCTATCGAAGAGCTCC
AATTTTTAGAATCAAAATGTACTTATTATTTTATTAAGAATTTAAGAAAG
AATCAGGTGTATGATTTATTTTTTTGCCTACAGCGTATTATTCATAGTAT
TATATAAACATGCCTGATTCTATAACGCTATTCTATACTGAGAATTTTTT
TAACAAGTAAAGTTGTACATTTGGAATCCAAAGCCTATTATTACTAAGAA
AGGTTTGGATCTAAATTTCATCTGTTTCAATAAATAAATATTTTTACCGA
TTGAATTTTTTATATTTACGTATAATAGATCAATAAATTTTATCGTTATC
CTTTAGAATTTTATTGCTCTACTTTAAACAAATGTTAATTTCATGTGAAT
AAGAAAAAGCAAATTAGAAATTTGACCAAATTATTTTTTTTAGAATATGT
GAAAATTTTGTAGTGATTAACAATATTAATATTGGCCAGTTTTGTTGGTG
CCATTACTCACGGTCTTCTGCAATTTGTTGAAACTTGTGAAAAATCTATG
TTATAAATGGTTACTGCTTTTTGTATTTTCAGATTTCTAATCAAAGCGAG
CCCCCTCCGCCACTGAGGCCCCGTTGCGATAGTAATATAAGTTTATTCAA
CTGATTGTTTCCTATTTCGAAATAAAACTTCAAAATATTTACAATTTCCT
TCAATTATTTCTATTTTAAAAGCTCAAAGATTTAATTTTTAAACTGTTTT
TAATTATTTTTTGTAAAGTACTGATATTTTTATACCGTTTTTATTATTTG
AC
back to top

protein sequence of SMED30021567-orf-1

>SMED30021567-orf-1 ID=SMED30021567-orf-1|Name=SMED30021567-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1809bp
MKWLNYEEGDCFAIAIYNYKPANSQHMELRSGDYLFIREHYPGWYRGFKY
TQPCILKVFPMSHIKILSNDIYPELWAEMFSWITYIRDSYLLVDTTDFDK
ITEAIQLAISERRYDSNIEKSKMIESNRRALIQKMDLARKALGLPTESRN
EKGEKIDLNTVSVIDLYAQHQREYESSRRVSKLSDSTIDYVSLYIKLLNV
NFERSQLADEILDINITLYKLEDRKITRISETYSHRVAIRSYGCDLIRAN
AIIMKDIQYGKSQKIFLVFHFIRKGPMCLTKKTIKEGVPYRRPKGVSVIE
VTNVMTENLDSEKQIGIQLITRDECLENNAEKLITDYRINKREYSSTINI
QLKTIRPEDISDRNVMVLGLDPYYPATNRNQRNCLYLNLHHAEIDKERKK
SDPNFEVEISIRDYQGNKVVMPSFDWRGFDEYSSVIYYHNAKPKWCEVIC
IPLFEKFSKFPPHTHIRFIIWHRSLNDRSKNPRGVAYMKLFPDDNNAILS
KNENDNYHSLTIYKMDMEKIKRAEYLTCHPEYEGDPELYSIKNRHPTFTE
QMMNSTRKKVVLKDTLFVQTIVCSTEYTFDKLLANICNQSLEDQTILHKL
HNEEIIVKNIDVNELKKFSTKILESSLDLIQQATDDSYLGKNILELLGEM
FKAIKNLPDSENQLDKFIQDTMHFDVHKQIFRELINNKPESDSNILRATD
WFIKIAVKSFQNYEREMLGNIDEASLFNELADSYLHILEDLASSKDKPIL
RSLVLRKAGLIINALIPVCQPIGMARLVNNLLKSCSDLDANMKSELTMNC
MNSKLFVDSQCRSIILPETTKNILELFNFQLNKIYNEKERDQDQLLDNIC
NEMIEFIQLHERSWQKSPPEILNNLVYELIIEHKMLRSCVAIVSTGMEYL
SRSESNGKLLHRPLMVLVSVIITFLSYISDKLWEFIVRKQKDDCQFCEAR
RMTDNYDMIMELFRLICELQMNPVFPSFKVAEKEIVRLSSNTILKSTSQV
IQSTSSASKVNRQAWMNMLFVQSRQFLATLKQIHNIILKPYYLTGLSQNL
RTMQSGLCFCHPTEKMQFELIISSVECISSIITQPFLNLEKLPSSVALRM
IESSIEWGGDIRLSGAVQIKNIWQDLDILKNRFSMNFFNIFAKLTTIQNF
KIRVLAVECLFDIVHLDRENKKTELITQIDQAMESAYSNYCEEMTKAFKQ
VLSSNTKYAFDSQLVENIIVQMNNIEECSHHLNDNSPINGMIVINNLRKF
YNEMGRSDIIGRYLFKLMTIHEKIKNYSEMGNTLLELSSFYQWSHEIVHH
SFLPSEYEDCEFEFQVKAKLLEESLKYFEKEDWEKGIEVCKELIKGYTEY
FIDFIKLSAVHSKMSELLKKIMFEDRPESNMYIIFYLGKGFPKFITDLPK
KSIVIRNKRNVSEMSIDLNSQFEYTTVERKYPEPEDFASADKKIFYMPVK
PSRFIFPTKYEGKIVKQRILKYYDNYEIEEFIYKRLMNNTEEDPSKRIID
GRIILCEEKLPNILSVGPVKSIEKIPIDPFKEALSDIEYQIRKDEMLYQD
YETADSEKRQSLHQKMKDIILRYVSPVSGGVTKLVEMIPNNDDNFSYTSE
VVNQVLSLIYQYLQAFEIYDTLDNYMIFVSAFQNLCSSVSRSLDLVSEEY
NVKILPDLYSKSKKRETNFTATIRRPSVALRVRHDDDVVSRKWKNNLDTR
PEIISERWSNSYDGPISSSDSRESIFSGRSTVTSDSRTVIPGPPPIPPKP
SRNMTSYGCYSMPFSNHPSIEELQFLESKCTYYFIKNLRKNQVYDLFFCL
QRIIHSII*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR043161DOCK_C_lobe_A
IPR026791DOCK
IPR036028SH3-like_dom_sf
IPR001452SH3_domain
IPR027007DHR-1_domain
IPR032376DOCK_N
IPR027357DHR-2
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005085guanyl-nucleotide exchange factor activity
GO:0005096GTPase activator activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0007010cytoskeleton organization
GO:0007264small GTPase mediated signal transduction
GO:0016477cell migration
GO:0043547positive regulation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001452SH3 domainSMARTSM00326SH3_2coord: 11..68
e-value: 0.0011
score: 28.3
IPR001452SH3 domainPROSITEPS50002SH3coord: 8..69
score: 12.328
IPR027007DHR-1 domainPFAMPF14429DOCK-C2coord: 380..580
e-value: 1.9E-27
score: 96.3
IPR027007DHR-1 domainPROSITEPS51650DHR_1coord: 382..573
score: 23.12
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 382..583
e-value: 1.4E-33
score: 118.2
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 1..70
e-value: 1.6E-8
score: 36.1
IPR043161Dedicator of cytokinesis, C-terminal, lobe AGENE3DG3DSA:1.25.40.410coord: 1228..1376
e-value: 1.5E-33
score: 117.4
IPR026791Dedicator of cytokinesisPANTHERPTHR45653FAMILY NOT NAMEDcoord: 12..1583
IPR027357DHR-2 domainPROSITEPS51651DHR_2coord: 1251..1659
score: 25.149
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 11..69