Proline dehydrogenase

Overview
NameProline dehydrogenase
Smed IDSMED30021565
Length (bp)1980
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Proline dehydrogenase (SMED30021565) t-SNE clustered cells

Violin plots show distribution of expression levels for Proline dehydrogenase (SMED30021565) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Proline dehydrogenase (SMED30021565) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Proline dehydrogenase (SMED30021565) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021565

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30021565SMESG000077440.1 dd_Smed_v4_7017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30021565SMESG000077440.1 dd_Smed_v4_7017_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30021565SMESG000077440.1 dd_Smed_v6_7017_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021565SMESG000077440.1 dd_Smed_v4_7017_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Proline dehydrogenase vs. Ensembl Human
Match: AC007325.2 (proline dehydrogenase 1, mitochondrial [Source:NCBI gene;Acc:102724788])

HSP 1 Score: 457.988 bits (1177), Expect = 1.415e-153
Identity = 225/531 (42.37%), Postives = 336/531 (63.28%), Query Frame = 1
Query:  193 IHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKN-SLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEE 1782
            + F +++ AY +++T E+ R+LLV RLC+   L+  ++++L + R + G+ +F  +MK T YGHFVAG  QE I+ +++  R FGV +ILDY VEED++ E+A+    ++  +  ++     +  + ++Q +  F +RRN VI ARTYFY +E +CD ++E F +CI AS   +++G  F A+KLT++G PQ L+  S++L + + FF   A  + Q   +  + K ++   QE +  + I  S  E   WFT   +     +DL +W +L +    L     + + QTG  + L+   +++  L M RMLQR+D LA+ A +   RLM+DAEQ+YFQPAI R+TLE+ R+FN EKP+IFNTYQCYLKDA + +  D+  A +E + FGAKLVRGAY+ QER RA    Y DPIN TYE T  MY+ C+D +   +    +    VM+ASHN +T++ A+ ++ E  + P +  + FGQLLGMCD ISF LG  G+ VYKY+PYGPV EVLPYLSRRALEN +++  +  E
Sbjct:   53 VDFGNAQEAYRSRRTWELARSLLVLRLCAWPALLARHEQLLYVSRKLLGQRLFNKLMKMTFYGHFVAGEDQESIQPLLRHYRAFGVSAILDYGVEEDLSPEEAEHKEMESCTSAAERDGSGTNKRDKQYQAHWAFGDRRNGVISARTYFYANEAKCDSHMETFLRCIEASGRVSDDG--FIAIKLTALGRPQFLLQFSEVLAKWRCFFHQMAVEQGQAGLAAMDTKLEVAVLQESVAKLGI-ASRAEIEDWFTAETLGVSGTMDLLDWSSLIDSRTKLSKHLVVPNAQTGQLEPLLSRFTEEEELQMTRMLQRMDVLAKKATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCYLKDAYDNVTLDVELARREGWCFGAKLVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAK--VMVASHNEDTVRFALRRMEELGLHPADHQVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVMEVLPYLSRRALENSSLMKGTHRE 578          
BLAST of Proline dehydrogenase vs. Ensembl Human
Match: PRODH (proline dehydrogenase 1 [Source:HGNC Symbol;Acc:HGNC:9453])

HSP 1 Score: 457.988 bits (1177), Expect = 1.874e-153
Identity = 225/531 (42.37%), Postives = 336/531 (63.28%), Query Frame = 1
Query:  193 IHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKN-SLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEE 1782
            + F +++ AY +++T E+ R+LLV RLC+   L+  ++++L + R + G+ +F  +MK T YGHFVAG  QE I+ +++  R FGV +ILDY VEED++ E+A+    ++  +  ++     +  + ++Q +  F +RRN VI ARTYFY +E +CD ++E F +CI AS   +++G  F A+KLT++G PQ L+  S++L + + FF   A  + Q   +  + K ++   QE +  + I  S  E   WFT   +     +DL +W +L +    L     + + QTG  + L+   +++  L M RMLQR+D LA+ A +   RLM+DAEQ+YFQPAI R+TLE+ R+FN EKP+IFNTYQCYLKDA + +  D+  A +E + FGAKLVRGAY+ QER RA    Y DPIN TYE T  MY+ C+D +   +    +    VM+ASHN +T++ A+ ++ E  + P +  + FGQLLGMCD ISF LG  G+ VYKY+PYGPV EVLPYLSRRALEN +++  +  E
Sbjct:   53 VDFGNAQEAYRSRRTWELARSLLVLRLCAWPALLARHEQLLYVSRKLLGQRLFNKLMKMTFYGHFVAGEDQESIQPLLRHYRAFGVSAILDYGVEEDLSPEEAEHKEMESCTSAAERDGSGTNKRDKQYQAHWAFGDRRNGVISARTYFYANEAKCDSHMETFLRCIEASGRVSDDG--FIAIKLTALGRPQFLLQFSEVLAKWRCFFHQMAVEQGQAGLAAMDTKLEVAVLQESVAKLGI-ASRAEIEDWFTAETLGVSGTMDLLDWSSLIDSRTKLSKHLVVPNAQTGQLEPLLSRFTEEEELQMTRMLQRMDVLAKKATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCYLKDAYDNVTLDVELARREGWCFGAKLVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAK--VMVASHNEDTVRFALRRMEELGLHPADHRVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVMEVLPYLSRRALENSSLMKGTHRE 578          
BLAST of Proline dehydrogenase vs. Ensembl Human
Match: PRODH (proline dehydrogenase 1 [Source:HGNC Symbol;Acc:HGNC:9453])

HSP 1 Score: 457.988 bits (1177), Expect = 1.874e-153
Identity = 225/531 (42.37%), Postives = 336/531 (63.28%), Query Frame = 1
Query:  193 IHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKN-SLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEE 1782
            + F +++ AY +++T E+ R+LLV RLC+   L+  ++++L + R + G+ +F  +MK T YGHFVAG  QE I+ +++  R FGV +ILDY VEED++ E+A+    ++  +  ++     +  + ++Q +  F +RRN VI ARTYFY +E +CD ++E F +CI AS   +++G  F A+KLT++G PQ L+  S++L + + FF   A  + Q   +  + K ++   QE +  + I  S  E   WFT   +     +DL +W +L +    L     + + QTG  + L+   +++  L M RMLQR+D LA+ A +   RLM+DAEQ+YFQPAI R+TLE+ R+FN EKP+IFNTYQCYLKDA + +  D+  A +E + FGAKLVRGAY+ QER RA    Y DPIN TYE T  MY+ C+D +   +    +    VM+ASHN +T++ A+ ++ E  + P +  + FGQLLGMCD ISF LG  G+ VYKY+PYGPV EVLPYLSRRALEN +++  +  E
Sbjct:   53 VDFGNAQEAYRSRRTWELARSLLVLRLCAWPALLARHEQLLYVSRKLLGQRLFNKLMKMTFYGHFVAGEDQESIQPLLRHYRAFGVSAILDYGVEEDLSPEEAEHKEMESCTSAAERDGSGTNKRDKQYQAHWAFGDRRNGVISARTYFYANEAKCDSHMETFLRCIEASGRVSDDG--FIAIKLTALGRPQFLLQFSEVLAKWRCFFHQMAVEQGQAGLAAMDTKLEVAVLQESVAKLGI-ASRAEIEDWFTAETLGVSGTMDLLDWSSLIDSRTKLSKHLVVPNAQTGQLEPLLSRFTEEEELQMTRMLQRMDVLAKKATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCYLKDAYDNVTLDVELARREGWCFGAKLVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAK--VMVASHNEDTVRFALRRMEELGLHPADHRVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVMEVLPYLSRRALENSSLMKGTHRE 578          
BLAST of Proline dehydrogenase vs. Ensembl Human
Match: PRODH (proline dehydrogenase 1 [Source:HGNC Symbol;Acc:HGNC:9453])

HSP 1 Score: 418.698 bits (1075), Expect = 8.982e-140
Identity = 219/496 (44.15%), Postives = 313/496 (63.10%), Query Frame = 1
Query:  361 MKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKN-SLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYP 1845
            MK T YGHFVAG  QE I+ +++  R FGV +ILDY VEED++ E+A+    ++  +  ++     +  + ++Q +  F +RRN VI ARTYFY +E +CD ++E F +CI AS   +++G  F A+KLT++G PQ L+  S++L + + FF   A  + Q   +  + K ++   QE +  + I  S  E   WFT   +     +DL +W +L +    L     + + QTG  + L+   +++  L M RMLQR+D LA+ A +   RLM+DAEQ+YFQPAI R+TLE+ R+FN EKP+IFNTYQCYLKDA + +  D+  A +E + FGAKLVRGAY+ QER RA    Y DPIN TYE T  MY+ C+D +   +    +    VM+ASHN +T++ A+ ++ E  + P +  + FGQLLGMCD ISF LG  G+ VYKY+PYGPV EVLPYLSRRALEN +++  +  E+ LLW EL+RRL T +L   P
Sbjct:    1 MKMTFYGHFVAGEDQESIQPLLRHYRAFGVSAILDYGVEEDLSPEEAEHKEMESCTSAAERDGSGTNKRDKQYQAHWAFGDRRNGVISARTYFYANEAKCDSHMETFLRCIEASGRVSDDG--FIAIKLTALGRPQFLLQFSEVLAKWRCFFHQMAVEQGQAGLAAMDTKLEVAVLQESVAKLGI-ASRAEIEDWFTAETLGVSGTMDLLDWSSLIDSRTKLSKHLVVPNAQTGQLEPLLSRFTEEEELQMTRMLQRMDVLAKKATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCYLKDAYDNVTLDVELARREGWCFGAKLVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAK--VMVASHNEDTVRFALRRMEELGLHPADHRVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVMEVLPYLSRRALENSSLMKGTHRERQLLWLELLRRLRTGNLFHRP 491          
BLAST of Proline dehydrogenase vs. Ensembl Human
Match: PRODH (proline dehydrogenase 1 [Source:HGNC Symbol;Acc:HGNC:9453])

HSP 1 Score: 418.698 bits (1075), Expect = 8.982e-140
Identity = 219/496 (44.15%), Postives = 313/496 (63.10%), Query Frame = 1
Query:  361 MKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKN-SLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYP 1845
            MK T YGHFVAG  QE I+ +++  R FGV +ILDY VEED++ E+A+    ++  +  ++     +  + ++Q +  F +RRN VI ARTYFY +E +CD ++E F +CI AS   +++G  F A+KLT++G PQ L+  S++L + + FF   A  + Q   +  + K ++   QE +  + I  S  E   WFT   +     +DL +W +L +    L     + + QTG  + L+   +++  L M RMLQR+D LA+ A +   RLM+DAEQ+YFQPAI R+TLE+ R+FN EKP+IFNTYQCYLKDA + +  D+  A +E + FGAKLVRGAY+ QER RA    Y DPIN TYE T  MY+ C+D +   +    +    VM+ASHN +T++ A+ ++ E  + P +  + FGQLLGMCD ISF LG  G+ VYKY+PYGPV EVLPYLSRRALEN +++  +  E+ LLW EL+RRL T +L   P
Sbjct:    1 MKMTFYGHFVAGEDQESIQPLLRHYRAFGVSAILDYGVEEDLSPEEAEHKEMESCTSAAERDGSGTNKRDKQYQAHWAFGDRRNGVISARTYFYANEAKCDSHMETFLRCIEASGRVSDDG--FIAIKLTALGRPQFLLQFSEVLAKWRCFFHQMAVEQGQAGLAAMDTKLEVAVLQESVAKLGI-ASRAEIEDWFTAETLGVSGTMDLLDWSSLIDSRTKLSKHLVVPNAQTGQLEPLLSRFTEEEELQMTRMLQRMDVLAKKATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCYLKDAYDNVTLDVELARREGWCFGAKLVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAK--VMVASHNEDTVRFALRRMEELGLHPADHRVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVMEVLPYLSRRALENSSLMKGTHRERQLLWLELLRRLRTGNLFHRP 491          
BLAST of Proline dehydrogenase vs. Ensembl Celegans
Match: prdh-1 (Proline dehydrogenase 1, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:O45228])

HSP 1 Score: 494.967 bits (1273), Expect = 4.075e-168
Identity = 247/564 (43.79%), Postives = 370/564 (65.60%), Query Frame = 1
Query:  163 KSLSHC-DQTKIHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKE-IVKDTMETMLDQQQKCP-------DSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTN 1827
            K L  C ++  + F +++ A+ +K  +E++RAL+V RLC I  LVN N+ IL   R + GK +F+  +K T +GHFVAG ++E+++ +V+  R +GVKSILDYSVE DIT ++A +  VK T    +      P       ++   ++  + +F +RR  V  ARTYFY  E QCD+N +IFK  INA + +A + EGF AVK+T++G PQLL+ +S+ ++Q QNFFK          SL E +   Q F +RL  + ++   +   K+F  +D + D  +DL  W ++ +    LG LF++ +++TG  + LI+ LS +     R M++R  ++AE+A +K  R+M+DAEQ+Y QPAI +IT+E+M+++NK +  IFNTYQ YLK  L+ + +D+  A +E ++FGAKLVRGAYMEQER RA+   Y DPIN  +E T+ MY  C+  I   + +R +  V VM+ASHN +T++ A++ ++E  I P+E+++C  QL GMCD +SF+LG  GFSVYKY+PYGPVEEVLPYLSRRALEN +VL K+ +E++LLW EL RR+ + 
Sbjct:   48 KELEECYNRLDLSFENTKEAFKSKSNTELVRALVVLRLCGIQTLVNQNQIILNTMRRVLGKNLFKKTLKNTFFGHFVAGETEEEVRHVVEKLRNYGVKSILDYSVEADITSQEATDKTVKGTSVATVKPAAMTPVVDAKTLETTRERYTVHEEFGDRRQGVSSARTYFYEGEEQCDKNRDIFKDSINAVA-SATKNEGFVAVKITALGRPQLLLKLSEAIVQTQNFFKALTGGM----SLQEGRLTSQEFYKRLGELGVKTDTESVKKFFDEVDFDSDGIVDLHGWNHILDDHVKLGQLFQVLNIKTGSLEPLIQNLSNEEEQEFRNMVRRTLDVAEYAIEKGVRIMVDAEQTYLQPAISKITIEMMKKYNKGRGNIFNTYQAYLKGTLQNMEADMQVARREGWHFGAKLVRGAYMEQERARAKAIGYEDPINDNFEATSKMYESCLTRIADEVHRRGKTNVSVMVASHNEDTVRFALNLMKEKCISPSERVMCMAQLYGMCDQVSFSLGQAGFSVYKYLPYGPVEEVLPYLSRRALENGSVLKKANKERDLLWKELKRRISSG 606          
BLAST of Proline dehydrogenase vs. Ensembl Celegans
Match: prdh-1 (Proline dehydrogenase 1, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:O45228])

HSP 1 Score: 456.833 bits (1174), Expect = 1.161e-154
Identity = 226/509 (44.40%), Postives = 336/509 (66.01%), Query Frame = 1
Query:  325 RTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKE-IVKDTMETMLDQQQKCP-------DSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTN 1827
            R + GK +F+  +K T +GHFVAG ++E+++ +V+  R +GVKSILDYSVE DIT ++A +  VK T    +      P       ++   ++  + +F +RR  V  ARTYFY  E QCD+N +IFK  INA + +A + EGF AVK+T++G PQLL+ +S+ ++Q QNFFK          SL E +   Q F +RL  + ++   +   K+F  +D + D  +DL  W ++ +    LG LF++ +++TG  + LI+ LS +     R M++R  ++AE+A +K  R+M+DAEQ+Y QPAI +IT+E+M+++NK +  IFNTYQ YLK  L+ + +D+  A +E ++FGAKLVRGAYMEQER RA+   Y DPIN  +E T+ MY  C+  I   + +R +  V VM+ASHN +T++ A++ ++E  I P+E+++C  QL GMCD +SF+LG  GFSVYKY+PYGPVEEVLPYLSRRALEN +VL K+ +E++LLW EL RR+ + 
Sbjct:    2 RRVLGKNLFKKTLKNTFFGHFVAGETEEEVRHVVEKLRNYGVKSILDYSVEADITSQEATDKTVKGTSVATVKPAAMTPVVDAKTLETTRERYTVHEEFGDRRQGVSSARTYFYEGEEQCDKNRDIFKDSINAVA-SATKNEGFVAVKITALGRPQLLLKLSEAIVQTQNFFKALTGGM----SLQEGRLTSQEFYKRLGELGVKTDTESVKKFFDEVDFDSDGIVDLHGWNHILDDHVKLGQLFQVLNIKTGSLEPLIQNLSNEEEQEFRNMVRRTLDVAEYAIEKGVRIMVDAEQTYLQPAISKITIEMMKKYNKGRGNIFNTYQAYLKGTLQNMEADMQVARREGWHFGAKLVRGAYMEQERARAKAIGYEDPINDNFEATSKMYESCLTRIADEVHRRGKTNVSVMVASHNEDTVRFALNLMKEKCISPSERVMCMAQLYGMCDQVSFSLGQAGFSVYKYLPYGPVEEVLPYLSRRALENGSVLKKANKERDLLWKELKRRISSG 505          
BLAST of Proline dehydrogenase vs. Ensembl Fly
Match: slgA (gene:FBgn0003423 transcript:FBtr0077206)

