5-hydroxytryptamine receptor 2C

Overview
Name5-hydroxytryptamine receptor 2C
Smed IDSMED30021550
Length (bp)1978
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 5-hydroxytryptamine receptor 2C (SMED30021550) t-SNE clustered cells

Violin plots show distribution of expression levels for 5-hydroxytryptamine receptor 2C (SMED30021550) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 5-hydroxytryptamine receptor 2C (SMED30021550) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 5-hydroxytryptamine receptor 2C (SMED30021550) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021550

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30021550SMESG000032682.1 SMESG000032679.1 SmedASXL_010387SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30021550SMESG000032682.1 SMESG000032679.1 dd_Smed_v4_16037_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021550SMESG000032682.1 SMESG000032679.1 dd_Smed_v4_16037_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021550SMESG000032682.1 SMESG000032679.1 dd_Smed_v4_16037_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30021550SMESG000032682.1 SMESG000032679.1 dd_Smed_v4_16037_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30021550SMESG000032682.1 SMESG000032679.1 dd_Smed_v4_16037_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30021550SMESG000032682.1 SMESG000032679.1 dd_Smed_v4_16037_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30021550SMESG000032682.1 SMESG000032679.1 dd_Smed_v6_16037_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30021550SMESG000032682.1 SMESG000032679.1 SMED30021550smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Human
Match: HTR1A (5-hydroxytryptamine receptor 1A [Source:HGNC Symbol;Acc:HGNC:5286])

HSP 1 Score: 150.984 bits (380), Expect = 3.488e-39
Identity = 124/456 (27.19%), Postives = 208/456 (45.61%), Query Frame = 3
Query:  243 FLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTK--SRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCK 1604
             LG LI   C + GNA V  ++ +E+ LQN  N+ + SLA++DL+ ++LV+P++A   V N    ++ +  C  + +LDV   +++I+HLC+I+LDRY+ + +P+ Y N R        IS+ WLI F I+ P                   P  GW + E  S   D+      H   + I ST   F +PL +M+V Y     +   +  +  + +    + T+  + P  Q K     +S+N  + S +       +GV+ K                  G+                   +R+  D +  + + + +    +  S +      +  PT        RKN  N+          AKR + A+   +K V+ LGI+ G F+LC+LPFF++ L+  FC     M   L +   W+GYS S+LNP++Y  FN  F+N F ++++CK
Sbjct:   42 LLGTLI--FCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNK--WTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIP-------------------PMLGWRTPEDRSDP-DACTISKDHG--YTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASPAPQPK-----KSVNGESGSRN-----WRLGVESK----------------AGGAL-------------CANGAVRQGDDGAALEVIEVHR----VGNSKEHLPLPSEAGPTPCAPASFERKNERNA---------EAKRKM-ALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCK 418          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Human
Match: DRD3 (dopamine receptor D3 [Source:HGNC Symbol;Acc:HGNC:3024])

HSP 1 Score: 145.976 bits (367), Expect = 1.729e-37
Identity = 120/452 (26.55%), Postives = 197/452 (43.58%), Query Frame = 3
Query:  267 LCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNN--NFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSS---LPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRP-LTQIKITDDSQSIN-ETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRC 1601
            L  ++GN LVC++V  E+ LQ   N+ +VSLA++DLL A LVMP   +  V     NF+   R  C  + +LDV   + +I++LC+IS+DRY  +  P+ Y +   +SS   + L I+  W++ F ++CPL           G N    P    +SN                   F+I S+V++F LP  + ++ Y   ++ +++Q  + R     N      RP   Q  ++ D   +  +   S   D +    G  +                 + G  K   K   ++           S   +PK +L ++K S+         + S K+ P                     Q R    R        KKA Q++ I+ G F++C+LPFF+ ++L+  C  C  ++  L S T W+GY  S LNP++Y  FN  FR  F +++ C
Sbjct:   41 LAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFS---RICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLF---------GFNTTGDPTVCSISNPD-----------------FVIYSSVVSFYLPFGVTVLVYA-RIYVVLKQRRRKRILTRQNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQE-----------------RGGELKREEKTRNSL-----------SPTIAPKLSLEVRKLSN------GRLSTSLKLGPL--------------------QPRGVPLRE-------KKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCH-VSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC 400          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Human
Match: DRD3 (dopamine receptor D3 [Source:HGNC Symbol;Acc:HGNC:3024])

