SMED30021559
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Homology
BLAST of SMED30021559 vs. Planmine SMEST
Match: SMESG000029866.1 (SMESG000029866.1) HSP 1 Score: 50.8322 bits (120), Expect = 1.197e-9 Identity = 23/42 (54.76%), Postives = 27/42 (64.29%), Query Frame = 1 Query: 25 SRKICETCVHCPMIHENAK*GKLKTRLLTMMNENIQNKWQKD 150 SR C TC C IH AK GKLKT+L+ M EN+ +KWQ D Sbjct: 320 SRSDCVTCTQCQTIHTEAKIGKLKTKLIATMTENLFDKWQND 361 HSP 2 Score: 26.9498 bits (58), Expect = 1.197e-9 Identity = 15/50 (30.00%), Postives = 27/50 (54.00%), Query Frame = 2 Query: 266 FNSFHNIIKHCQAGAKKTKIYA*NNFNMEDFEQLLFNTEQACENCQRGKS 415 FN +N++K + G KK + Y +N M + + + CENC++ K+ Sbjct: 378 FNVENNLVKKIE-GIKKVEKYICHNIAMNNLSSKVKEVIEKCENCEKRKT 426 HSP 3 Score: 23.0978 bits (48), Expect = 1.197e-9 Identity = 8/26 (30.77%), Postives = 16/26 (61.54%), Query Frame = 3 Query: 426 KTKEEIICSRESKLFSTNNVDLYNQR 503 +TKE I+ + K+F +D+Y ++ Sbjct: 430 RTKEPIVSQEDYKIFEVIYIDIYGKK 455
BLAST of SMED30021559 vs. Planmine SMEST
Match: SMESG000029259.1 (SMESG000029259.1) HSP 1 Score: 40.817 bits (94), Expect = 1.404e-9 Identity = 17/47 (36.17%), Postives = 32/47 (68.09%), Query Frame = 1 Query: 493 TIRGERYIFGIINHHCKHISLHSVKTQNKKTVVRMLKEEGVMKY*AP 633 T ++YI GII+H+ K+ISL ++ Q+++T+ L + ++K+ AP Sbjct: 3307 TFNKKKYICGIIDHYSKYISLTAINKQDERTISETLLNKWILKFGAP 3353 HSP 2 Score: 31.9574 bits (71), Expect = 1.404e-9 Identity = 20/48 (41.67%), Postives = 26/48 (54.17%), Query Frame = 2 Query: 716 ILSKP----VNGQIERQFRKIRDAIQITL*DKPHKSWVHF--HIEYSL 841 I S P NG IERQFR IR+ I +L + K+W I+Y+L Sbjct: 3381 IFSSPYHHNTNGIIERQFRTIREYINASLNEGGRKNWADIVPEIKYTL 3428 HSP 3 Score: 27.7202 bits (60), Expect = 1.404e-9 Identity = 14/36 (38.89%), Postives = 19/36 (52.78%), Query Frame = 2 Query: 296 CQAGAKKTKIYA*NNFNMEDFEQLLFNTEQACENCQ 403 C AGA+K Y NN +ME+ + + CE CQ Sbjct: 3236 CHAGAQKVTKYIQNNCDMENLATEVKKVIENCERCQ 3271 HSP 4 Score: 56.6102 bits (135), Expect = 4.395e-8 Identity = 27/49 (55.10%), Postives = 34/49 (69.39%), Query Frame = 1 Query: 25 SRKICETCVHCPMIHENAK*GKLKTRLLTMMNENIQNKWQKDSSVVERL 171 SRK C TCV C M HE+AK GK+KTR+LT+ E NKWQ D+ V+ + Sbjct: 3144 SRKTCGTCVQCMMEHEDAKTGKIKTRILTVTAEGGYNKWQNDNMEVQEI 3192 The following BLAST results are available for this feature:
BLAST of SMED30021559 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of SMED30021559 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of SMED30021559 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of SMED30021559 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of SMED30021559 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of SMED30021559 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of SMED30021559 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of SMED30021559 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 0
BLAST of SMED30021559 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of SMED30021559 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of SMED30021559 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of SMED30021559 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of SMED30021559 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of SMED30021559 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 2
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30021559 ID=SMED30021559|Name=SMED30021559|organism=Schmidtea mediterranea sexual|type=transcript|length=1412bpback to top Annotated Terms
The following terms have been associated with this transcript:
|