HSP 1 Score: 470.315 bits (1209), Expect = 9.721e-158
Identity = 243/564 (43.09%), Postives = 359/564 (63.65%), Query Frame = 1
Query:  181 DQTKIHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKA-KEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKNSLDEIKF--DLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSI-----LQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYPK 1848
            D   + FND   A+ +K T E+IRA LV+ +CS + LV +N  ++KL R + G+ +F  +MK + YGHFVAG ++  I   ++  R FGVK ILDYSVEEDIT+E+A K  V+ ++ +  D+++   +    ++  +  FA+RR  V  ARTYFY +E  C+ N+EIF KC+ A S  A  G G TA+KLT++G PQLL+ +S+++++ + + +       Q N L   K   DL+ +   L + K      +  ++   +  +K+  + LF W  + + +  L D F++ D QTG  + LI  +        R M++RL+ + + A   + R+M+DAEQ+YFQPAI RITLE+MR++NK+K I+FNTYQCYL++   ++N+DL  A +++FYFGAKLVRGAYM+QER+RA+   Y DP+N T+E TT MY+  +      I            + +M+ASHN +T++ AI +++E  I P +K++CFGQLLGMCD+I+F LG  G+S YKY+PYGPVEEVLPYLSRRA EN+ VL K K+E+ LL  E+ RRLM   L   PK
Sbjct:  112 DPLDVSFNDPIAAFKSKTTGELIRAYLVYMICSSEKLVEHNMTLMKLARNLLGQKLFVLLMKSSFYGHFVAGENRHTIVPALERLRSFGVKPILDYSVEEDITQEEAEKREVESSVSSAGDKKE---EGSMPQYHVDKSFADRRYKVSSARTYFYLNEATCERNMEIFIKCLEAVS-GATFGTGITAIKLTALGRPQLLLQLSEVIMRTRKYMEDMV--GGQGNVLTHHKTIKDLEKYYATLGDNK------DVKEFLNNVTSDKEGILHLFPWSGIVDEDSQLSDTFRVPDPQTGQMRRLISQIPPKEEEMFRNMIRRLNTIVKAAADLDVRIMVDAEQTYFQPAISRITLEMMRKYNKDKAIVFNTYQCYLRETFREVNTDLEQAKRQNFYFGAKLVRGAYMDQERDRAKSLGYPDPVNPTFEATTDMYHRTLSECLRRIKLMKDCDDDARKIGIMVASHNEDTVRFAIQQMKEIGISPEDKVICFGQLLGMCDYITFPLGQAGYSAYKYIPYGPVEEVLPYLSRRAQENKGVLKKIKKEKRLLLSEIRRRLMRGQLFYKPK 663          
BLAST of Proline dehydrogenase vs. Ensembl Fly
Match: slgA (gene:FBgn0003423 transcript:FBtr0307528)

HSP 1 Score: 470.315 bits (1209), Expect = 9.721e-158
Identity = 243/564 (43.09%), Postives = 359/564 (63.65%), Query Frame = 1
Query:  181 DQTKIHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKA-KEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKNSLDEIKF--DLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSI-----LQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYPK 1848
            D   + FND   A+ +K T E+IRA LV+ +CS + LV +N  ++KL R + G+ +F  +MK + YGHFVAG ++  I   ++  R FGVK ILDYSVEEDIT+E+A K  V+ ++ +  D+++   +    ++  +  FA+RR  V  ARTYFY +E  C+ N+EIF KC+ A S  A  G G TA+KLT++G PQLL+ +S+++++ + + +       Q N L   K   DL+ +   L + K      +  ++   +  +K+  + LF W  + + +  L D F++ D QTG  + LI  +        R M++RL+ + + A   + R+M+DAEQ+YFQPAI RITLE+MR++NK+K I+FNTYQCYL++   ++N+DL  A +++FYFGAKLVRGAYM+QER+RA+   Y DP+N T+E TT MY+  +      I            + +M+ASHN +T++ AI +++E  I P +K++CFGQLLGMCD+I+F LG  G+S YKY+PYGPVEEVLPYLSRRA EN+ VL K K+E+ LL  E+ RRLM   L   PK
Sbjct:  112 DPLDVSFNDPIAAFKSKTTGELIRAYLVYMICSSEKLVEHNMTLMKLARNLLGQKLFVLLMKSSFYGHFVAGENRHTIVPALERLRSFGVKPILDYSVEEDITQEEAEKREVESSVSSAGDKKE---EGSMPQYHVDKSFADRRYKVSSARTYFYLNEATCERNMEIFIKCLEAVS-GATFGTGITAIKLTALGRPQLLLQLSEVIMRTRKYMEDMV--GGQGNVLTHHKTIKDLEKYYATLGDNK------DVKEFLNNVTSDKEGILHLFPWSGIVDEDSQLSDTFRVPDPQTGQMRRLISQIPPKEEEMFRNMIRRLNTIVKAAADLDVRIMVDAEQTYFQPAISRITLEMMRKYNKDKAIVFNTYQCYLRETFREVNTDLEQAKRQNFYFGAKLVRGAYMDQERDRAKSLGYPDPVNPTFEATTDMYHRTLSECLRRIKLMKDCDDDARKIGIMVASHNEDTVRFAIQQMKEIGISPEDKVICFGQLLGMCDYITFPLGQAGYSAYKYIPYGPVEEVLPYLSRRAQENKGVLKKIKKEKRLLLSEIRRRLMRGQLFYKPK 663          
BLAST of Proline dehydrogenase vs. Ensembl Fly
Match: slgA (gene:FBgn0003423 transcript:FBtr0307524)

HSP 1 Score: 470.315 bits (1209), Expect = 9.721e-158
Identity = 243/564 (43.09%), Postives = 359/564 (63.65%), Query Frame = 1
Query:  181 DQTKIHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKA-KEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKNSLDEIKF--DLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSI-----LQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYPK 1848
            D   + FND   A+ +K T E+IRA LV+ +CS + LV +N  ++KL R + G+ +F  +MK + YGHFVAG ++  I   ++  R FGVK ILDYSVEEDIT+E+A K  V+ ++ +  D+++   +    ++  +  FA+RR  V  ARTYFY +E  C+ N+EIF KC+ A S  A  G G TA+KLT++G PQLL+ +S+++++ + + +       Q N L   K   DL+ +   L + K      +  ++   +  +K+  + LF W  + + +  L D F++ D QTG  + LI  +        R M++RL+ + + A   + R+M+DAEQ+YFQPAI RITLE+MR++NK+K I+FNTYQCYL++   ++N+DL  A +++FYFGAKLVRGAYM+QER+RA+   Y DP+N T+E TT MY+  +      I            + +M+ASHN +T++ AI +++E  I P +K++CFGQLLGMCD+I+F LG  G+S YKY+PYGPVEEVLPYLSRRA EN+ VL K K+E+ LL  E+ RRLM   L   PK
Sbjct:  112 DPLDVSFNDPIAAFKSKTTGELIRAYLVYMICSSEKLVEHNMTLMKLARNLLGQKLFVLLMKSSFYGHFVAGENRHTIVPALERLRSFGVKPILDYSVEEDITQEEAEKREVESSVSSAGDKKE---EGSMPQYHVDKSFADRRYKVSSARTYFYLNEATCERNMEIFIKCLEAVS-GATFGTGITAIKLTALGRPQLLLQLSEVIMRTRKYMEDMV--GGQGNVLTHHKTIKDLEKYYATLGDNK------DVKEFLNNVTSDKEGILHLFPWSGIVDEDSQLSDTFRVPDPQTGQMRRLISQIPPKEEEMFRNMIRRLNTIVKAAADLDVRIMVDAEQTYFQPAISRITLEMMRKYNKDKAIVFNTYQCYLRETFREVNTDLEQAKRQNFYFGAKLVRGAYMDQERDRAKSLGYPDPVNPTFEATTDMYHRTLSECLRRIKLMKDCDDDARKIGIMVASHNEDTVRFAIQQMKEIGISPEDKVICFGQLLGMCDYITFPLGQAGYSAYKYIPYGPVEEVLPYLSRRAQENKGVLKKIKKEKRLLLSEIRRRLMRGQLFYKPK 663          
BLAST of Proline dehydrogenase vs. Ensembl Fly
Match: slgA (gene:FBgn0003423 transcript:FBtr0307527)

HSP 1 Score: 469.159 bits (1206), Expect = 3.256e-157
Identity = 243/564 (43.09%), Postives = 357/564 (63.30%), Query Frame = 1
Query:  181 DQTKIHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKA-KEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKNSLDEIKF--DLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSI-----LQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYPK 1848
            D   + FND   A+ +K T E+IRA LV+ +CS + LV +N  ++K  + + G+ +F  +MK T YGHFVAG  Q  I   ++  R FGVK ILDYSVEEDIT+E+A K  V+ ++ +  D+++   +    ++  +  FA+RR  V  ARTYFY +E  C+ N+EIF KC+ A S  A  G G TA+KLT++G PQLL+ +S+++++ + + +       Q N L   K   DL+ +   L + K      +  ++   +  +K+  + LF W  + + +  L D F++ D QTG  + LI  +        R M++RL+ + + A   + R+M+DAEQ+YFQPAI RITLE+MR++NK+K I+FNTYQCYL++   ++N+DL  A +++FYFGAKLVRGAYM+QER+RA+   Y DP+N T+E TT MY+  +      I            + +M+ASHN +T++ AI +++E  I P +K++CFGQLLGMCD+I+F LG  G+S YKY+PYGPVEEVLPYLSRRA EN+ VL K K+E+ LL  E+ RRLM   L   PK
Sbjct:  112 DPLDVSFNDPIAAFKSKTTGELIRAYLVYMICSSEKLVEHNMTLMKWSKNVLGQRLFTLLMKATFYGHFVAGEDQIKIIPTLERLRSFGVKPILDYSVEEDITQEEAEKREVESSVSSAGDKKE---EGSMPQYHVDKSFADRRYKVSSARTYFYLNEATCERNMEIFIKCLEAVS-GATFGTGITAIKLTALGRPQLLLQLSEVIMRTRKYMEDMV--GGQGNVLTHHKTIKDLEKYYATLGDNK------DVKEFLNNVTSDKEGILHLFPWSGIVDEDSQLSDTFRVPDPQTGQMRRLISQIPPKEEEMFRNMIRRLNTIVKAAADLDVRIMVDAEQTYFQPAISRITLEMMRKYNKDKAIVFNTYQCYLRETFREVNTDLEQAKRQNFYFGAKLVRGAYMDQERDRAKSLGYPDPVNPTFEATTDMYHRTLSECLRRIKLMKDCDDDARKIGIMVASHNEDTVRFAIQQMKEIGISPEDKVICFGQLLGMCDYITFPLGQAGYSAYKYIPYGPVEEVLPYLSRRAQENKGVLKKIKKEKRLLLSEIRRRLMRGQLFYKPK 663          
BLAST of Proline dehydrogenase vs. Ensembl Fly
Match: slgA (gene:FBgn0003423 transcript:FBtr0077203)

HSP 1 Score: 469.159 bits (1206), Expect = 3.256e-157
Identity = 243/564 (43.09%), Postives = 357/564 (63.30%), Query Frame = 1
Query:  181 DQTKIHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKA-KEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKNSLDEIKF--DLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSI-----LQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYPK 1848
            D   + FND   A+ +K T E+IRA LV+ +CS + LV +N  ++K  + + G+ +F  +MK T YGHFVAG  Q  I   ++  R FGVK ILDYSVEEDIT+E+A K  V+ ++ +  D+++   +    ++  +  FA+RR  V  ARTYFY +E  C+ N+EIF KC+ A S  A  G G TA+KLT++G PQLL+ +S+++++ + + +       Q N L   K   DL+ +   L + K      +  ++   +  +K+  + LF W  + + +  L D F++ D QTG  + LI  +        R M++RL+ + + A   + R+M+DAEQ+YFQPAI RITLE+MR++NK+K I+FNTYQCYL++   ++N+DL  A +++FYFGAKLVRGAYM+QER+RA+   Y DP+N T+E TT MY+  +      I            + +M+ASHN +T++ AI +++E  I P +K++CFGQLLGMCD+I+F LG  G+S YKY+PYGPVEEVLPYLSRRA EN+ VL K K+E+ LL  E+ RRLM   L   PK
Sbjct:  112 DPLDVSFNDPIAAFKSKTTGELIRAYLVYMICSSEKLVEHNMTLMKWSKNVLGQRLFTLLMKATFYGHFVAGEDQIKIIPTLERLRSFGVKPILDYSVEEDITQEEAEKREVESSVSSAGDKKE---EGSMPQYHVDKSFADRRYKVSSARTYFYLNEATCERNMEIFIKCLEAVS-GATFGTGITAIKLTALGRPQLLLQLSEVIMRTRKYMEDMV--GGQGNVLTHHKTIKDLEKYYATLGDNK------DVKEFLNNVTSDKEGILHLFPWSGIVDEDSQLSDTFRVPDPQTGQMRRLISQIPPKEEEMFRNMIRRLNTIVKAAADLDVRIMVDAEQTYFQPAISRITLEMMRKYNKDKAIVFNTYQCYLRETFREVNTDLEQAKRQNFYFGAKLVRGAYMDQERDRAKSLGYPDPVNPTFEATTDMYHRTLSECLRRIKLMKDCDDDARKIGIMVASHNEDTVRFAIQQMKEIGISPEDKVICFGQLLGMCDYITFPLGQAGYSAYKYIPYGPVEEVLPYLSRRAQENKGVLKKIKKEKRLLLSEIRRRLMRGQLFYKPK 663          
BLAST of Proline dehydrogenase vs. Ensembl Zebrafish
Match: prodha (proline dehydrogenase (oxidase) 1a [Source:ZFIN;Acc:ZDB-GENE-041008-73])

HSP 1 Score: 501.901 bits (1291), Expect = 1.718e-170
Identity = 250/564 (44.33%), Postives = 366/564 (64.89%), Query Frame = 1
Query:  193 IHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTM------ETMLD------QQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKN-SLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYP 1845
            I F+++  AY +K T E++R+LLVF+LC+ DFLV+ NK+++ L + I G+ +FE +MK T YG FVAG  Q  IK +++ N+ FGV S+LDYSVEED+T+E+A++   D+       E+ +D      Q  +C D    K++ +  F +RR  VI ARTYFY  E +CD ++E F  CI AS+   +  +GF+A+K+T++G PQ L+  S++L++ + FF + A H+ +   ++ E K +LQ  Q+ L  + +    D +  WFT  ++     IDL +W +L N    + +L  + ++++G  + L+   + +    M+RMLQR+D LA+HA +   RLM+DAEQ+YFQPAI R+TLE+ R FN+EKP IFNTYQCYL++A + ++ D+  + +E +YFGAKLVRGAYM QER RA    Y DPIN  YE T  MY+ C++ I   I      M  VM+ASHN +T++  + K+ E ++ P E  + FGQLLGMCD ISF LG  GF VYKY+PYGPV EV+PYLSRRA ENR  +  S+ E++LLW E+ RRL +  L+  P
Sbjct:   69 IDFDNTREAYRSKHTLELLRSLLVFKLCTFDFLVDKNKELIDLSKKILGQRLFEKLMKMTFYGQFVAGEDQNSIKPLIEKNQAFGVGSVLDYSVEEDLTQEEAEKKEMDSCVSEAEKESHVDTHACSPQDPECMDHREKKYKAHRQFGDRRGGVISARTYFYADEAKCDHHMETFINCIKASA--GSSVDGFSAIKMTALGRPQFLLQFSEVLVKWRRFFTLLAAHQGKDGMAVLEQKLELQQLQDSLIKLGVGAKSDIE-NWFTGEELGSSGTIDLLDWNSLINDRTKISNLLVVPNMESGHLEPLLSKFTDEEEKQMKRMLQRMDVLAKHAVENGVRLMVDAEQTYFQPAISRLTLEMQRIFNREKPHIFNTYQCYLREAYDNVSVDVELSRREGWYFGAKLVRGAYMCQERSRASEIGYEDPINPDYEATNNMYHKCLEYILEEINHNR--MANVMVASHNEDTVKFTLEKMNEMNLSPTENKVYFGQLLGMCDQISFPLGQAGFPVYKYVPYGPVNEVIPYLSRRAQENRGFMKGSQRERSLLWKEIKRRLFSGQLLYTP 627          
BLAST of Proline dehydrogenase vs. Ensembl Zebrafish
Match: prodhb (proline dehydrogenase (oxidase) 1b [Source:ZFIN;Acc:ZDB-GENE-101116-1])