HSP 1 Score: 145.976 bits (367), Expect = 1.729e-37
Identity = 120/452 (26.55%), Postives = 197/452 (43.58%), Query Frame = 3
Query:  267 LCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNN--NFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSS---LPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRP-LTQIKITDDSQSIN-ETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRC 1601
            L  ++GN LVC++V  E+ LQ   N+ +VSLA++DLL A LVMP   +  V     NF+   R  C  + +LDV   + +I++LC+IS+DRY  +  P+ Y +   +SS   + L I+  W++ F ++CPL           G N    P    +SN                   F+I S+V++F LP  + ++ Y   ++ +++Q  + R     N      RP   Q  ++ D   +  +   S   D +    G  +                 + G  K   K   ++           S   +PK +L ++K S+         + S K+ P                     Q R    R        KKA Q++ I+ G F++C+LPFF+ ++L+  C  C  ++  L S T W+GY  S LNP++Y  FN  FR  F +++ C
Sbjct:   41 LAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFS---RICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLF---------GFNTTGDPTVCSISNPD-----------------FVIYSSVVSFYLPFGVTVLVYA-RIYVVLKQRRRKRILTRQNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQE-----------------RGGELKREEKTRNSL-----------SPTIAPKLSLEVRKLSN------GRLSTSLKLGPL--------------------QPRGVPLRE-------KKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCH-VSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC 400          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Human
Match: DRD3 (dopamine receptor D3 [Source:HGNC Symbol;Acc:HGNC:3024])

HSP 1 Score: 145.976 bits (367), Expect = 1.729e-37
Identity = 120/452 (26.55%), Postives = 197/452 (43.58%), Query Frame = 3
Query:  267 LCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNN--NFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSS---LPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRP-LTQIKITDDSQSIN-ETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRC 1601
            L  ++GN LVC++V  E+ LQ   N+ +VSLA++DLL A LVMP   +  V     NF+   R  C  + +LDV   + +I++LC+IS+DRY  +  P+ Y +   +SS   + L I+  W++ F ++CPL           G N    P    +SN                   F+I S+V++F LP  + ++ Y   ++ +++Q  + R     N      RP   Q  ++ D   +  +   S   D +    G  +                 + G  K   K   ++           S   +PK +L ++K S+         + S K+ P                     Q R    R        KKA Q++ I+ G F++C+LPFF+ ++L+  C  C  ++  L S T W+GY  S LNP++Y  FN  FR  F +++ C
Sbjct:   41 LAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFS---RICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLF---------GFNTTGDPTVCSISNPD-----------------FVIYSSVVSFYLPFGVTVLVYA-RIYVVLKQRRRKRILTRQNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQE-----------------RGGELKREEKTRNSL-----------SPTIAPKLSLEVRKLSN------GRLSTSLKLGPL--------------------QPRGVPLRE-------KKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCH-VSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC 400          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Human
Match: DRD2 (dopamine receptor D2 [Source:HGNC Symbol;Acc:HGNC:3023])

HSP 1 Score: 137.887 bits (346), Expect = 1.928e-34
Identity = 130/477 (27.25%), Postives = 220/477 (46.12%), Query Frame = 3
Query:  225 DRYQWPFLGLLIIPLCTI--WGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMP-VSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSS--LPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSF---KISHKNEFTIHLNVPTTDMRRS-YDFSPKQNLAIKKQSSLIDKSFQSFNNS--FKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMN-------SGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRC 1601
            DR  + +   L+  L  +  +GN LVC++V  EK LQ   N+ +VSLA++DLL A LVMP V    +V    F+   R  C  + +LDV   + +I++LC+IS+DRY  +  P+ Y NTR  S   + + ISI W++ F I+CPL +F L       NN +         NE           C   N  F++ S++++F +P  + ++ YI  ++ ++R+    R+ +   +SS   R   +  +  +       T+  D  +   ++  +  +             PV R            E  + +   T+   R+ Y   P  +     Q +L D S    +++      P + G+     K ++  F I        + +L  M+         KKA Q+L I+ G+F++C+LPFF+ ++L+  C  C  +   L S   W+GY  S +NPI+Y  FN  FR  F +++ C
Sbjct:   30 DRPHYNYYATLLTLLIAVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFS---RIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLY-NTRYSSKRRVTVMISIVWVLSFTISCPL-LFGL-------NNAD--------QNE-----------CIIANPAFVVYSSIVSFYVPFIVTLLVYI-KIYIVLRRR---RKRVNTKRSSRAFRAHLRAPLKGNC------THPEDMKLCTVIMKSNGSF-------------PVNRRRVVQEAARRAQELEMEMLSSTSPPERTRYSPIPPSH----HQLTLPDPSHHGLHSTPDSPAKPEKNGHAKDHPK-IAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHC-DCN-IPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFLKILHC 445          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Celegans
Match: tyra-3 (TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2L6V9])