HSP 1 Score: 325.094 bits (832), Expect = 2.292e-105
Identity = 160/371 (43.13%), Postives = 237/371 (63.88%), Query Frame = 1
Query:  745 LTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKNSLD--EIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYPKL 1851
            +T++G PQ L+  S++L++ + FF   A  K  K+ ++  E K DL+  Q  L  +  E +      +F+   ++    +D+ +W  L +    + DL  + +LQTG  + L+   +++    M+RMLQRLD LA+HA +   RLM+DAEQ+YFQPAI R+T+E+ R FN++K ++FNTYQCYLK+A + ++ D+  + +E + F AKLVRGAYM QER RA    Y DPIN  YE T  MY+ C+D +   I +  +  V VM+ASHN++T++  + ++ E  + P +K +CFGQLLGMCD ISF L   GF VYKY+PYGPV EV+PYLSRRA ENR  +   + E+ LLW EL+RRL +  ++  P +
Sbjct:    1 MTALGRPQFLLQFSEVLVKWRRFFSFLAS-KQGKDGMEVLEQKLDLEQLQMCLARLGAEGNIQ---SFFSDGRLHSSGIVDMLDWNRLIDERMKISDLLVVPNLQTGQLEPLLSRFTEEEERQMKRMLQRLDVLAKHAVENGVRLMVDAEQTYFQPAISRLTVEMKRSFNRDKAVVFNTYQCYLKEAFDNVSMDVELSRREGWCFAAKLVRGAYMYQERSRAAEIGYEDPINPDYESTNRMYHRCLDYVLEEIQRNKK--VNVMVASHNLDTVKHTLRRMNEMGLQPTDKKVCFGQLLGMCDQISFPLAQAGFPVYKYVPYGPVNEVIPYLSRRAQENRGFMKGVQMERELLWKELMRRLSSGQILYTPPV 365          
BLAST of Proline dehydrogenase vs. Ensembl Zebrafish
Match: prodha (proline dehydrogenase (oxidase) 1a [Source:ZFIN;Acc:ZDB-GENE-041008-73])

HSP 1 Score: 265.774 bits (678), Expect = 2.764e-84
Identity = 127/233 (54.51%), Postives = 163/233 (69.96%), Query Frame = 1
Query: 1147 HAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYP 1845
            HA +   RLM+DAEQ+YFQPAI R+TLE+ R FN+EKP IFNTYQCYL++A + ++ D+  + +E +YFGAKLVRGAYM QER RA    Y DPIN  YE T  MY+ C++ I   I      M  VM+ASHN +T++  + K+ E ++ P E  + FGQLLGMCD ISF LG  GF VYKY+PYGPV EV+PYLSRRA ENR  +  S+ E++LLW E+ RRL +  L+  P
Sbjct:    1 HAVENGVRLMVDAEQTYFQPAISRLTLEMQRIFNREKPHIFNTYQCYLREAYDNVSVDVELSRREGWYFGAKLVRGAYMCQERSRASEIGYEDPINPDYEATNNMYHKCLEYILEEINH--NRMANVMVASHNEDTVKFTLEKMNEMNLSPTENKVYFGQLLGMCDQISFPLGQAGFPVYKYVPYGPVNEVIPYLSRRAQENRGFMKGSQRERSLLWKEIKRRLFSGQLLYTP 231          
BLAST of Proline dehydrogenase vs. Ensembl Zebrafish
Match: zgc:92040 (zgc:92040 [Source:ZFIN;Acc:ZDB-GENE-040718-87])

HSP 1 Score: 212.231 bits (539), Expect = 7.112e-61
Identity = 102/233 (43.78%), Postives = 158/233 (67.81%), Query Frame = 1
Query: 1120 LQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRL 1818
            L+RL+++ E +  K  R+++DAE +Y  PA+  IT+ +M++FN++   I+NTYQCYLK++   +   +  +  +SF FG KLVRGAYM++ER+ A  +  TDPI+ ++E T   YN C++ +   I ++P   +++ +A+HN E+++ A+  + E  +  +   +CFGQLLGMCDH+S TL   GFSVYK +PYG V++ LPYL RRA ENR VL   ++E++LL  EL RRL
Sbjct:  230 LRRLNKIGEASVNK-VRVLVDAEYTYMNPALSLITMAMMKKFNQQSAWIWNTYQCYLKESRNLLLDAVQTSINQSFCFGVKLVRGAYMDKERKLAEKEGRTDPIHESWEHTNDSYNGCLELMLKLIAEKPERYMMI-VATHNEESVRRAVTHMAELGLHRDGNSVCFGQLLGMCDHVSLTLAQHGFSVYKSVPYGSVDDTLPYLVRRAQENRTVLQGIRKERDLLRQELHRRL 460          

HSP 2 Score: 81.2629 bits (199), Expect = 1.060e-15
Identity = 39/116 (33.62%), Postives = 64/116 (55.17%), Query Frame = 1
Query:  193 IHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLD 540
            + F D + A+  K   E+IRAL VFRLCS   LVNN  K++   R + GK  F  +++ ++Y  FVAG ++ +I   ++     G+  +L   +EED+ E   ++   D +  ML+
Sbjct:   44 LRFEDPQ-AFRVKSLWELIRALGVFRLCSFPVLVNNCGKLMSFSRRVLGKRCFCMVLRPSVYAQFVAGETEGEIADSMQKMSSLGLHPMLAVPIEEDLGESTGEKRYDDNLSAMLE 158          
BLAST of Proline dehydrogenase vs. Ensembl Xenopus
Match: ENSXETT00000009434.1 (proline dehydrogenase (oxidase) 1 [Source:NCBI gene;Acc:100494891])

HSP 1 Score: 520.776 bits (1340), Expect = 7.997e-178
Identity = 256/564 (45.39%), Postives = 372/564 (65.96%), Query Frame = 1
Query:  169 LSHCDQTKIHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKA--KEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFF-KIFAEHKNQKNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYPKL 1851
            L  C    ++F++++ AY +K T E++R+++VF LCSID LV+ N++IL L + + G+ +FE +MK T YG FVAG  QE IK +++ N+ FGV S+LDYSVEED+T+E+A  KEI   T E   +++    +    K+Q    F +RR  VI ARTYFY  E +CD ++E F KCI+AS  ++ +G  F+A+KLT++G PQ L+  S++L++ + FF ++ AE      +  EI+ +++  QE L  + I  + DE   WF+  ++     +DL +W +L +    +  L  + +LQ+G  + L+   +++  L M+RMLQR+D LA+ A +K  RLM+DAEQ+YFQPAI R+TLE+ R+FN E PIIFNTYQCYLK+A + + +D+  + +E ++FGAKLVRGAYM+QER RA    Y DPIN TY+ T  MY+ C+D I   I  R      VM+ASHN +T++  + ++ E  I P EK + FGQLLGMCD ISF LG  G+ VYKY+PYGPV EVLPYLSRRA ENR ++  +  E++LLW E  RRL+T +L   P+ 
Sbjct:   66 LKSCPAATMNFDNTQEAYKSKATWELLRSIMVFWLCSIDTLVDRNQQILSLSKKVLGQKLFEKMMKMTFYGQFVAGEDQESIKPVIRRNQAFGVGSVLDYSVEEDLTQEEAEKKEIESSTAEA--EKENLGAERREKKYQVQPGFGDRRGGVISARTYFYADEAKCDHHMETFLKCIDASGGSSEDG--FSAIKLTALGRPQFLLQFSEVLMKWRRFFHQLAAEQGKAGMAAVEIELEVEKLQESLAKLGI-ATKDESRNWFSGENLGLSGTLDLLDWNSLIDSRTKISRLLLVPNLQSGQLEPLLSRFTEEEDLQMKRMLQRIDVLAKRALEKGVRLMVDAEQTYFQPAISRLTLEMQRKFNMESPIIFNTYQCYLKEAYDNVTADVELSRREGWHFGAKLVRGAYMQQERNRAMEVGYDDPINPTYDKTNEMYHRCLDYILEEI--RHNRKANVMVASHNEDTVKFTLRRMNELVIYPEEKKVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVNEVLPYLSRRAQENRGIMKGAIRERHLLWSEFKRRLLTGNLFYAPRF 622          
BLAST of Proline dehydrogenase vs. Ensembl Xenopus
Match: ENSXETT00000009383.1 (proline dehydrogenase (oxidase) 1 [Source:NCBI gene;Acc:100494891])

HSP 1 Score: 486.878 bits (1252), Expect = 7.975e-165
Identity = 246/562 (43.77%), Postives = 358/562 (63.70%), Query Frame = 1
Query:  169 LSHCDQTKIHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFF-KIFAEHKNQKNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYPKL 1851
            L  C    ++F++++ AY +K T E++R+++VF LCSID LV+ N++IL L + + G+ +FE +MK T YG FVAG  QE IK +++ N+ FGV S+LDYSVEED+T+E+A+   K  +E +L   ++       K+Q    F +RR  VI ARTYFY  E +CD ++E F KCI+AS             K  ++ P    +  S++L++ + FF ++ AE      +  EI+ +++  QE L  + I  + DE   WF+  ++     +DL +W +L +    +  L  + +LQ+G  + L+   +++  L M+RMLQR+D LA+ A +K  RLM+DAEQ+YFQPAI R+TLE+ R+FN E PIIFNTYQCYLK+A + + +D+  + +E ++FGAKLVRGAYM+QER RA    Y DPIN TY+ T  MY+ C+D I   I  R      VM+ASHN +T++  + ++ E  I P EK + FGQLLGMCD ISF LG  G+ VYKY+PYGPV EVLPYLSRRA ENR ++  +  E++LLW E  RRL+T +L   P+ 
Sbjct:   61 LKSCPAATMNFDNTQEAYKSKATWELLRSIMVFWLCSIDTLVDRNQQILSLSKKVLGQKLFEKMMKMTFYGQFVAGEDQESIKPVIRRNQAFGVGSVLDYSVEEDLTQEEAE---KKEIECILPGAER----REKKYQVQPGFGDRRGGVISARTYFYADEAKCDHHMETFLKCIDASGKCCQS-------KSLAIYPLFQFLQFSEVLMKWRRFFHQLAAEQGKAGMAAVEIELEVEKLQESLAKLGI-ATKDESRNWFSGENLGLSGTLDLLDWNSLIDSRTKISRLLLVPNLQSGQLEPLLSRFTEEEDLQMKRMLQRIDVLAKRALEKGVRLMVDAEQTYFQPAISRLTLEMQRKFNMESPIIFNTYQCYLKEAYDNVTADVELSRREGWHFGAKLVRGAYMQQERNRAMEVGYDDPINPTYDKTNEMYHRCLDYILEEI--RHNRKANVMVASHNEDTVKFTLRRMNELVIYPEEKKVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVNEVLPYLSRRAQENRGIMKGAIRERHLLWSEFKRRLLTGNLFYAPRF 605          
BLAST of Proline dehydrogenase vs. Ensembl Xenopus
Match: ENSXETT00000009455.1 (proline dehydrogenase (oxidase) 1 [Source:NCBI gene;Acc:100494891])

HSP 1 Score: 486.108 bits (1250), Expect = 4.044e-164
Identity = 250/579 (43.18%), Postives = 363/579 (62.69%), Query Frame = 1
Query:  169 LSHCDQTKIHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKA--KEIVKDT------METMLDQQQKCPDSLNV---------KFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFF-KIFAEHKNQKNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYPKL 1851
            L  C    ++F++++ AY +K T E++R+++VF LCSID LV+ N++IL L + + G+ +FE +MK T YG FVAG  QE IK +++ N+ FGV S+LDYSVEED+T+E+A  KEI ++       +E+   +Q  C D   +         K+Q    F +RR  VI ARTYFY  E +CD ++E F KCI+AS             K  ++ P    +  S++L++ + FF ++ AE      +  EI+ +++  QE L  + I  + DE   WF+  ++     +DL +W +L +    +  L  + +LQ+G  + L+   +++  L M+RMLQR+D LA+ A +K  RLM+DAEQ+YFQPAI R+TLE+ R+FN E PIIFNTYQCYLK+A + + +D+  + +E ++FGAKLVRGAYM+QER RA    Y DPIN TY+ T  MY+ C+D I   I  R      VM+ASHN +T++  + ++ E  I P EK + FGQLLGMCD ISF LG  G+ VYKY+PYGPV EVLPYLSRRA ENR ++  +  E++LLW E  RRL+T +L   P+ 
Sbjct:   61 LKSCPAATMNFDNTQEAYKSKATWELLRSIMVFWLCSIDTLVDRNQQILSLSKKVLGQKLFEKMMKMTFYGQFVAGEDQESIKPVIRRNQAFGVGSVLDYSVEEDLTQEEAEKKEIDEEPNNTWNKLESSHVKQITCSDPECILPGAERREKKYQVQPGFGDRRGGVISARTYFYADEAKCDHHMETFLKCIDASGKCCQS-------KSLAIYPLFQFLQFSEVLMKWRRFFHQLAAEQGKAGMAAVEIELEVEKLQESLAKLGI-ATKDESRNWFSGENLGLSGTLDLLDWNSLIDSRTKISRLLLVPNLQSGQLEPLLSRFTEEEDLQMKRMLQRIDVLAKRALEKGVRLMVDAEQTYFQPAISRLTLEMQRKFNMESPIIFNTYQCYLKEAYDNVTADVELSRREGWHFGAKLVRGAYMQQERNRAMEVGYDDPINPTYDKTNEMYHRCLDYILEEI--RHNRKANVMVASHNEDTVKFTLRRMNELVIYPEEKKVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVNEVLPYLSRRAQENRGIMKGAIRERHLLWSEFKRRLLTGNLFYAPRF 629          
BLAST of Proline dehydrogenase vs. Ensembl Xenopus
Match: ENSXETT00000009247.1 (proline dehydrogenase (oxidase) 1 [Source:NCBI gene;Acc:100494891])

HSP 1 Score: 465.307 bits (1196), Expect = 1.570e-156
Identity = 243/563 (43.16%), Postives = 345/563 (61.28%), Query Frame = 1
Query:  169 LSHCDQTKIHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKA--KEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYPKL 1851
            L  C    ++F++++ AY +K T E++R+++VF LCSID LV+ N++IL L + + G+ +FE +MK T YG FVAG  QE IK +++ N+ FGV S+LDYSVEED+T+E+A  KEI   T E   +++    +    K+Q    F +RR  VI ARTYFY  E +CD ++E F KCI+AS                     +     S  +  L  F  +F  H        E   +++   E L  + I  + DE   WF+  ++     +DL +W +L +    +  L  + +LQ+G  + L+   +++  L M+RMLQR+D LA+ A +K  RLM+DAEQ+YFQPAI R+TLE+ R+FN E PIIFNTYQCYLK+A + + +D+  + +E ++FGAKLVRGAYM+QER RA    Y DPIN TY+ T  MY+ C+D I   I  R      VM+ASHN +T++  + ++ E  I P EK + FGQLLGMCD ISF LG  G+ VYKY+PYGPV EVLPYLSRRA ENR ++  +  E++LLW E  RRL+T +L   P+ 
Sbjct:   61 LKSCPAATMNFDNTQEAYKSKATWELLRSIMVFWLCSIDTLVDRNQQILSLSKKVLGQKLFEKMMKMTFYGQFVAGEDQESIKPVIRRNQAFGVGSVLDYSVEEDLTQEEAEKKEIESSTAEA--EKENLGAERREKKYQVQPGFGDRRGGVISARTYFYADEAKCDHHMETFLKCIDASG--------------------KCCQSKSLAIYPLFQFGFVFFCHF-------EYILNIKTRDESLAKLGI-ATKDESRNWFSGENLGLSGTLDLLDWNSLIDSRTKISRLLLVPNLQSGQLEPLLSRFTEEEDLQMKRMLQRIDVLAKRALEKGVRLMVDAEQTYFQPAISRLTLEMQRKFNMESPIIFNTYQCYLKEAYDNVTADVELSRREGWHFGAKLVRGAYMQQERNRAMEVGYDDPINPTYDKTNEMYHRCLDYILEEI--RHNRKANVMVASHNEDTVKFTLRRMNELVIYPEEKKVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVNEVLPYLSRRAQENRGIMKGAIRERHLLWSEFKRRLLTGNLFYAPRF 591          
BLAST of Proline dehydrogenase vs. Ensembl Xenopus
Match: ENSXETT00000009159.1 (proline dehydrogenase (oxidase) 1 [Source:NCBI gene;Acc:100494891])