HSP 1 Score: 142.895 bits (359), Expect = 9.463e-36
Identity = 135/501 (26.95%), Postives = 225/501 (44.91%), Query Frame = 3
Query:  246 LGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTY--ILTVWS----IIRQT----------NQARQNLYPNKSSTKSRP--LTQIKITDDSQSIN------ETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHL--NVPTTDMRRSYDFSPKQNLAIKKQSSLID-----KSFQSFNNSFKMSP--TRYGNQLSIR---KNLSNSFRIHKQSRNSAKRTLAAMNS-----GKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTE----WIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYK 1613
            L L+++ L TI+GN LV +SV + KR++   N  L SLA +DLL  L+VMP+S  +++ N+ +  + R +C  W + DV   + +I++LC ISLDRYF + +PLKY  TR R      ++  W I F +  P ++     +    NN N             +   + +K     +V + I S + +F LPL +M+  Y  I  V S    ++RQ+           + +Q    N   T S P   T++++  +   +N      E  N  +N +  S    D   C          DSP    S +       ++ L  N P   +++       +N   ++  SL D      +    N    ++P  ++   Q + R    NL      H Q     K    +         +KA++ +GI+   F++C++PFF++YL++ F I       P+   T     W+GYS S+LNPI+Y ++N  FR  F  L+   C +
Sbjct:  104 LFLVMLILLTIFGNILVVLSVVVYKRMRTFTNILLTSLATADLLVGLIVMPMSLLDLLHNHRW-PLGRFLCRMWATSDVLLCTASILNLCVISLDRYFAITSPLKYPRTRSRKMAAGLLTAVWAISFVVCSPPWVIP-SWNLFIDNNNN-------------TGSSEDFKCAYSPSVAYRIYSALGSFYLPLLVMLFVYFKIFRVASEREALMRQSVGTCRLSNRLTKTQQKNQRNNLRTASAPHSRTRVQVNHNCGRVNYSVRPVEYANRVENSLKPSHERFDSTDC---------EDSPPNGDSLEAGTTCNISMSLVTNSPPNGLQKE-----AKNSMERECHSLADIVNSADTPVRKNTEVGVAPSLSKRARQCNARLQPNNLLQKAHEHYQINGPGKAVRGSKEKMVYMRERKALKTIGIVVLGFIICWMPFFIMYLVEVF-ISDPVAESPIYRITSEFFLWLGYSNSVLNPIIYTMYNGDFRRCFRDLLSFGCVQ 574          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Celegans
Match: tyra-3 (TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2L6V9])

HSP 1 Score: 142.51 bits (358), Expect = 1.087e-35
Identity = 135/501 (26.95%), Postives = 225/501 (44.91%), Query Frame = 3
Query:  246 LGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTY--ILTVWS----IIRQT----------NQARQNLYPNKSSTKSRP--LTQIKITDDSQSIN------ETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHL--NVPTTDMRRSYDFSPKQNLAIKKQSSLID-----KSFQSFNNSFKMSP--TRYGNQLSIR---KNLSNSFRIHKQSRNSAKRTLAAMNS-----GKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTE----WIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYK 1613
            L L+++ L TI+GN LV +SV + KR++   N  L SLA +DLL  L+VMP+S  +++ N+ +  + R +C  W + DV   + +I++LC ISLDRYF + +PLKY  TR R      ++  W I F +  P ++     +    NN N             +   + +K     +V + I S + +F LPL +M+  Y  I  V S    ++RQ+           + +Q    N   T S P   T++++  +   +N      E  N  +N +  S    D   C          DSP    S +       ++ L  N P   +++       +N   ++  SL D      +    N    ++P  ++   Q + R    NL      H Q     K    +         +KA++ +GI+   F++C++PFF++YL++ F I       P+   T     W+GYS S+LNPI+Y ++N  FR  F  L+   C +
Sbjct:   76 LFLVMLILLTIFGNILVVLSVVVYKRMRTFTNILLTSLATADLLVGLIVMPMSLLDLLHNHRW-PLGRFLCRMWATSDVLLCTASILNLCVISLDRYFAITSPLKYPRTRSRKMAAGLLTAVWAISFVVCSPPWVIP-SWNLFIDNNNN-------------TGSSEDFKCAYSPSVAYRIYSALGSFYLPLLVMLFVYFKIFRVASEREALMRQSVGTCRLSNRLTKTQQKNQRNNLRTASAPHSRTRVQVNHNCGRVNYSVRPVEYANRVENSLKPSHERFDSTDC---------EDSPPNGDSLEAGTTCNISMSLVTNSPPNGLQKE-----AKNSMERECHSLADIVNSADTPVRKNTEVGVAPSLSKRARQCNARLQPNNLLQKAHEHYQINGPGKAVRGSKEKMVYMRERKALKTIGIVVLGFIICWMPFFIMYLVEVF-ISDPVAESPIYRITSEFFLWLGYSNSVLNPIIYTMYNGDFRRCFRDLLSFGCVQ 546          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Celegans
Match: tyra-3 (TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2L6V9])

HSP 1 Score: 140.969 bits (354), Expect = 1.167e-35
Identity = 132/495 (26.67%), Postives = 222/495 (44.85%), Query Frame = 3
Query:  267 LCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPE-SGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTY--ILTVWS----IIRQT----------NQARQNLYPNKSSTKSRP--LTQIKITDDSQSIN------ETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHL--NVPTTDMRRSYDFSPKQNLAIKKQSSLID-----KSFQSFNNSFKMSP--TRYGNQLSIR---KNLSNSFRIHKQSRNSAKRTLAAMNS-----GKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTE----WIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYK 1613
            L TI+GN LV +SV + KR++   N  L SLA +DLL  L+VMP+S  +++ N+ +  + R +C  W + DV   + +I++LC ISLDRYF + +PLKY  TR R      ++  W I F +  P ++               +P  + ++ N   +   + +K     +V + I S + +F LPL +M+  Y  I  V S    ++RQ+           + +Q    N   T S P   T++++  +   +N      E  N  +N +  S    D   C          DSP    S +       ++ L  N P   +++       +N   ++  SL D      +    N    ++P  ++   Q + R    NL      H Q     K    +         +KA++ +GI+   F++C++PFF++YL++ F I       P+   T     W+GYS S+LNPI+Y ++N  FR  F  L+   C +
Sbjct:    4 LLTIFGNILVVLSVVVYKRMRTFTNILLTSLATADLLVGLIVMPMSLLDLLHNHRW-PLGRFLCRMWATSDVLLCTASILNLCVISLDRYFAITSPLKYPRTRSRKMAAGLLTAVWAISFVVCSPPWV---------------IPSWNLFIDNNNNTGSSEDFKCAYSPSVAYRIYSALGSFYLPLLVMLFVYFKIFRVASEREALMRQSVGTCRLSNRLTKTQQKNQRNNLRTASAPHSRTRVQVNHNCGRVNYSVRPVEYANRVENSLKPSHERFDSTDC---------EDSPPNGDSLEAGTTCNISMSLVTNSPPNGLQKE-----AKNSMERECHSLADIVNSADTPVRKNTEVGVAPSLSKRARQCNARLQPNNLLQKAHEHYQINGPGKAVRGSKEKMVYMRERKALKTIGIVVLGFIICWMPFFIMYLVEVF-ISDPVAESPIYRITSEFFLWLGYSNSVLNPIIYTMYNGDFRRCFRDLLSFGCVQ 467          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 125.176 bits (313), Expect = 9.669e-31
Identity = 114/444 (25.68%), Postives = 203/444 (45.72%), Query Frame = 3
Query:  252 LLIIPLCTIWGNALVCVSVFIEKRLQ-NRFNFFLVSLAISDLLCALLVMPVS-AWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSK-TEWIGYSASMLNPIVYHIFNPTFR 1574
            +L + L  I+GN LV V+V+ +++L+  R N+ +VSLA++D+L  LLVMP++  + +V      ++   +C  W +LDV F + +I+H+C+ISLDRYF + +PL Y  TR    + + I ++W++   I  P  IF  R +   G    S                         ++ +++ S++ +F +P+ I+I+ Y   ++SI      +RQ L      T+ R  T   +T     I  +TN   N + Y +    D               P++    K+    +    +N     +R+  +  P+Q + I            + + +    P             S+  R  ++ +   KR        ++A  +LGI+   F+L +LPFF+IY++  F  +      PLV K   W+GY  S +NP++Y +FN  F+
Sbjct:   28 MLTVMLLIIFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGEWTMGNI---LCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPP-IFGWRPERAEGECSVST------------------------DLGYVLYSSLGSFYIPVVILIIVYA-KIYSI--TIRHSRQRL----KETERRDHTLNMLT-----IRSSTNERYN-MEYELEENSD---------------PIEDEKEKVVTNRDM---INKVCWQLRKISEELPRQGVKI------------ALDTNHNSPPA------------SDLTRKLEEKKFCEKRKRKLKAKERQATLLLGIILSAFILSWLPFFLIYVIGAFGHEAP----PLVFKFFFWLGYCNSGINPVIYTVFNREFK 384          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 125.176 bits (313), Expect = 1.056e-30
Identity = 117/444 (26.35%), Postives = 205/444 (46.17%), Query Frame = 3
Query:  252 LLIIPLCTIWGNALVCVSVFIEKRLQ-NRFNFFLVSLAISDLLCALLVMPVS-AWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSK-TEWIGYSASMLNPIVYHIFNPTFR 1574
            +L + L  I+GN LV V+V+ +++L+  R N+ +VSLA++D+L  LLVMP++  + +V      ++   +C  W +LDV F + +I+H+C+ISLDRYF + +PL Y  TR    + + I ++W++   I  P  IF  R +   G    S                         ++ +++ S++ +F +P+ I+I+ Y   ++SI      +RQ L      T+ R  T   +T     I  +TN   N + Y +    D               P++    K+    +    +N     +R+  +  P+Q +   K S  +D +  S        P             S+  R  ++ +   KR        ++A  +LGI+   F+L +LPFF+IY++  F  +      PLV K   W+GY  S +NP++Y +FN  F+
Sbjct:   28 MLTVMLLIIFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGEWTMGNI---LCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPP-IFGWRPERAEGECSVST------------------------DLGYVLYSSLGSFYIPVVILIIVYA-KIYSI--TIRHSRQRL----KETERRDHTLNMLT-----IRSSTNERYN-MEYELEENSD---------------PIEDEKEKVVTNRDM---INKVCWQLRKISEELPRQGV---KVSIALDTNHNS-------PPA------------SDLTRKLEEKKFCEKRKRKLKAKERQATLLLGIILSAFILSWLPFFLIYVIGAFGHEAP----PLVFKFFFWLGYCNSGINPVIYTVFNREFK 386          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Fly
Match: Dop2R (gene:FBgn0053517 transcript:FBtr0343171)