HSP 1 Score: 442.58 bits (1137), Expect = 1.283e-148
Identity = 226/511 (44.23%), Postives = 322/511 (63.01%), Query Frame = 1
Query:  328 TIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKA--KEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFF-KIFAEHKNQKNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYPKL 1851
            ++ G+ +FE +MK T YG FVAG  QE IK +++ N+ FGV S+LDYSVEED+T+E+A  KEI   T E   +++    +    K+Q    F +RR  VI ARTYFY  E +CD ++E F KCI+AS             K  ++ P    +  S++L++ + FF ++ AE      +  EI+ +++  QE L  + I  + DE   WF+  ++     +DL +W +L +    +  L  + +LQ+G  + L+   +++  L M+RMLQR+D LA+ A +K  RLM+DAEQ+YFQPAI R+TLE+ R+FN E PIIFNTYQCYLK+A + + +D+  + +E ++FGAKLVRGAYM+QER RA    Y DPIN TY+ T  MY+ C+D I   I  R      VM+ASHN +T++  + ++ E  I P EK + FGQLLGMCD ISF LG  G+ VYKY+PYGPV EVLPYLSRRA ENR ++  +  E++LLW E  RRL+T +L   P+ 
Sbjct:   26 SVLGQKLFEKMMKMTFYGQFVAGEDQESIKPVIRRNQAFGVGSVLDYSVEEDLTQEEAEKKEIESSTAEA--EKENLGAERREKKYQVQPGFGDRRGGVISARTYFYADEAKCDHHMETFLKCIDASGKCCQS-------KSLAIYPLFQFLQFSEVLMKWRRFFHQLAAEQGKAGMAAVEIELEVEKLQESLAKLGI-ATKDESRNWFSGENLGLSGTLDLLDWNSLIDSRTKISRLLLVPNLQSGQLEPLLSRFTEEEDLQMKRMLQRIDVLAKRALEKGVRLMVDAEQTYFQPAISRLTLEMQRKFNMESPIIFNTYQCYLKEAYDNVTADVELSRREGWHFGAKLVRGAYMQQERNRAMEVGYDDPINPTYDKTNEMYHRCLDYILEEI--RHNRKANVMVASHNEDTVKFTLRRMNELVIYPEEKKVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVNEVLPYLSRRAQENRGIMKGAIRERHLLWSEFKRRLLTGNLFYAPRF 524          
BLAST of Proline dehydrogenase vs. Ensembl Mouse
Match: Prodh (proline dehydrogenase [Source:MGI Symbol;Acc:MGI:97770])

HSP 1 Score: 471.855 bits (1213), Expect = 4.772e-159
Identity = 246/575 (42.78%), Postives = 362/575 (62.96%), Query Frame = 1
Query:  157 STKSLSHCDQTK--------IHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVK---FQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFF-KIFAEHKNQKNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYP 1845
            S ++L  C   K        + F +++ AY ++++ E++R LLV RLC+   L+ +++++ ++ R + G+ +FE +MK T YGHFVAG  QE I+ +++ N+ FGV  ILDY VEED++ E+A+   +  ME+   + ++     N +   +Q +  F +RR+ VI ARTYFY +E +CD  +E   +CI AS   A++G GF+A+KLT++G PQ L+  SD+L + + FF ++ AE      +  + K ++   Q+ +  M I  S  E   WFT   +     +DL +W +L +    L     + ++QTG  + L+   +++    M+RMLQR+D LA+ AK+   RLMIDAEQSYFQPAI R+TLE+ RRFN +KP IFNT+QCYLKDA + +  D+  A +E + FGAKLVRGAYM QER RA    Y DPIN TYE T  MY+ C++ +   +    +    VM+ASHN +T+   + +++E  + P +  +CFGQLLGMCD ISF LG  GF VYKY+PYGPV EVLPYLSRRALEN +++  ++ E+ LLW EL RRL T SL  +P
Sbjct:   32 SPEALRGCGAAKAVRPPVPAVDFTNTQEAYRSRRSWELVRNLLVLRLCASPVLLAHHEQLFQVARKLLGQRMFERLMKMTFYGHFVAGEDQESIRPLIRHNKAFGVGFILDYGVEEDLSPEEAE---RKEMESCTSEAERDGSGANKREKQYQVHPAFGDRRDGVISARTYFYANEAKCDNYMENLLQCIKASG-GASDG-GFSAIKLTALGRPQFLLQFSDVLTRWRRFFHQMAAEQGQAGRAAVDTKLEVAVLQDSIAKMGI-ASRAEIEGWFTPETLGVSGTVDLLDWNSLIDSRTRLSRHLVVPNVQTGQLEPLLSRFTEEEEQQMKRMLQRMDVLAKKAKEAGVRLMIDAEQSYFQPAISRLTLEMQRRFNVDKPFIFNTFQCYLKDAYDNVTLDMELARREGWCFGAKLVRGAYMAQERVRAAEIGYEDPINPTYEATNAMYHRCLNYVLEELKHSTKAE--VMVASHNEDTVHFTLCRMKEIGLHPADGQVCFGQLLGMCDQISFPLGQAGFPVYKYVPYGPVMEVLPYLSRRALENSSIMKGAQRERQLLWQELRRRLRTGSLFHHP 598          
BLAST of Proline dehydrogenase vs. Ensembl Mouse
Match: Prodh (proline dehydrogenase [Source:MGI Symbol;Acc:MGI:97770])

HSP 1 Score: 471.855 bits (1213), Expect = 4.772e-159
Identity = 246/575 (42.78%), Postives = 362/575 (62.96%), Query Frame = 1
Query:  157 STKSLSHCDQTK--------IHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVK---FQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFF-KIFAEHKNQKNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYP 1845
            S ++L  C   K        + F +++ AY ++++ E++R LLV RLC+   L+ +++++ ++ R + G+ +FE +MK T YGHFVAG  QE I+ +++ N+ FGV  ILDY VEED++ E+A+   +  ME+   + ++     N +   +Q +  F +RR+ VI ARTYFY +E +CD  +E   +CI AS   A++G GF+A+KLT++G PQ L+  SD+L + + FF ++ AE      +  + K ++   Q+ +  M I  S  E   WFT   +     +DL +W +L +    L     + ++QTG  + L+   +++    M+RMLQR+D LA+ AK+   RLMIDAEQSYFQPAI R+TLE+ RRFN +KP IFNT+QCYLKDA + +  D+  A +E + FGAKLVRGAYM QER RA    Y DPIN TYE T  MY+ C++ +   +    +    VM+ASHN +T+   + +++E  + P +  +CFGQLLGMCD ISF LG  GF VYKY+PYGPV EVLPYLSRRALEN +++  ++ E+ LLW EL RRL T SL  +P
Sbjct:   32 SPEALRGCGAAKAVRPPVPAVDFTNTQEAYRSRRSWELVRNLLVLRLCASPVLLAHHEQLFQVARKLLGQRMFERLMKMTFYGHFVAGEDQESIRPLIRHNKAFGVGFILDYGVEEDLSPEEAE---RKEMESCTSEAERDGSGANKREKQYQVHPAFGDRRDGVISARTYFYANEAKCDNYMENLLQCIKASG-GASDG-GFSAIKLTALGRPQFLLQFSDVLTRWRRFFHQMAAEQGQAGRAAVDTKLEVAVLQDSIAKMGI-ASRAEIEGWFTPETLGVSGTVDLLDWNSLIDSRTRLSRHLVVPNVQTGQLEPLLSRFTEEEEQQMKRMLQRMDVLAKKAKEAGVRLMIDAEQSYFQPAISRLTLEMQRRFNVDKPFIFNTFQCYLKDAYDNVTLDMELARREGWCFGAKLVRGAYMAQERVRAAEIGYEDPINPTYEATNAMYHRCLNYVLEELKHSTKAE--VMVASHNEDTVHFTLCRMKEIGLHPADGQVCFGQLLGMCDQISFPLGQAGFPVYKYVPYGPVMEVLPYLSRRALENSSIMKGAQRERQLLWQELRRRLRTGSLFHHP 598          
BLAST of Proline dehydrogenase vs. Ensembl Mouse
Match: Prodh (proline dehydrogenase [Source:MGI Symbol;Acc:MGI:97770])

HSP 1 Score: 448.743 bits (1153), Expect = 1.458e-151
Identity = 228/504 (45.24%), Postives = 321/504 (63.69%), Query Frame = 1
Query:  346 IFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVK---FQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFF-KIFAEHKNQKNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYP 1845
            +FE +MK T YGHFVAG  QE I+ +++ N+ FGV  ILDY VEED++ E+A+   +  ME+   + ++     N +   +Q +  F +RR+ VI ARTYFY +E +CD  +E   +CI AS   A++G GF+A+KLT++G PQ L+  SD+L + + FF ++ AE      +  + K ++   Q+ +  M I  S  E   WFT   +     +DL +W +L +    L     + ++QTG  + L+   +++    M+RMLQR+D LA+ AK+   RLMIDAEQSYFQPAI R+TLE+ RRFN +KP IFNT+QCYLKDA + +  D+  A +E + FGAKLVRGAYM QER RA    Y DPIN TYE T  MY+ C++ +   +    +    VM+ASHN +T+   + +++E  + P +  +CFGQLLGMCD ISF LG  GF VYKY+PYGPV EVLPYLSRRALEN +++  ++ E+ LLW EL RRL T SL  +P
Sbjct:    1 MFERLMKMTFYGHFVAGEDQESIRPLIRHNKAFGVGFILDYGVEEDLSPEEAE---RKEMESCTSEAERDGSGANKREKQYQVHPAFGDRRDGVISARTYFYANEAKCDNYMENLLQCIKASG-GASDG-GFSAIKLTALGRPQFLLQFSDVLTRWRRFFHQMAAEQGQAGRAAVDTKLEVAVLQDSIAKMGI-ASRAEIEGWFTPETLGVSGTVDLLDWNSLIDSRTRLSRHLVVPNVQTGQLEPLLSRFTEEEEQQMKRMLQRMDVLAKKAKEAGVRLMIDAEQSYFQPAISRLTLEMQRRFNVDKPFIFNTFQCYLKDAYDNVTLDMELARREGWCFGAKLVRGAYMAQERVRAAEIGYEDPINPTYEATNAMYHRCLNYVLEELKHSTKAE--VMVASHNEDTVHFTLCRMKEIGLHPADGQVCFGQLLGMCDQISFPLGQAGFPVYKYVPYGPVMEVLPYLSRRALENSSIMKGAQRERQLLWQELRRRLRTGSLFHHP 496          
BLAST of Proline dehydrogenase vs. Ensembl Mouse
Match: Prodh (proline dehydrogenase [Source:MGI Symbol;Acc:MGI:97770])

HSP 1 Score: 448.743 bits (1153), Expect = 1.458e-151
Identity = 228/504 (45.24%), Postives = 321/504 (63.69%), Query Frame = 1
Query:  346 IFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVK---FQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFF-KIFAEHKNQKNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYP 1845
            +FE +MK T YGHFVAG  QE I+ +++ N+ FGV  ILDY VEED++ E+A+   +  ME+   + ++     N +   +Q +  F +RR+ VI ARTYFY +E +CD  +E   +CI AS   A++G GF+A+KLT++G PQ L+  SD+L + + FF ++ AE      +  + K ++   Q+ +  M I  S  E   WFT   +     +DL +W +L +    L     + ++QTG  + L+   +++    M+RMLQR+D LA+ AK+   RLMIDAEQSYFQPAI R+TLE+ RRFN +KP IFNT+QCYLKDA + +  D+  A +E + FGAKLVRGAYM QER RA    Y DPIN TYE T  MY+ C++ +   +    +    VM+ASHN +T+   + +++E  + P +  +CFGQLLGMCD ISF LG  GF VYKY+PYGPV EVLPYLSRRALEN +++  ++ E+ LLW EL RRL T SL  +P
Sbjct:    1 MFERLMKMTFYGHFVAGEDQESIRPLIRHNKAFGVGFILDYGVEEDLSPEEAE---RKEMESCTSEAERDGSGANKREKQYQVHPAFGDRRDGVISARTYFYANEAKCDNYMENLLQCIKASG-GASDG-GFSAIKLTALGRPQFLLQFSDVLTRWRRFFHQMAAEQGQAGRAAVDTKLEVAVLQDSIAKMGI-ASRAEIEGWFTPETLGVSGTVDLLDWNSLIDSRTRLSRHLVVPNVQTGQLEPLLSRFTEEEEQQMKRMLQRMDVLAKKAKEAGVRLMIDAEQSYFQPAISRLTLEMQRRFNVDKPFIFNTFQCYLKDAYDNVTLDMELARREGWCFGAKLVRGAYMAQERVRAAEIGYEDPINPTYEATNAMYHRCLNYVLEELKHSTKAE--VMVASHNEDTVHFTLCRMKEIGLHPADGQVCFGQLLGMCDQISFPLGQAGFPVYKYVPYGPVMEVLPYLSRRALENSSIMKGAQRERQLLWQELRRRLRTGSLFHHP 496          
BLAST of Proline dehydrogenase vs. Ensembl Mouse
Match: Prodh (proline dehydrogenase [Source:MGI Symbol;Acc:MGI:97770])

HSP 1 Score: 249.21 bits (635), Expect = 7.058e-78
Identity = 117/208 (56.25%), Postives = 148/208 (71.15%), Query Frame = 1
Query: 1141 AEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVL 1764
             + AK+   RLMIDAEQSYFQPAI R+TLE+ RRFN +KP IFNT+QCYLKDA + +  D+  A +E + FGAKLVRGAYM QER RA    Y DPIN TYE T  MY+ C++ +   +    +    VM+ASHN +T+   + +++E  + P +  +CFGQLLGMCD ISF LG  GF VYKY+PYGPV EVLPYLSRRALEN +++
Sbjct:   37 VQKAKEAGVRLMIDAEQSYFQPAISRLTLEMQRRFNVDKPFIFNTFQCYLKDAYDNVTLDMELARREGWCFGAKLVRGAYMAQERVRAAEIGYEDPINPTYEATNAMYHRCLNYVLEELKHSTKAE--VMVASHNEDTVHFTLCRMKEIGLHPADGQVCFGQLLGMCDQISFPLGQAGFPVYKYVPYGPVMEVLPYLSRRALENSSIM 242          
BLAST of Proline dehydrogenase vs. UniProt/SwissProt
Match: sp|O45228|PROD_CAEEL (Proline dehydrogenase 1, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=prdh-1 PE=2 SV=2)

HSP 1 Score: 494.967 bits (1273), Expect = 5.184e-167
Identity = 247/564 (43.79%), Postives = 370/564 (65.60%), Query Frame = 1
Query:  163 KSLSHC-DQTKIHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKE-IVKDTMETMLDQQQKCP-------DSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTN 1827
            K L  C ++  + F +++ A+ +K  +E++RAL+V RLC I  LVN N+ IL   R + GK +F+  +K T +GHFVAG ++E+++ +V+  R +GVKSILDYSVE DIT ++A +  VK T    +      P       ++   ++  + +F +RR  V  ARTYFY  E QCD+N +IFK  INA + +A + EGF AVK+T++G PQLL+ +S+ ++Q QNFFK          SL E +   Q F +RL  + ++   +   K+F  +D + D  +DL  W ++ +    LG LF++ +++TG  + LI+ LS +     R M++R  ++AE+A +K  R+M+DAEQ+Y QPAI +IT+E+M+++NK +  IFNTYQ YLK  L+ + +D+  A +E ++FGAKLVRGAYMEQER RA+   Y DPIN  +E T+ MY  C+  I   + +R +  V VM+ASHN +T++ A++ ++E  I P+E+++C  QL GMCD +SF+LG  GFSVYKY+PYGPVEEVLPYLSRRALEN +VL K+ +E++LLW EL RR+ + 
Sbjct:   48 KELEECYNRLDLSFENTKEAFKSKSNTELVRALVVLRLCGIQTLVNQNQIILNTMRRVLGKNLFKKTLKNTFFGHFVAGETEEEVRHVVEKLRNYGVKSILDYSVEADITSQEATDKTVKGTSVATVKPAAMTPVVDAKTLETTRERYTVHEEFGDRRQGVSSARTYFYEGEEQCDKNRDIFKDSINAVA-SATKNEGFVAVKITALGRPQLLLKLSEAIVQTQNFFKALTGGM----SLQEGRLTSQEFYKRLGELGVKTDTESVKKFFDEVDFDSDGIVDLHGWNHILDDHVKLGQLFQVLNIKTGSLEPLIQNLSNEEEQEFRNMVRRTLDVAEYAIEKGVRIMVDAEQTYLQPAISKITIEMMKKYNKGRGNIFNTYQAYLKGTLQNMEADMQVARREGWHFGAKLVRGAYMEQERARAKAIGYEDPINDNFEATSKMYESCLTRIADEVHRRGKTNVSVMVASHNEDTVRFALNLMKEKCISPSERVMCMAQLYGMCDQVSFSLGQAGFSVYKYLPYGPVEEVLPYLSRRALENGSVLKKANKERDLLWKELKRRISSG 606          
BLAST of Proline dehydrogenase vs. UniProt/SwissProt
Match: sp|Q148G5|PROD_BOVIN (Proline dehydrogenase 1, mitochondrial OS=Bos taurus OX=9913 GN=PRODH PE=2 SV=1)