HSP 1 Score: 154.066 bits (388), Expect = 9.542e-39
Identity = 128/488 (26.23%), Postives = 221/488 (45.29%), Query Frame = 3
Query:  225 DRYQWPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQ-TNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSP---TRYGNQLSI-----------------RKNLSNS-------FRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSK---TEWIGYSASMLNPIVYHIFNPTFRNTFNRLM 1595
            D   W  + L++ P+ T++GN LV +SV  E+ LQ   N+F+VSLAI+DLL A++VMP + + +V  N   ++P  +C  + ++DV  ++++I +L +IS+DRY  +  P+KY   +    + L I + W I   I  P+ +  L       N  N  P+                  C  +N  FI+ S++ +F +P  IM+  Y    W+I +   ++AR+     + + +   L+++      ++I +T   A+  +  S                 S   P +  +   S  NE          +   S D      +   K +  +  +      +  M P    RYG Q ++                 RK+  NS       +++HK S+   KR  ++    +KA + L I+ G+FL C+LPFF   ++D  C K +    P ++    T W+GY  S +NP++Y IFNP FR  F ++M
Sbjct:  374 DHNYWALI-LILFPILTLFGNILVILSVCRERSLQTVTNYFIVSLAIADLLVAVVVMPFAVYFLV--NGAWALPDVVCDFYIAMDVICSTSSIFNLVAISIDRYIAVTQPIKYAKHKNSRRVCLTILLVWAISAAIGSPI-VLGLN------NTPNREPDV-----------------CAFYNADFILYSSLSSFYIPCIIMVFLY----WNIFKALRSRARK-----QRAARKPHLSELTGGSVIENIAQTRRLAETALDSS--------------RHASRILPDEAATNTASGSNE-------EEDENAISPDIDDCHVIVNDKSTEFMLATVVEETGNVAMKPLSFVRYGVQEAMTLARNDSTLSTTSKTSSRKDKKNSQASRFTIYKVHKASKK--KREKSSAKKERKATKTLAIVLGVFLFCWLPFFSCNIMDAMCAKFKKDCRPGLTAYMMTTWLGYINSFVNPVIYTIFNPEFRKAFKKIM 802          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Fly
Match: 5-HT2B (gene:FBgn0261929 transcript:FBtr0303603)