HSP 1 Score: 476.478 bits (1225), Expect = 3.798e-160
Identity = 237/552 (42.93%), Postives = 343/552 (62.14%), Query Frame = 1
Query:  193 IHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFK-IFAEHKNQKNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYP 1845
            + F +++ AY ++++ E+ R+LLV  LC+   L+  ++++L L R + G+ +F  +MK T YG FVAG  QE I+ +++ NR FGV SILDY VEED+T E+A+    ++  + L++          +FQ +  F +RR+ V  ARTYFY SE +CD ++E F  CI AS   + +G  F+A+KLT++G PQ L+  SD+L + + FF  + AE      +  + K ++   QE +  M I  S  E   WFT   +     +DL +W +L +    L     + ++QTG  + L+   +++    M RMLQR+D LA+ A +   RLM+DAEQ+YFQPAI R+TLE+ RRFN E+P+IFNT+QCYL+DA + +  D+  A +E + FGAKLVRGAYM Q         Y DPIN TYE T+ +Y+ C+D +   +    R    VM+ASHN +T++  + ++ E  + P ++ + FGQLLGMCDHISF LG  GF VYKY+PYGPV EVLPYLSRRALEN  V+  ++ E+ LLW EL RRL T SL   P
Sbjct:   53 VDFGNTQEAYRSRRSWELARSLLVLSLCASPALLARHEQLLHLARKLLGQRLFNTLMKMTFYGQFVAGEDQESIRPLIQHNRAFGVGSILDYGVEEDLTPEEAERTEMESCSSALERDGCGVSKREKQFQAHRAFGDRRDGVTSARTYFYASEAKCDSHMETFLHCIEASGGASEDG--FSAIKLTALGRPQFLLQFSDMLTKWRRFFHHVAAEQGKAGLAAVDTKLEVAALQESVVKMGI-ASRAEIEDWFTAETLGVSGTLDLLDWCSLIDSRTELSRHLVVPNMQTGRLEPLLSQFTEEEERQMTRMLQRMDVLAKKANQVGVRLMVDAEQTYFQPAISRLTLEMQRRFNVERPLIFNTFQCYLRDAYDNVILDVELARREGWCFGAKLVRGAYMAQ-------VGYEDPINPTYEATSAVYHRCLDYVLEELKHNARAA--VMVASHNEDTVRFTLRRMEELGLHPADRQVYFGQLLGMCDHISFPLGQAGFPVYKYVPYGPVMEVLPYLSRRALENSGVMKGAQRERQLLWQELKRRLCTRSLFHQP 592          
BLAST of Proline dehydrogenase vs. UniProt/SwissProt
Match: sp|Q9WU79|PROD_MOUSE (Proline dehydrogenase 1, mitochondrial OS=Mus musculus OX=10090 GN=Prodh PE=1 SV=2)

HSP 1 Score: 471.855 bits (1213), Expect = 3.338e-158
Identity = 246/575 (42.78%), Postives = 362/575 (62.96%), Query Frame = 1
Query:  157 STKSLSHCDQTK--------IHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVK---FQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFF-KIFAEHKNQKNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYP 1845
            S ++L  C   K        + F +++ AY ++++ E++R LLV RLC+   L+ +++++ ++ R + G+ +FE +MK T YGHFVAG  QE I+ +++ N+ FGV  ILDY VEED++ E+A+   +  ME+   + ++     N +   +Q +  F +RR+ VI ARTYFY +E +CD  +E   +CI AS   A++G GF+A+KLT++G PQ L+  SD+L + + FF ++ AE      +  + K ++   Q+ +  M I  S  E   WFT   +     +DL +W +L +    L     + ++QTG  + L+   +++    M+RMLQR+D LA+ AK+   RLMIDAEQSYFQPAI R+TLE+ RRFN +KP IFNT+QCYLKDA + +  D+  A +E + FGAKLVRGAYM QER RA    Y DPIN TYE T  MY+ C++ +   +    +    VM+ASHN +T+   + +++E  + P +  +CFGQLLGMCD ISF LG  GF VYKY+PYGPV EVLPYLSRRALEN +++  ++ E+ LLW EL RRL T SL  +P
Sbjct:   32 SPEALRGCGAAKAVRPPVPAVDFTNTQEAYRSRRSWELVRNLLVLRLCASPVLLAHHEQLFQVARKLLGQRMFERLMKMTFYGHFVAGEDQESIRPLIRHNKAFGVGFILDYGVEEDLSPEEAE---RKEMESCTSEAERDGSGANKREKQYQVHPAFGDRRDGVISARTYFYANEAKCDNYMENLLQCIKASG-GASDG-GFSAIKLTALGRPQFLLQFSDVLTRWRRFFHQMAAEQGQAGRAAVDTKLEVAVLQDSIAKMGI-ASRAEIEGWFTPETLGVSGTVDLLDWNSLIDSRTRLSRHLVVPNVQTGQLEPLLSRFTEEEEQQMKRMLQRMDVLAKKAKEAGVRLMIDAEQSYFQPAISRLTLEMQRRFNVDKPFIFNTFQCYLKDAYDNVTLDMELARREGWCFGAKLVRGAYMAQERVRAAEIGYEDPINPTYEATNAMYHRCLNYVLEELKHSTKAE--VMVASHNEDTVHFTLCRMKEIGLHPADGQVCFGQLLGMCDQISFPLGQAGFPVYKYVPYGPVMEVLPYLSRRALENSSIMKGAQRERQLLWQELRRRLRTGSLFHHP 598          
BLAST of Proline dehydrogenase vs. UniProt/SwissProt
Match: sp|Q04499|PROD_DROME (Proline dehydrogenase 1, mitochondrial OS=Drosophila melanogaster OX=7227 GN=slgA PE=2 SV=2)

HSP 1 Score: 466.077 bits (1198), Expect = 5.944e-155
Identity = 243/575 (42.26%), Postives = 359/575 (62.43%), Query Frame = 1
Query:  181 DQTKIHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKA-KEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASS-----------YTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKNSLDEIKF--DLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSI-----LQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYPK 1848
            D   + FND   A+ +K T E+IRA LV+ +CS + LV +N  ++KL R + G+ +F  +MK + YGHFVAG ++  I   ++  R FGVK ILDYSVEEDIT+E+A K  V+ ++ +  D+++   +    ++  +  FA+RR  V  ARTYFY +E  C+ N+EIF KC+ A S             A  G G TA+KLT++G PQLL+ +S+++++ + + +       Q N L   K   DL+ +   L + K      +  ++   +  +K+  + LF W  + + +  L D F++ D QTG  + LI  +        R M++RL+ + + A   + R+M+DAEQ+YFQPAI RITLE+MR++NK+K I+FNTYQCYL++   ++N+DL  A +++FYFGAKLVRGAYM+QER+RA+   Y DP+N T+E TT MY+  +      I            + +M+ASHN +T++ AI +++E  I P +K++CFGQLLGMCD+I+F LG  G+S YKY+PYGPVEEVLPYLSRRA EN+ VL K K+E+ LL  E+ RRLM   L   PK
Sbjct:  112 DPLDVSFNDPIAAFKSKTTGELIRAYLVYMICSSEKLVEHNMTLMKLARNLLGQKLFVLLMKSSFYGHFVAGENRHTIVPALERLRSFGVKPILDYSVEEDITQEEAEKREVESSVSSAGDKKE---EGSMPQYHVDKSFADRRYKVSSARTYFYLNEATCERNMEIFIKCLEAVSDDDRKAPRAVATGATFGTGITAIKLTALGRPQLLLQLSEVIMRTRKYMEDMV--GGQGNVLTHHKTIKDLEKYYATLGDNK------DVKEFLNNVTSDKEGILHLFPWSGIVDEDSQLSDTFRVPDPQTGQMRRLISQIPPKEEEMFRNMIRRLNTIVKAAADLDVRIMVDAEQTYFQPAISRITLEMMRKYNKDKAIVFNTYQCYLRETFREVNTDLEQAKRQNFYFGAKLVRGAYMDQERDRAKSLGYPDPVNPTFEATTDMYHRTLSECLRRIKLMKDCDDDARKIGIMVASHNEDTVRFAIQQMKEIGISPEDKVICFGQLLGMCDYITFPLGQAGYSAYKYIPYGPVEEVLPYLSRRAQENKGVLKKIKKEKRLLLSEIRRRLMRGQLFYKPK 675          
BLAST of Proline dehydrogenase vs. UniProt/SwissProt
Match: sp|O43272|PROD_HUMAN (Proline dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=PRODH PE=1 SV=3)

HSP 1 Score: 457.988 bits (1177), Expect = 7.653e-153
Identity = 236/552 (42.75%), Postives = 350/552 (63.41%), Query Frame = 1
Query:  193 IHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKN-SLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYP 1845
            + F +++ AY +++T E+ R+LLV RLC+   L+  ++++L + R + G+ +F  +MK T YGHFVAG  QE I+ +++  R FGV +ILDY VEED++ E+A+    ++  +  ++     +  + ++Q +  F +RRN VI ARTYFY +E +CD ++E F +CI AS   +++G  F A+KLT++G PQ L+  S++L + + FF   A  + Q   +  + K ++   QE +  + I  S  E   WFT   +     +DL +W +L +    L     + + QTG  + L+   +++  L M RMLQR+D LA+ A +   RLM+DAEQ+YFQPAI R+TLE+ R+FN EKP+IFNTYQCYLKDA + +  D+  A +E + FGAKLVRGAY+ QER RA    Y DPIN TYE T  MY+ C+D +   +    +    VM+ASHN +T++ A+ ++ E  + P +  + FGQLLGMCD ISF LG  G+ VYKY+PYGPV EVLPYLSRRALEN +++  +  E+ LLW EL+RRL T +L   P
Sbjct:   53 VDFGNAQEAYRSRRTWELARSLLVLRLCAWPALLARHEQLLYVSRKLLGQRLFNKLMKMTFYGHFVAGEDQESIQPLLRHYRAFGVSAILDYGVEEDLSPEEAEHKEMESCTSAAERDGSGTNKRDKQYQAHRAFGDRRNGVISARTYFYANEAKCDSHMETFLRCIEASGRVSDDG--FIAIKLTALGRPQFLLQFSEVLAKWRCFFHQMAVEQGQAGLAAMDTKLEVAVLQESVAKLGI-ASRAEIEDWFTAETLGVSGTMDLLDWSSLIDSRTKLSKHLVVPNAQTGQLEPLLSRFTEEEELQMTRMLQRMDVLAKKATEMGVRLMVDAEQTYFQPAISRLTLEMQRKFNVEKPLIFNTYQCYLKDAYDNVTLDVELARREGWCFGAKLVRGAYLAQERARAAEIGYEDPINPTYEATNAMYHRCLDYVLEELKHNAKAK--VMVASHNEDTVRFALRRMEELGLHPADHQVYFGQLLGMCDQISFPLGQAGYPVYKYVPYGPVMEVLPYLSRRALENSSLMKGTHRERQLLWLELLRRLRTGNLFHRP 599          
BLAST of Proline dehydrogenase vs. TrEMBL
Match: A0A5K4EWI8 (Proline dehydrogenase OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 292/557 (52.42%), Postives = 397/557 (71.27%), Query Frame = 1
Query:  178 CDQTKIHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKN-QKNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYP 1845
            C      F DS++A++AK  SE+IRALLVF++CS   LV +NKK++ + R IFGK +F  IMK T YGHFVAG ++  I+ ++   +++GVKSILDYSVE+DI E++A +IVK ++  +L   +K P++   ++Q +I FA+R   V+GAR+YFY SE QCD N+E F KCI+ SS    E  GFTA+KLT++G PQLL  +SD L+Q++  F +  +  N QK  L  +  DL NF+++L+ + I+I+YDE +KWFTLLDV+ D  +DL +W +LK FE++L  LF +K+ +TG  + L+  L+ +GI  MR M++R+D LA +AK    R+M+DAEQSYFQPAIRR+ +E+MR FNK+K +IF TYQCYLK+ALE +  DL  A  E+FYFGAKLVRGAYM+QER RA+   Y DPI S +  TT MY  C++ +F +I +R  G V VMIASHN +T++ A+ K+ E+ I P ++L+CFGQLLGMCD ISFTL   G+SVYKY+PYGPVEEVLPYLSRRALEN +VL  +  E+ LLW EL RRL     I  P
Sbjct:   52 CTTQNFSFRDSKLAHAAKSNSEVIRALLVFKICSFPTLVKHNKKLMDVSRKIFGKSLFRLIMKMTFYGHFVAGENEASIQPLIMRLKKYGVKSILDYSVEKDIQEDEAVQIVKKSLSEVLQTPEKRPEAATKQYQISIRFADRTKQVVGARSYFYKSEYQCDRNMETFMKCIDVSS-KYGEDRGFTAIKLTALGRPQLLQQMSDFLVQMKRLFFLLTKADNGQKGGL--VSLDLDNFRKKLEGLGIKIAYDENVKWFTLLDVSGDGVLDLLDWSHLKAFEYDLASLFILKNKKTGEVEQLVPTLTTEGIEEMRNMIKRVDTLASYAKSVGVRVMVDAEQSYFQPAIRRLIIEMMRLFNKDKAVIFGTYQCYLKEALESLTQDLNHAATENFYFGAKLVRGAYMDQERARAKELGYEDPICSDFNATTTMYELCLEEVFKAIKKRKSGQVSVMIASHNEDTVRHALKKMHEYDISPKDRLICFGQLLGMCDQISFTLSQAGYSVYKYVPYGPVEEVLPYLSRRALENGSVLNCTLTERQLLWSELKRRLSNGQFIYKP 605          
BLAST of Proline dehydrogenase vs. TrEMBL
Match: A0A4S2M715 (Proline dehydrogenase OS=Opisthorchis felineus OX=147828 GN=CRM22_003493 PE=3 SV=1)

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 273/554 (49.28%), Postives = 396/554 (71.48%), Query Frame = 1
Query:  193 IHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIF--AEHKNQKNSLDEIK-FDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYP 1845
            I FN+ +VA+++K   E++R ++V+R+CSI  LV  NK++++L R +FG+ IF   MK TIYGHFVAG S+EDI+ +V+  R++GVKSILDYSVE+D+ E +A E  +  +  ++      P +   ++QT++ FANR  NV+ ARTYFY SE QCD N+E+F +C++  S  + E EGF A+K+T++G PQLL+ +SD L+Q++  F +   A+  N +N   +++  D+ NF++RL+ + ++ISYD+ LKWFTLLDV+ D  +DL +W +LK+FEH+L  +F +K+ +TG  + L+  L+ DG+  MR ML+R+D +A +AK    R+M+DAEQSYFQPAIRR+T+E+MR FNK+  ++FNTYQCYLKDA + +  DL  +  E F+FGAKLVRGAY++QER R+R   Y DPI  TY+ TT MY  C+  +  +I QRP G V VM+A+HN + ++  + K+  + I P ++L+CFGQLLGMCDH+SFTLG  G+SVYKY+PYGPVE+VLPYLSRRALEN +V++K+  E+  +W EL RRL        P
Sbjct:   58 IEFNNPKVAHASKTNLELLRGIIVYRMCSIAPLVKYNKQLMELSRKVFGRSIFRLSMKSTIYGHFVAGESREDIEPVVRRLRKYGVKSILDYSVEKDVGESEAVEKARGGLAEVVRGPVVRPAAATKQYQTSLQFANRSQNVVAARTYFYESEYQCDRNMEVFLQCLDYVS-GSTEKEGFAAIKVTALGRPQLLLQMSDFLVQMKRLFNLLLAADDGNLQNQTTQLRSLDVNNFRQRLERLGVKISYDDNLKWFTLLDVSGDGVVDLLDWNHLKSFEHDLAAIFTVKNRETGKLEQLVPTLTPDGLEQMRNMLRRMDTIATYAKSVGVRVMVDAEQSYFQPAIRRLTMEMMRLFNKDGAVMFNTYQCYLKDAYDLLQQDLNHSEVEGFHFGAKLVRGAYIDQERARSRALDYEDPICPTYDSTTKMYQSCVLGVLDAIKQRPLGHVSVMMATHNEDMVRFVLEKMYGYGIAPEQRLICFGQLLGMCDHVSFTLGQRGYSVYKYVPYGPVEDVLPYLSRRALENGSVISKATLERQTMWSELKRRLKQGEFFYKP 610          
BLAST of Proline dehydrogenase vs. TrEMBL
Match: A0A183T258 (Proline dehydrogenase OS=Schistocephalus solidus OX=70667 PE=3 SV=1)