HSP 1 Score: 125.946 bits (315), Expect = 1.370e-29
Identity = 76/219 (34.70%), Postives = 119/219 (54.34%), Query Frame = 3
Query:  273 TIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRP 929
            T  GN LVC+++  E+RLQN  N+FL+SLAI+DL+ A+LVMP+    +V+   +  +    CL W  LDV F + +I+HLC+IS+DRY  L  P+++   + R  + LKI   WL+   ++ PL +       M   N  SV     L N T          C   +  + ++ +++ F +PL +M++TY LTV  + RQ    RQNL   + +  + P
Sbjct:   87 TAAGNILVCLAIAWERRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVKG--YFPLGSEHCLTWICLDVLFCTASIMHLCTISVDRYLSLRYPMRFGRNKTRRRVTLKIVFVWLLSIAMSLPLSL-------MYSKNHASV-----LVNGT----------CQIPDPVYKLVGSIVCFYIPLGVMLLTYCLTVRLLARQ----RQNLGGGQQTAAATP 277          

HSP 2 Score: 75.485 bits (184), Expect = 9.549e-14
Identity = 52/157 (33.12%), Postives = 82/157 (52.23%), Query Frame = 3
Query: 1140 TTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLS-NSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLV-SKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCK 1604
            +T +RRS      QN+  +       K+  + +     SP     Q ++R + S NS  I   SRNS+ R    +   +KA +VLG++F  F++ + PFFV+ LL   C +C+      V     W+GY++SM+NPI Y IFN  FR  F +++ C+
Sbjct:  746 STPLRRSATLRSHQNMNYQGAGECGGKTRTTTS-----SPCMLQRQQTVRSHHSRNSSVI---SRNSS-RHGRIIRLEQKATKVLGVVFFTFVILWSPFFVLNLLPTVCAECEERISHWVFDVVTWLGYASSMVNPIFYTIFNKVFRQAFKKVLLCR 893          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Fly
Match: 5-HT2B (gene:FBgn0261929 transcript:FBtr0339322)

HSP 1 Score: 125.946 bits (315), Expect = 1.370e-29
Identity = 76/219 (34.70%), Postives = 119/219 (54.34%), Query Frame = 3
Query:  273 TIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRP 929
            T  GN LVC+++  E+RLQN  N+FL+SLAI+DL+ A+LVMP+    +V+   +  +    CL W  LDV F + +I+HLC+IS+DRY  L  P+++   + R  + LKI   WL+   ++ PL +       M   N  SV     L N T          C   +  + ++ +++ F +PL +M++TY LTV  + RQ    RQNL   + +  + P
Sbjct:   87 TAAGNILVCLAIAWERRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVKG--YFPLGSEHCLTWICLDVLFCTASIMHLCTISVDRYLSLRYPMRFGRNKTRRRVTLKIVFVWLLSIAMSLPLSL-------MYSKNHASV-----LVNGT----------CQIPDPVYKLVGSIVCFYIPLGVMLLTYCLTVRLLARQ----RQNLGGGQQTAAATP 277          

HSP 2 Score: 75.485 bits (184), Expect = 9.549e-14
Identity = 52/157 (33.12%), Postives = 82/157 (52.23%), Query Frame = 3
Query: 1140 TTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLS-NSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLV-SKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCK 1604
            +T +RRS      QN+  +       K+  + +     SP     Q ++R + S NS  I   SRNS+ R    +   +KA +VLG++F  F++ + PFFV+ LL   C +C+      V     W+GY++SM+NPI Y IFN  FR  F +++ C+
Sbjct:  746 STPLRRSATLRSHQNMNYQGAGECGGKTRTTTS-----SPCMLQRQQTVRSHHSRNSSVI---SRNSS-RHGRIIRLEQKATKVLGVVFFTFVILWSPFFVLNLLPTVCAECEERISHWVFDVVTWLGYASSMVNPIFYTIFNKVFRQAFKKVLLCR 893          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Fly
Match: 5-HT2B (gene:FBgn0261929 transcript:FBtr0330144)