HSP 1 Score: 593.964 bits (1530), Expect = 0.000e+0
Identity = 277/555 (49.91%), Postives = 397/555 (71.53%), Query Frame = 1
Query:  193 IHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIF--AEHKNQKNSLD--EIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYP 1845
            I F D + ++ A  T E++R+  VFR+CS D+LV +NKKI+++CR I G+ +F+ +MK TIYGHFVAG  +E I  +V+  R++GVKSILDYSVE+DI E +A +  K+ +E ++D  +    + + +FQ ++ FA+R  +V  ARTYFY SE QCDEN+  F +CI+A++  A   EGF+A+KLT++G PQ L+ +SD L++++  F +   AE  +Q +      +  D+++F+++L+ + +EIS+D  + WFTL+D + D  +DL +WL+ K+FEH+L  +FKIK+ +TG  + L+  L  +GI  MR M+ R+DELA++AK +  RLMIDAE SYFQPAIRR+T+E+MRRFNK++ ++FNTYQCYL+ ALEQ+  DL  +  ++FYFGAKLVRGAYMEQER RA    Y DPIN TYE T+ MY DC++  F  I  RP+G V VM+A+HN ++++ A+ K+RE+ I P  +L+CFGQLLGMCD +SF LG  G+SVYKY+PYGPVEEVLPYLSRRA EN+++L+    E+ L   EL RRL +  L   P
Sbjct:   23 IDFRDPKTSFIAATTPELLRSTFVFRMCSWDWLVRHNKKIMEICRNILGRTLFQKLMKATIYGHFVAGEDREKIMPLVRRYRKYGVKSILDYSVEKDIPESEAVKKFKEALE-VIDTPKAMEAAASKQFQPSLQFADRSKHVFSARTYFYESEAQCDENMRTFMRCIDAATQMA-PTEGFSAIKLTALGRPQFLLQLSDFLVEMERMFYLLVNAERPSQPSPQQPMSVSIDIESFRKQLERLGVEISHDTTVNWFTLIDHSSDGVVDLLDWLHFKHFEHDLATIFKIKNKKTGRMEQLVSTLKPEGIEQMRNMIGRIDELAQYAKSRGVRLMIDAEHSYFQPAIRRLTMEMMRRFNKDQAVVFNTYQCYLRSALEQLTMDLKMSEVQNFYFGAKLVRGAYMEQERARAAELGYPDPINPTYEATSKMYEDCLEECFGVIQHRPKGTVSVMVATHNEDSVRFALQKMREYGIQPEHRLICFGQLLGMCDQVSFPLGQAGYSVYKYVPYGPVEEVLPYLSRRASENQSILSNIIVERKLRAKELRRRLFSGQLFCRP 575          
BLAST of Proline dehydrogenase vs. TrEMBL
Match: A0A3P7ED80 (Proline dehydrogenase OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS10556 PE=3 SV=1)

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 277/555 (49.91%), Postives = 397/555 (71.53%), Query Frame = 1
Query:  193 IHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIF--AEHKNQKNSLD--EIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYP 1845
            I F D + ++ A  T E++R+  VFR+CS D+LV +NKKI+++CR I G+ +F+ +MK TIYGHFVAG  +E I  +V+  R++GVKSILDYSVE+DI E +A +  K+ +E ++D  +    + + +FQ ++ FA+R  +V  ARTYFY SE QCDEN+  F +CI+A++  A   EGF+A+KLT++G PQ L+ +SD L++++  F +   AE  +Q +      +  D+++F+++L+ + +EIS+D  + WFTL+D + D  +DL +WL+ K+FEH+L  +FKIK+ +TG  + L+  L  +GI  MR M+ R+DELA++AK +  RLMIDAE SYFQPAIRR+T+E+MRRFNK++ ++FNTYQCYL+ ALEQ+  DL  +  ++FYFGAKLVRGAYMEQER RA    Y DPIN TYE T+ MY DC++  F  I  RP+G V VM+A+HN ++++ A+ K+RE+ I P  +L+CFGQLLGMCD +SF LG  G+SVYKY+PYGPVEEVLPYLSRRA EN+++L+    E+ L   EL RRL +  L   P
Sbjct:   23 IDFRDPKTSFIAATTPELLRSTFVFRMCSWDWLVRHNKKIMEICRNILGRTLFQKLMKATIYGHFVAGEDREKIMPLVRRYRKYGVKSILDYSVEKDIPESEAVKKFKEALE-VIDTPKAMEAAASKQFQPSLQFADRSKHVFSARTYFYESEAQCDENMRTFMRCIDAATQMA-PTEGFSAIKLTALGRPQFLLQLSDFLVEMERMFYLLVNAERPSQPSPQQPMSVSIDIESFRKQLERLGVEISHDTTVNWFTLIDHSSDGVVDLLDWLHFKHFEHDLATIFKIKNKKTGRMEQLVSTLKPEGIEQMRNMIGRIDELAQYAKSRGVRLMIDAEHSYFQPAIRRLTMEMMRRFNKDQAVVFNTYQCYLRSALEQLTMDLKMSEVQNFYFGAKLVRGAYMEQERARAAELGYPDPINPTYEATSKMYEDCLEECFGVIQHRPKGTVSVMVATHNEDSVRFALQKMREYGIQPEHRLICFGQLLGMCDQVSFPLGQAGYSVYKYVPYGPVEEVLPYLSRRASENQSILSNIIVERKLRAKELRRRLFSGQLFCRP 575          
BLAST of Proline dehydrogenase vs. TrEMBL
Match: A0A504Z1U8 (Proline dehydrogenase OS=Fasciola gigantica OX=46835 GN=FGIG_10541 PE=3 SV=1)

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 285/601 (47.42%), Postives = 411/601 (68.39%), Query Frame = 1
Query:   70 FRKD-LMSLRNLFFYCRNKYLTKISLFSHYSTKSLSHCD------------QTKIHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIF-----AEHKNQKNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRL 1818
            FR+  L SL N     RN Y    + FS  + + +                 T + F ++ +A+ +K   +++R ++V+RLCSI  LV  NK++++  R IFGK+IF  +MK T YGHFVAG    +IK +V   R++GVKSILDYSVE+DI E +A   VK+ +  ++ + + CPD++  K+QT++ FA+R   V+ ARTYFY SE QCD+N+E F +CI++ S++  E EGF A+K+T++G PQLL+ +S+ ++Q++  FKI      AE K+    L  +  DL NF++RL+ + + ISYDE ++WFTLLDV+ D  +DL +W +LK FEH+L  +F IK+ +T  T+ L+  L+ DG+  MR MLQR+D +A+HA     R+M+DAEQ+YFQPA+RR+T+E+MR FN+E  IIFNTYQCYLK A E ++ DL  A  E+F+FGAKLVRGAY+EQER RA    Y DPI S Y+ T+ MY  C+D +  S+  +P G V +M A+HN +TI+  + ++ E  +LP ++++CFGQL GMCDHISF L + G+SVYKY+PYGPVEEVLPYLSRRALEN ++L+K+K E+ ++W EL RR+
Sbjct:    6 FRQGFLFSLENFGIRGRNSYWNSSASFSVTTGEKIKTTQWNSGVPASQLGCATNLDFRNTRLAHISKTNIDLLRGIIVYRLCSIPQLVKWNKQLMECSRKIFGKWIFRKMMKSTFYGHFVAGEDPNEIKPVVARMRKYGVKSILDYSVEKDINESEAVNKVKEGLAKVISEPESCPDAVTRKYQTSLQFADRSKQVVAARTYFYESEYQCDKNMETFLQCIDSVSHST-EKEGFAAIKVTALGRPQLLLQMSNFIVQMERLFKILTGSIMAEGKDSITPLPAL--DLDNFRKRLEWLGVRISYDENVQWFTLLDVSGDGFVDLLDWSHLKTFEHDLARIFTIKNKKTDQTEHLVPTLTPDGLEQMRNMLQRMDTIAKHAHSAGVRVMVDAEQTYFQPAVRRLTMEMMRLFNRESAIIFNTYQCYLKCAREHLHHDLNQASLENFFFGAKLVRGAYIEQERSRAVALGYEDPICSDYDATSRMYESCVDEVLQSLKTQPNGRVAIMTATHNEDTIRYVLKRMEESGVLPEQRVICFGQLFGMCDHISFNLSNSGYSVYKYVPYGPVEEVLPYLSRRALENGSMLSKTKLERKMMWSELKRRI 603          
BLAST of Proline dehydrogenase vs. Ensembl Cavefish
Match: prodha (proline dehydrogenase 1, mitochondrial-like [Source:NCBI gene;Acc:103042105])

HSP 1 Score: 495.352 bits (1274), Expect = 4.528e-168
Identity = 244/562 (43.42%), Postives = 363/562 (64.59%), Query Frame = 1
Query:  172 SHCDQT---KIHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKN-SLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYP 1845
            +H D+T    + F+++  AY +K T E++R+LLVF+LC+ D+LV+ NK+++ L + I G+ +FE +MK T YG FVAG  Q+ IK +++ N+ FGV S+LDYSVEED+T+E+A++    +  +  +++    D    K++ +  F +RR  VI ARTYFY  E +CD ++E F KCI A +   +  +GF+A+K+T++G PQ L+  S++L++ + FF + A  + ++  ++ E K +L+  Q+ L  + +   +D +  WFT   +     IDL +W +L N    + +L  + +++TG  + L+   + +    M+RMLQR+D LA+HA +   RLM+DAEQ+YFQPAI R+TLE+ R FN  KPIIFNTYQCYLK+A + ++ D+  + +E +YFGAKLVRGAYM QER+RA    Y DPIN  YE T  MY+ C++ I   I      M  VM+ASHN +T++  + K+ E  + P E  + FGQLLGMCD ISF LG  GF VYKY+PYGPV EV+PYL RRA ENR  +  S+ E++LL+ EL RRL        P
Sbjct:   65 AHPDRTTAISVDFDNTHEAYRSKDTLELLRSLLVFKLCTFDYLVDKNKELMDLSKKILGQRMFEKLMKMTFYGQFVAGEDQDSIKPLMEKNQAFGVGSVLDYSVEEDLTQEEAEKKEMASCVSEAEKESHGIDHREKKYKAHRQFGDRRGGVISARTYFYADEAKCDHHMETFIKCIKACA--GSSVDGFSAIKMTALGRPQFLLQFSEVLVKWRRFFSLLAAQQGKEGMAVLEQKLELEQLQDSLTKLGVGAKHDIE-NWFTGEKLGSSGTIDLLDWNSLINDRTKISNLLVVPNVETGHLEPLLSRFTDEEERQMKRMLQRMDVLAKHAVENGVRLMVDAEQTYFQPAISRLTLEMQRIFNTHKPIIFNTYQCYLKEAYDNVSVDVELSRREGWYFGAKLVRGAYMHQERQRAAEIGYEDPINPEYESTNRMYHRCLEYILEEISHNR--MTNVMVASHNEDTVKFTLEKMNELGLTPGENNVFFGQLLGMCDQISFPLGQAGFPVYKYVPYGPVNEVIPYLCRRAQENRGFMKGSQRERSLLYKELKRRLFNGQFFYKP 621          
BLAST of Proline dehydrogenase vs. Ensembl Cavefish
Match: prodhb (proline dehydrogenase (oxidase) 1b [Source:ZFIN;Acc:ZDB-GENE-101116-1])

HSP 1 Score: 337.035 bits (863), Expect = 4.965e-110
Identity = 162/364 (44.51%), Postives = 235/364 (64.56%), Query Frame = 1
Query:  745 LTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQ-KNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSL 1833
            +T++G PQ L+  S++L++ + FF   A  + +    + E K DL+  Q  L+ +  E    +   WF    ++    ID+ +W  L +    + DL  + +LQ+G  + L+   +++    M+R+LQRL+ LAE+A + + RLM+DAEQ+YFQPAI R+TLE  R FN  +P+IFNTYQCYLK+A + ++ D+  + +E + FGAKLVRGAYM+QER RA    Y DPIN  YE T  MY+ C+D +   I +   G   VM+ASHNI T++  + ++ E  + P++K +CFGQLLGMCD ISF LG  GF VYKY+PYGPV EV+PYLSRRA ENR V+  ++ E+ LLW EL+RRL +  +
Sbjct:    1 MTALGRPQFLVQFSEVLMKWRCFFSFLAAKQGKYGQEVLEQKLDLEQLQAFLEKLGAE---GDVRAWFAGEKLSSSGTIDILDWNRLIDERMKVPDLLVVPNLQSGRLEPLLSKFTEEEEQQMKRILQRLEALAEYAVENSVRLMVDAEQTYFQPAISRLTLETQRSFNTHRPVIFNTYQCYLKEAYDNVSMDVELSRREGWCFGAKLVRGAYMDQERRRAAEMGYEDPINPDYESTNRMYHRCLDYVLEEIER--SGRANVMVASHNIRTVKHTLRRMNEMGLTPSDKNICFGQLLGMCDQISFPLGQAGFPVYKYVPYGPVSEVIPYLSRRAQENRGVMKGAQAERELLWSELVRRLTSGEI 359          
BLAST of Proline dehydrogenase vs. Ensembl Cavefish
Match: zgc:92040 (zgc:92040 [Source:ZFIN;Acc:ZDB-GENE-040718-87])

HSP 1 Score: 206.453 bits (524), Expect = 2.109e-59
Identity = 100/233 (42.92%), Postives = 158/233 (67.81%), Query Frame = 1
Query: 1120 LQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRL 1818
            L+RL+E+ E +  K  R+++DAE +Y  PA+  IT+ +M++FN++   I+NTYQCYLK++ + +   +  + ++SF  G KLVRGAYM++ER+ A  +   DP++ ++E T   YN  ++ + + I Q P+    +++A+HN E+++ A+ ++ E  I  +   +CFGQLLGMCDH+S TL   GFSVYK +PYG V++ LPYL RRA ENR VL   ++E++LL  EL RR+
Sbjct:  199 LRRLNEIGEASINK-VRVLVDAEYTYMNPALSLITMAMMKKFNQDGAWIWNTYQCYLKESRDLLLDAVRLSVEQSFCLGVKLVRGAYMDKERKLADKEGRADPVHQSWEYTNDCYNGSLEIMLNLISQHPQ-RYKIIVATHNEESVRKAVTRMTELGIDRDGGAVCFGQLLGMCDHVSLTLAQQGFSVYKSVPYGSVDDTLPYLVRRAQENRTVLQGIRKERDLLRQELRRRV 429          

HSP 2 Score: 68.9366 bits (167), Expect = 6.413e-12
Identity = 41/119 (34.45%), Postives = 64/119 (53.78%), Query Frame = 1
Query:  187 TKIHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDI-KSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLD 540
            T + F D   A+ AK   E+ RAL VFRLCS   LVN+  K++   RTI GK  F   ++  +Y  FVAG ++E+I +S+ K++           S+  D+ E   ++   D + +ML+
Sbjct:   21 TLLTFEDPR-AFQAKSWWELTRALGVFRLCSFPVLVNHCGKLMSFTRTILGKRAFAMALRPFVYAQFVAGETEEEIAESMEKMS-----------SLGTDLGESTGEQRYDDNLASMLE 127          
BLAST of Proline dehydrogenase vs. Ensembl Cavefish
Match: zgc:92040 (zgc:92040 [Source:ZFIN;Acc:ZDB-GENE-040718-87])

HSP 1 Score: 206.838 bits (525), Expect = 2.534e-59
Identity = 100/233 (42.92%), Postives = 158/233 (67.81%), Query Frame = 1
Query: 1120 LQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRL 1818
            L+RL+E+ E +  K  R+++DAE +Y  PA+  IT+ +M++FN++   I+NTYQCYLK++ + +   +  + ++SF  G KLVRGAYM++ER+ A  +   DP++ ++E T   YN  ++ + + I Q P+   ++ +A+HN E+++ A+ ++ E  I  +   +CFGQLLGMCDH+S TL   GFSVYK +PYG V++ LPYL RRA ENR VL   ++E++LL  EL RR+
Sbjct:  210 LRRLNEIGEASINK-VRVLVDAEYTYMNPALSLITMAMMKKFNQDGAWIWNTYQCYLKESRDLLLDAVRLSVEQSFCLGVKLVRGAYMDKERKLADKEGRADPVHQSWEYTNDCYNGSLEIMLNLISQHPQRYKII-VATHNEESVRKAVTRMTELGIDRDGGAVCFGQLLGMCDHVSLTLAQQGFSVYKSVPYGSVDDTLPYLVRRAQENRTVLQGIRKERDLLRQELRRRV 440          

HSP 2 Score: 66.2402 bits (160), Expect = 4.190e-11
Identity = 33/76 (43.42%), Postives = 45/76 (59.21%), Query Frame = 1
Query:  187 TKIHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDI 414
            T + F D   A+ AK   E+ RAL VFRLCS   LVN+  K++   RTI GK  F   ++  +Y  FVAG ++E+I
Sbjct:   40 TLLTFEDPR-AFQAKSWWELTRALGVFRLCSFPVLVNHCGKLMSFTRTILGKRAFAMALRPFVYAQFVAGETEEEI 114          
BLAST of Proline dehydrogenase vs. Ensembl Yeast
Match: PUT1 (Proline oxidase; nuclear-encoded mitochondrial protein involved in utilization of proline as sole nitrogen source; PUT1 transcription is induced by Put3p in the presence of proline and the absence of a preferred nitrogen source [Source:SGD;Acc:S000004132])

HSP 1 Score: 66.6254 bits (161), Expect = 4.926e-12
Identity = 56/201 (27.86%), Postives = 95/201 (47.26%), Query Frame = 1
Query: 1177 IDAEQSYFQP-AIRRITLELMRRFNKEKPIIFN---TYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVL--VMIASHNIETIQTAIHKLREFSILPNEKL-LCFGQLLGMCDHISFTL--GSLGFSVYKYMPYGPVEEVLPYLSRRALEN 1752
            IDAE+   Q   +  +   L ++FN     + +   T+Q YL+D+ + I  +L  A +  +  G KLVRGAY+  E+ R +I      I      T   Y+  +  + + ++          +++ASHN ++     + L+        K  +  GQLLGM D++++ L       ++ KY+P+GP  E   YL RR  EN
Sbjct:  256 IDAEKYDLQENGVYELQRILFQKFNPTSSKLISCVGTWQLYLRDSGDHILHELKLAQENGYKLGLKLVRGAYIHSEKNRNQI------IFGDKTGTDENYDRIITQVVNDLIINGEDSYFGHLVVASHNYQSQMLVTNLLKSTQDNSYAKSNIVLGQLLGMADNVTYDLITNHGAKNIIKYVPWGPPLETKDYLLRRLQEN 450          
BLAST of Proline dehydrogenase vs. Ensembl Nematostella
Match: EDO37792 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEU7])

HSP 1 Score: 461.455 bits (1186), Expect = 2.132e-156
Identity = 249/556 (44.78%), Postives = 350/556 (62.95%), Query Frame = 1
Query:  190 KIHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKNSLDEIKFDL--QNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYPKL 1851
            ++ F++++ A+ +K T EI RAL VFRLCSIDFLV  N++I+KL + + GK +F  +MK T YGHFVAG  ++DIK  +    ++GV +ILDYSVEED++EE+ K  + +  +T    Q    D  + +F+ + +FA+RR  V  ARTYFY+ E +CD  +E F +C++A+S  +++G  F A+K+T++G PQLL+ +S+IL Q Q FF         KN   +I + L    F + L+ +         L + + L V++D  ID+ EW      +  L  LFK    +TG  + LI  L+ D +  +  M  RL +L EHA+ KN RLMIDAEQSYFQPAIRR T++L R FNK  P++ NTYQCYLK A      D+  A +E F FGAKLVRGAYMEQER RA+   Y DPI+ +Y  T+  YN  ++ I        RG   VM+ASHN ++++ A+ ++ E  I P +K + FGQLLGM D +SFTLG  G+SVYKY+PYGPVE+VLPYLSRRA+ENR +L    +E+ +LW E  RRL    L  +  +
Sbjct:    8 ELKFDNAKEAFRSKTTFEIARALAVFRLCSIDFLVEKNQEIMKLSQKLMGKKLFRKVMKSTFYGHFVAGEDRDDIKPTIHNLNKYGVGAILDYSVEEDLSEEETKTAMGNKSKT----QVYIADD-HGRFKPHEEFADRRKGVFSARTYFYSGEPECDARLETFMECVDAASGASSDG--FAAIKVTALGRPQLLLKVSEILHQTQAFFDQLTMDSAIKN---KIGYGLAKNRFFDGLERLG--------LGFHSFLFVDRD--IDVIEWHEYLTPQLQLSKLFKAHPEETG--QPLITLLTPDELRQVENMRGRLHQLGEHARNKNVRLMIDAEQSYFQPAIRRFTVDLQREFNKSFPLVLNTYQCYLKSAHRDAQVDMELARREGFKFGAKLVRGAYMEQERLRAQSLGYDDPIHPSYAATSECYNQTLNDILEECR---RGGANVMVASHNEDSVRFAVKRMYELGISPEDKKVFFGQLLGMSDPLSFTLGQAGYSVYKYVPYGPVEDVLPYLSRRAMENRGLLKGILKERRMLWKEFTRRLRERQLFGHATM 538          
BLAST of Proline dehydrogenase vs. Ensembl Nematostella
Match: EDO39930 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8U9])

HSP 1 Score: 206.453 bits (524), Expect = 3.328e-62
Identity = 97/225 (43.11%), Postives = 139/225 (61.78%), Query Frame = 1
Query: 1144 EHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRL 1818
            ++A ++N RL+IDAEQSY +  I  + L L  ++NK+   ++ TYQCY KD + ++  DL     E F+FGAK+VRGAY + E +RA+   Y +PI+ +Y DT  MYND M  I   + Q P     +MIA+HN ++I  A  ++ +   LP    + F Q+ GMCDH SF LG  GF VYK +P GPV   LPYL+RR +EN  + A++ +E+ L W E+  RL
Sbjct:    4 QYAGERNVRLVIDAEQSYLEGGIHHLILALQSKYNKQGSWVYGTYQCYRKDTMSRVLRDLQVMSTEGFHFGAKIVRGAYRQMEEKRAQEMGYANPIHDSYGDTCDMYNDVMQVILEKVAQSP---AQLMIATHNEDSISLATRRMAKLC-LPKTGRVSFAQVYGMCDHASFVLGKKGFDVYKSVPCGPVGTTLPYLARRVVENSDIFARAAKERALYWQEISNRL 224          
BLAST of Proline dehydrogenase vs. Ensembl Medaka
Match: prodha (proline dehydrogenase 1, mitochondrial [Source:NCBI gene;Acc:101165161])

HSP 1 Score: 506.138 bits (1302), Expect = 2.497e-172
Identity = 247/565 (43.72%), Postives = 367/565 (64.96%), Query Frame = 1
Query:  160 TKSLSHCDQTKIH--FNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKN-SLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYP 1845
            TK++ +     IH  F++++ AY +KK  E++R+LLVF+LC+ D LV  NK+++ L + + G+ +FE +MK T YG FVAG     IK +++ N+ FGV ++LDYSVEED+T+E+A++   D+  +  +++    D    K++ +  F +RR  VI ARTYFY  E +CD+ +E F  CI ASS  +N+G  F+A+KLT++G PQ L+  S++L++ + FF   A  + + +  + E K +L+  +E L  + +  + D+   WFT   +     IDL +W +L N    + +L  I +L+TG  + L+   + +    M+RMLQR+D LA+HA     RLM+DAEQ+YFQPAI R+TLE+ R+FN+EKP+IFNTYQCYLK+A   +  D+  + +E +YFGAKLVRGAYM QER RA+   Y DPIN  YE T  MY+ C+D +   I    +    VM+A+HN +T++  + K+ E ++ P E  + FGQLLGMCD ISF LG  GF VYKY+PYGPV EV+PYLSRRA ENR  +  S+ E++LLW E+ RRL++  ++  P
Sbjct:   61 TKNVPNAQAKSIHIDFDNTQEAYKSKKNIELLRSLLVFKLCTFDVLVERNKELMALSKKLLGQRMFEKLMKMTFYGQFVAGEDHNAIKPLIQKNQAFGVGAVLDYSVEEDLTQEEAEKKEMDSCVSEAEKESPGADHREKKYKAHRQFGDRRGGVISARTYFYADEAKCDKQMETFINCIKASSGASNDG--FSAIKLTALGRPQFLLQFSEVLVKWRQFFNYLAAQQGKSDMCVLEQKLELEQLKENLAQLGVG-AKDDIENWFTGEKLGLSGAIDLLDWNSLINDTTKISNLLMIPNLETGHLEPLLNKFTAEEESQMKRMLQRVDVLAKHAVANGVRLMVDAEQTYFQPAISRLTLEMQRKFNREKPVIFNTYQCYLKEAYNNVTLDVELSRREGWYFGAKLVRGAYMYQERARAQEIGYEDPINPDYEATNRMYHKCLDYVLEEIEHNRKAN--VMVATHNEDTVKFTLEKMNEMALSPTENKVYFGQLLGMCDQISFPLGQAGFPVYKYVPYGPVNEVIPYLSRRAQENRGFMKGSQRERSLLWKEVKRRLLSGQVLYKP 620          
BLAST of Proline dehydrogenase vs. Ensembl Medaka
Match: prodha (proline dehydrogenase 1, mitochondrial [Source:NCBI gene;Acc:101165161])

HSP 1 Score: 496.508 bits (1277), Expect = 1.697e-168
Identity = 243/551 (44.10%), Postives = 358/551 (64.97%), Query Frame = 1
Query:  160 TKSLSHCDQTKIH--FNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKN-SLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHE 1803
            TK++ +     IH  F++++ AY +KK  E++R+LLVF+LC+ D LV  NK+++ L + + G+ +FE +MK T YG FVAG     IK +++ N+ FGV ++LDYSVEED+T+E+A++   D+  +  +++    D    K++ +  F +RR  VI ARTYFY  E +CD+ +E F  CI ASS  +N+G  F+A+KLT++G PQ L+  S++L++ + FF   A  + + +  + E K +L+  +E L  + +  + D+   WFT   +     IDL +W +L N    + +L  I +L+TG  + L+   + +    M+RMLQR+D LA+HA     RLM+DAEQ+YFQPAI R+TLE+ R+FN+EKP+IFNTYQCYLK+A   +  D+  + +E +YFGAKLVRGAYM QER RA+   Y DPIN  YE T  MY+ C+D +   I    +    VM+A+HN +T++  + K+ E ++ P E  + FGQLLGMCD ISF LG  GF VYKY+PYGPV EV+PYLSRRA ENR  +  S+ E++LLW E
Sbjct:   61 TKNVPNAQAKSIHIDFDNTQEAYKSKKNIELLRSLLVFKLCTFDVLVERNKELMALSKKLLGQRMFEKLMKMTFYGQFVAGEDHNAIKPLIQKNQAFGVGAVLDYSVEEDLTQEEAEKKEMDSCVSEAEKESPGADHREKKYKAHRQFGDRRGGVISARTYFYADEAKCDKQMETFINCIKASSGASNDG--FSAIKLTALGRPQFLLQFSEVLVKWRQFFNYLAAQQGKSDMCVLEQKLELEQLKENLAQLGVG-AKDDIENWFTGEKLGLSGAIDLLDWNSLINDTTKISNLLMIPNLETGHLEPLLNKFTAEEESQMKRMLQRVDVLAKHAVANGVRLMVDAEQTYFQPAISRLTLEMQRKFNREKPVIFNTYQCYLKEAYNNVTLDVELSRREGWYFGAKLVRGAYMYQERARAQEIGYEDPINPDYEATNRMYHKCLDYVLEEIEHNRKAN--VMVATHNEDTVKFTLEKMNEMALSPTENKVYFGQLLGMCDQISFPLGQAGFPVYKYVPYGPVNEVIPYLSRRAQENRGFMKGSQRERSLLWKE 606          
BLAST of Proline dehydrogenase vs. Ensembl Medaka
Match: prodha (proline dehydrogenase 1, mitochondrial [Source:NCBI gene;Acc:101165161])

HSP 1 Score: 470.7 bits (1210), Expect = 1.026e-158
Identity = 246/574 (42.86%), Postives = 356/574 (62.02%), Query Frame = 1
Query:  160 TKSLSHCDQTKIH--FNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKN-SLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSH---------IDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYP 1845
            TK++ +     IH  F++++ AY +KK  E++R+LLVF+LC+ D LV  NK++      + G+ +FE +MK T YG FVAG     IK +++ N+ FGV ++LDYSVEED+T+E+   +  D  E               K++ +  F +RR  VI ARTYFY  E +CD+ +E F  CI ASS  +N+G  F+A+KLT++G PQ L+  S++L++ + FF   A  + + +  + E K +L    E+LK  ++  S+           V+  SH         IDL +W +L N    + +L  I +L+TG  + L+   + +    M+RMLQR+D LA+HA     RLM+DAEQ+YFQPAI R+TLE+ R+FN+EKP+IFNTYQCYLK+A   +  D+  + +E +YFGAKLVRGAYM QER RA+   Y DPIN  YE T  MY+ C+D +   I    +    VM+A+HN +T++  + K+ E ++ P E  + FGQLLGMCD ISF LG  GF VYKY+PYGPV EV+PYLSRRA ENR  +  S+ E++LLW E+ RRL++  ++  P
Sbjct:   61 TKNVPNAQAKSIHIDFDNTQEAYKSKKNIELLRSLLVFKLCTFDVLVERNKEVS--LEKLLGQRMFEKLMKMTFYGQFVAGEDHNAIKPLIQKNQAFGVGAVLDYSVEEDLTQEEFLCLGADHREK--------------KYKAHRQFGDRRGGVISARTYFYADEAKCDKQMETFINCIKASSGASNDG--FSAIKLTALGRPQFLLQFSEVLVKWRQFFNYLAAQQGKSDMCVLEQKLEL----EQLKVCQVSCSH-------VFSSVSLSSHFLYIFKFGAIDLLDWNSLINDTTKISNLLMIPNLETGHLEPLLNKFTAEEESQMKRMLQRVDVLAKHAVANGVRLMVDAEQTYFQPAISRLTLEMQRKFNREKPVIFNTYQCYLKEAYNNVTLDVELSRREGWYFGAKLVRGAYMYQERARAQEIGYEDPINPDYEATNRMYHKCLDYVLEEIEHNRKAN--VMVATHNEDTVKFTLEKMNEMALSPTENKVYFGQLLGMCDQISFPLGQAGFPVYKYVPYGPVNEVIPYLSRRAQENRGFMKGSQRERSLLWKEVKRRLLSGQVLYKP 603          
BLAST of Proline dehydrogenase vs. Ensembl Medaka
Match: prodhb (proline dehydrogenase 1, mitochondrial [Source:NCBI gene;Acc:101175323])

HSP 1 Score: 459.529 bits (1181), Expect = 1.946e-154
Identity = 229/553 (41.41%), Postives = 352/553 (63.65%), Query Frame = 1
Query:  193 IHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKNSLDEI--KFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYP 1845
            + F ++  AY +K++ E++R+L+V +LCS DFLV  NK+I+ L  T+ G+  F  ++K T YG FVAG  Q  IK +++ N  FGV S+LDYSVEEDI   K ++   ++  +   +     D  + + ++   F + +    GARTY +  E +CD+++E F KCI AS  ++ EG  F+A+K+T++G PQLL+H S++L++ Q FF   A  + Q + L+ +  + +L   Q+ L  +  +  +     WFT    +   +I++ +W +L +      DL  + +++ G  + L K  + D    ++R++QRLD LA+HA +   RLM+DAEQ+YFQPAI ++T++L R  N+EKP+IFNTYQCYLK+A + + +D+  + +E ++F AKLVRGAYM+QERERA    Y DPIN  YE T+ MY+ C+D +   I    R    VM+ASHN +T++  + ++ +  +LP + ++ FGQLLGMCD ISF LG  GF+VYKY+PYGPV EV+PYLSRRA ENR  +  +++E+ LLW EL RRL +  L+  P
Sbjct:   55 VDFTETREAYKSKESLELLRSLVVLKLCSYDFLVEKNKEIMDLGETVLGQKAFHQLLKMTFYGQFVAGEDQNAIKPLIEKNLAFGVGSVLDYSVEEDIGSIKHEQKETNSCASAAGKHSLGED--HREKESEELFVSGQGGWNGARTYSHPDEAKCDQHMETFIKCIKASGGSSIEG--FSAIKMTALGRPQLLLHFSEVLMKWQRFFTFLATQQGQ-DGLEAVEQRLELTQLQDFLTKVGAKGDF---YGWFTGKQESA-GYINILDWKSLIDDREKASDLLVVPNVELGELEPLFKTFTADEEKELKRIMQRLDVLAKHALENGVRLMVDAEQTYFQPAISKLTVDLQRLQNREKPVIFNTYQCYLKEAYDSVTADVQLSRREGWHFAAKLVRGAYMDQERERAAEIGYDDPINPDYESTSRMYHRCLDYVLKEIALNRRAS--VMVASHNEDTVKHTLRRMNQLGLLPRDNVVYFGQLLGMCDQISFPLGQAGFAVYKYVPYGPVSEVMPYLSRRAQENRGFMKGAQKERGLLWKELKRRLASGELLHRP 596          
BLAST of Proline dehydrogenase vs. Ensembl Medaka
Match: zgc:92040 (proline dehydrogenase 2 [Source:NCBI gene;Acc:101155724])

HSP 1 Score: 208.379 bits (529), Expect = 8.191e-60
Identity = 100/233 (42.92%), Postives = 156/233 (66.95%), Query Frame = 1
Query: 1120 LQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRL 1818
            LQRLD++A+ A   N R+++DAE +Y  PA+  +T+ +M+++N++   I+NTYQCYLK++   +   L+ + +E F  G KLVRGAYM++ER+ A  +   DPI+ ++EDT   YN C+D +  +I Q P     +++ASHN E+++ A  ++ E  I  +   +CFGQLLGMCD++S TL   G++VYK +PYG V++ +PYL RRA ENR VL   ++E++LL  E   R+
Sbjct:  225 LQRLDKIAK-ASINNVRVLVDAEYTYMNPALSLVTMAMMKKYNRDSAWIWNTYQCYLKESRSLLLEALSLSKREGFCLGVKLVRGAYMDKERKLAEKEGRVDPIHQSWEDTNDSYNGCLDVMLRTISQNPE-RYRIIVASHNEESVRRAAKRMEELHIDKDRGSVCFGQLLGMCDYVSLTLAKEGYAVYKSVPYGSVDDTIPYLVRRAQENRTVLQGIRKERDLLRREFKHRV 455          

HSP 2 Score: 85.1149 bits (209), Expect = 4.955e-17
Identity = 43/143 (30.07%), Postives = 77/143 (53.85%), Query Frame = 1
Query:  124 YLTKISLFSHYSTKSL----SHCDQTKIHFNDSEVAYSAKKTSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLD 540
            +L+ + L    +++++    +    T ++F D   A+  K   E++RAL VFRLCS   LVNN  K++   R+I G+  F  +++ T+Y  FVAG ++ +I   ++     G++ +L   +EED+ E   +    D M  ML+
Sbjct:   12 HLSPLRLLGTAASRTVGFKQAELHPTALNFEDPS-AFRVKSLRELLRALTVFRLCSFPVLVNNCGKLMSTARSILGRKAFSLLLRPTVYAQFVAGENESEISQSMEKMSLLGLRPMLAVPMEEDLGESTGERRYDDNMAIMLE 153          
BLAST of Proline dehydrogenase vs. Planmine SMEST
Match: SMESG000077440.1 (SMESG000077440.1)

HSP 1 Score: 1038.1 bits (2683), Expect = 0.000e+0
Identity = 498/498 (100.00%), Postives = 498/498 (100.00%), Query Frame = 1
Query:  361 MKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYPKLH 1854
            MKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYPKLH
Sbjct:    1 MKQTIYGHFVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETMLDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFKKCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEHKNQKNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDLFEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLDELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQCYLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPINSTYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLREFSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLSRRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYPKLH 498          
The following BLAST results are available for this feature:
BLAST of Proline dehydrogenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AC007325.21.415e-15342.37proline dehydrogenase 1, mitochondrial [Source:NCB... [more]
PRODH1.874e-15342.37proline dehydrogenase 1 [Source:HGNC Symbol;Acc:HG... [more]
PRODH1.874e-15342.37proline dehydrogenase 1 [Source:HGNC Symbol;Acc:HG... [more]
PRODH8.982e-14044.15proline dehydrogenase 1 [Source:HGNC Symbol;Acc:HG... [more]
PRODH8.982e-14044.15proline dehydrogenase 1 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Proline dehydrogenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
prdh-14.075e-16843.79Proline dehydrogenase 1, mitochondrial [Source:Un... [more]
prdh-11.161e-15444.40Proline dehydrogenase 1, mitochondrial [Source:Un... [more]
back to top
BLAST of Proline dehydrogenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slgA9.721e-15843.09gene:FBgn0003423 transcript:FBtr0077206[more]
slgA9.721e-15843.09gene:FBgn0003423 transcript:FBtr0307528[more]
slgA9.721e-15843.09gene:FBgn0003423 transcript:FBtr0307524[more]
slgA3.256e-15743.09gene:FBgn0003423 transcript:FBtr0307527[more]
slgA3.256e-15743.09gene:FBgn0003423 transcript:FBtr0077203[more]
back to top
BLAST of Proline dehydrogenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
prodha1.718e-17044.33proline dehydrogenase (oxidase) 1a [Source:ZFIN;Ac... [more]
prodhb2.292e-10543.13proline dehydrogenase (oxidase) 1b [Source:ZFIN;Ac... [more]
prodha2.764e-8454.51proline dehydrogenase (oxidase) 1a [Source:ZFIN;Ac... [more]
zgc:920407.112e-6143.78zgc:92040 [Source:ZFIN;Acc:ZDB-GENE-040718-87][more]
back to top
BLAST of Proline dehydrogenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000009434.17.997e-17845.39proline dehydrogenase (oxidase) 1 [Source:NCBI gen... [more]
ENSXETT00000009383.17.975e-16543.77proline dehydrogenase (oxidase) 1 [Source:NCBI gen... [more]
ENSXETT00000009455.14.044e-16443.18proline dehydrogenase (oxidase) 1 [Source:NCBI gen... [more]
ENSXETT00000009247.11.570e-15643.16proline dehydrogenase (oxidase) 1 [Source:NCBI gen... [more]
ENSXETT00000009159.11.283e-14844.23proline dehydrogenase (oxidase) 1 [Source:NCBI gen... [more]
back to top
BLAST of Proline dehydrogenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prodh4.772e-15942.78proline dehydrogenase [Source:MGI Symbol;Acc:MGI:9... [more]
Prodh4.772e-15942.78proline dehydrogenase [Source:MGI Symbol;Acc:MGI:9... [more]
Prodh1.458e-15145.24proline dehydrogenase [Source:MGI Symbol;Acc:MGI:9... [more]
Prodh1.458e-15145.24proline dehydrogenase [Source:MGI Symbol;Acc:MGI:9... [more]
Prodh7.058e-7856.25proline dehydrogenase [Source:MGI Symbol;Acc:MGI:9... [more]
back to top
BLAST of Proline dehydrogenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O45228|PROD_CAEEL5.184e-16743.79Proline dehydrogenase 1, mitochondrial OS=Caenorha... [more]
sp|Q148G5|PROD_BOVIN3.798e-16042.93Proline dehydrogenase 1, mitochondrial OS=Bos taur... [more]
sp|Q9WU79|PROD_MOUSE3.338e-15842.78Proline dehydrogenase 1, mitochondrial OS=Mus musc... [more]
sp|Q04499|PROD_DROME5.944e-15542.26Proline dehydrogenase 1, mitochondrial OS=Drosophi... [more]
sp|O43272|PROD_HUMAN7.653e-15342.75Proline dehydrogenase 1, mitochondrial OS=Homo sap... [more]
back to top
BLAST of Proline dehydrogenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4EWI80.000e+052.42Proline dehydrogenase OS=Schistosoma mansoni OX=61... [more]
A0A4S2M7150.000e+049.28Proline dehydrogenase OS=Opisthorchis felineus OX=... [more]
A0A183T2580.000e+049.91Proline dehydrogenase OS=Schistocephalus solidus O... [more]
A0A3P7ED800.000e+049.91Proline dehydrogenase OS=Schistocephalus solidus O... [more]
A0A504Z1U80.000e+047.42Proline dehydrogenase OS=Fasciola gigantica OX=468... [more]
back to top
BLAST of Proline dehydrogenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
prodha4.528e-16843.42proline dehydrogenase 1, mitochondrial-like [Sourc... [more]
prodhb4.965e-11044.51proline dehydrogenase (oxidase) 1b [Source:ZFIN;Ac... [more]
zgc:920402.109e-5942.92zgc:92040 [Source:ZFIN;Acc:ZDB-GENE-040718-87][more]
zgc:920402.534e-5942.92zgc:92040 [Source:ZFIN;Acc:ZDB-GENE-040718-87][more]
back to top
BLAST of Proline dehydrogenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Proline dehydrogenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PUT14.926e-1227.86Proline oxidase; nuclear-encoded mitochondrial pro... [more]
back to top
BLAST of Proline dehydrogenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO377922.132e-15644.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399303.328e-6243.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Proline dehydrogenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prodha2.497e-17243.72proline dehydrogenase 1, mitochondrial [Source:NCB... [more]
prodha1.697e-16844.10proline dehydrogenase 1, mitochondrial [Source:NCB... [more]
prodha1.026e-15842.86proline dehydrogenase 1, mitochondrial [Source:NCB... [more]
prodhb1.946e-15441.41proline dehydrogenase 1, mitochondrial [Source:NCB... [more]
zgc:920408.191e-6042.92proline dehydrogenase 2 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Proline dehydrogenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000077440.10.000e+0100.00SMESG000077440.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021565 ID=SMED30021565|Name=Proline dehydrogenase|organism=Schmidtea mediterranea sexual|type=transcript|length=1980bp
TGAAAATGCTTTTAGAAATTTGAAATATTTATTTGATTTGAAATATTTAT
ATATATTTAATATTATAGTTTCAGAAAGGATTTGATGAGTTTGAGAAATT
TATTTTTTTATTGTCGAAATAAATATTTAACTAAAATTTCTTTATTTTCA
CATTACTCTACAAAATCATTAAGTCATTGCGATCAAACTAAAATACATTT
TAATGATTCTGAAGTTGCATATTCAGCAAAGAAAACTAGTGAAATTATTA
GAGCTTTATTGGTGTTTCGATTATGCTCTATCGATTTTTTAGTTAATAAT
AATAAAAAGATTTTAAAATTATGTAGAACAATTTTTGGAAAATACATTTT
TGAATTTATAATGAAGCAAACTATTTATGGACATTTTGTTGCTGGATCAA
GTCAAGAAGATATTAAGAGTATAGTTAAACTAAATCGACAATTCGGAGTG
AAATCTATTCTTGATTATAGTGTAGAGGAAGATATTACTGAAGAAAAAGC
TAAAGAAATTGTTAAAGACACAATGGAGACAATGCTAGATCAACAACAAA
AATGTCCAGATTCTTTGAATGTCAAATTTCAAACAAATATTGATTTTGCT
AATCGAAGAAATAATGTAATTGGTGCCCGTACTTACTTTTATACATCAGA
ATGTCAATGTGATGAAAACATAGAAATTTTTAAAAAGTGCATTAATGCTT
CGTCATATACTGCAAATGAAGGAGAAGGATTCACTGCAGTTAAGTTAACA
TCCATGGGTCCACCACAATTACTTATGCATATATCAGATATATTAATTCA
ATTACAAAACTTTTTTAAAATTTTTGCTGAGCACAAAAATCAAAAAAACT
CACTTGATGAAATTAAATTCGACCTCCAAAATTTCCAGGAAAGACTTAAA
AATATGAAAATTGAAATTAGTTATGATGAGCAATTAAAATGGTTTACTTT
GTTAGACGTTAATAAAGACAGTCATATCGACTTATTTGAGTGGCTCAATT
TAAAGAATTTTGAACATAATCTGGGCGACCTATTCAAAATAAAAGATCTC
CAAACTGGTGTTACAAAATCCCTTATTAAACCATTATCAAAAGATGGTAT
TCTTTCAATGAGACGCATGCTTCAAAGGCTTGACGAATTAGCAGAACACG
CAAAGAAGAAAAATACGCGTCTGATGATAGATGCTGAGCAATCCTATTTC
CAACCAGCAATTAGAAGAATTACTTTAGAATTAATGCGTCGTTTTAACAA
AGAAAAACCTATTATTTTTAATACTTATCAGTGTTATTTGAAGGATGCAC
TAGAACAAATAAATTCTGATTTAGCTTTTGCAGGACAAGAAAGTTTCTAC
TTCGGTGCAAAATTGGTCAGAGGAGCTTATATGGAGCAAGAAAGAGAAAG
AGCTAGAATACAGAAGTACACTGATCCTATCAATTCAACCTACGAAGATA
CAACCTACATGTATAATGATTGCATGGATGCCATTTTTCACTCTATTTTA
CAAAGACCTCGTGGAATGGTTCTTGTTATGATTGCTAGTCATAATATTGA
AACAATCCAGACAGCAATTCATAAACTTCGTGAATTCTCAATATTACCAA
ATGAAAAACTTCTATGCTTTGGTCAGTTACTTGGAATGTGCGATCATATA
AGTTTTACTTTAGGTAGTTTAGGGTTTTCCGTGTATAAATATATGCCTTA
TGGACCAGTAGAAGAAGTGCTGCCTTATCTATCCAGACGAGCATTAGAAA
ATAGAGCTGTTCTTGCAAAATCTAAAGAAGAACAAAATCTTTTGTGGCAT
GAGTTAATTAGAAGATTAATGACCAATTCATTGATAAAATATCCTAAATT
GCATTAAAAATAAATTAGAAATTAATTTATAGAGGTTTATTATTGTTTCT
ATTATAAGTACATTGCTATTTGTTTATCTTAAATATTTTCAAAATACATA
ATTGTAATCTATGTATATTTGAATTTTTAA
back to top

protein sequence of SMED30021565-orf-1

>SMED30021565-orf-1 ID=SMED30021565-orf-1|Name=SMED30021565-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=591bp
MSLRNLFFYCRNKYLTKISLFSHYSTKSLSHCDQTKIHFNDSEVAYSAKK
TSEIIRALLVFRLCSIDFLVNNNKKILKLCRTIFGKYIFEFIMKQTIYGH
FVAGSSQEDIKSIVKLNRQFGVKSILDYSVEEDITEEKAKEIVKDTMETM
LDQQQKCPDSLNVKFQTNIDFANRRNNVIGARTYFYTSECQCDENIEIFK
KCINASSYTANEGEGFTAVKLTSMGPPQLLMHISDILIQLQNFFKIFAEH
KNQKNSLDEIKFDLQNFQERLKNMKIEISYDEQLKWFTLLDVNKDSHIDL
FEWLNLKNFEHNLGDLFKIKDLQTGVTKSLIKPLSKDGILSMRRMLQRLD
ELAEHAKKKNTRLMIDAEQSYFQPAIRRITLELMRRFNKEKPIIFNTYQC
YLKDALEQINSDLAFAGQESFYFGAKLVRGAYMEQERERARIQKYTDPIN
STYEDTTYMYNDCMDAIFHSILQRPRGMVLVMIASHNIETIQTAIHKLRE
FSILPNEKLLCFGQLLGMCDHISFTLGSLGFSVYKYMPYGPVEEVLPYLS
RRALENRAVLAKSKEEQNLLWHELIRRLMTNSLIKYPKLH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR015659Proline_oxidase
IPR011992EF-hand-dom_pair
IPR029041FAD-linked_oxidoreductase-like
IPR002872Proline_DH_dom
Vocabulary: molecular function
TermDefinition
GO:0004657proline dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0071949FAD binding
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005759mitochondrial matrix
Vocabulary: biological process
TermDefinition
GO:0006560proline metabolic process
GO:0006562proline catabolic process
GO:0010133proline catabolic process to glutamate
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 339..366
NoneNo IPR availableCOILSCoilCoilcoord: 250..277
NoneNo IPR availableGENE3DG3DSA:3.20.20.220coord: 326..586
e-value: 1.9E-45
score: 157.5
NoneNo IPR availablePANTHERPTHR13914:SF22PROLINE DEHYDROGENASE 1, MITOCHONDRIALcoord: 69..583
IPR002872Proline dehydrogenase domainPFAMPF01619Pro_dhcoord: 326..563
e-value: 9.5E-78
score: 261.7
IPR015659Proline oxidase familyPANTHERPTHR13914PROLINE OXIDASEcoord: 69..583
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 239..318
IPR029041FAD-linked oxidoreductase-likeSUPERFAMILYSSF51730FAD-linked oxidoreductasecoord: 104..581