HSP 1 Score: 125.561 bits (314), Expect = 1.656e-29
Identity = 76/219 (34.70%), Postives = 119/219 (54.34%), Query Frame = 3
Query:  273 TIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRP 929
            T  GN LVC+++  E+RLQN  N+FL+SLAI+DL+ A+LVMP+    +V+   +  +    CL W  LDV F + +I+HLC+IS+DRY  L  P+++   + R  + LKI   WL+   ++ PL +       M   N  SV     L N T          C   +  + ++ +++ F +PL +M++TY LTV  + RQ    RQNL   + +  + P
Sbjct:   87 TAAGNILVCLAIAWERRLQNVTNYFLMSLAITDLMVAVLVMPLGILTLVKG--YFPLGSEHCLTWICLDVLFCTASIMHLCTISVDRYLSLRYPMRFGRNKTRRRVTLKIVFVWLLSIAMSLPLSL-------MYSKNHASV-----LVNGT----------CQIPDPVYKLVGSIVCFYIPLGVMLLTYCLTVRLLARQ----RQNLGGGQQTAAATP 277          

HSP 2 Score: 75.0998 bits (183), Expect = 1.121e-13
Identity = 52/157 (33.12%), Postives = 82/157 (52.23%), Query Frame = 3
Query: 1140 TTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLS-NSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLV-SKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCK 1604
            +T +RRS      QN+  +       K+  + +     SP     Q ++R + S NS  I   SRNS+ R    +   +KA +VLG++F  F++ + PFFV+ LL   C +C+      V     W+GY++SM+NPI Y IFN  FR  F +++ C+
Sbjct:  746 STPLRRSATLRSHQNMNYQGAGECGGKTRTTTS-----SPCMLQRQQTVRSHHSRNSSVI---SRNSS-RHGRIIRLEQKATKVLGVVFFTFVILWSPFFVLNLLPTVCAECEERISHWVFDVVTWLGYASSMVNPIFYTIFNKVFRQAFKKVLLCR 893          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Fly
Match: 5-HT7 (gene:FBgn0004573 transcript:FBtr0334508)

HSP 1 Score: 99.7525 bits (247), Expect = 1.399e-21
Identity = 67/198 (33.84%), Postives = 105/198 (53.03%), Query Frame = 3
Query:  252 LLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSA-WNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTY 842
            LLI+ L T+ GN LVC++V + ++L+   N+ LVSLA+SDL  ALLVMP++  + ++   NF  +   +C  W S DV   + +I++LC+IS+DRY  +  PL+Y   R    + L + I WL   CI+ P  +       + GN      E G     T+ Q           N  + I +T+ +F +PL +M+  Y
Sbjct:  169 LLIVILGTVVGNVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPL---LCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLL-------ILGNEHED--EEGQ-PICTVCQ-----------NFAYQIYATLGSFYIPLSVMLFVY 342          

HSP 2 Score: 61.2326 bits (147), Expect = 1.742e-9
Identity = 34/91 (37.36%), Postives = 49/91 (53.85%), Query Frame = 3
Query: 1371 KKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGP--LVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYKVRKAFSAN 1637
            KKA   LGI+   F +C+LPFF++ L+  F    +TM  P  L S   W+GY+ S+LNPI+Y   N  FR  F  ++  +C  +      N
Sbjct:  450 KKASTTLGIIMSAFTVCWLPFFILALIRPF----ETMHVPASLSSLFLWLGYANSLLNPIIYATLNRDFRKPFQEILYFRCSSLNTMMREN 536          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Zebrafish
Match: drd2a (dopamine receptor D2a [Source:ZFIN;Acc:ZDB-GENE-021119-2])

HSP 1 Score: 154.451 bits (389), Expect = 2.107e-40
Identity = 129/474 (27.22%), Postives = 234/474 (49.37%), Query Frame = 3
Query:  228 RYQWPFLGLLIIPL--CTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMP-VSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSS--LPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGS----FKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMN-------SGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRC 1601
            R+Q+ +  +L+  L    ++GN LVC++V  EK LQ   N+ +VSLA++DLL A LVMP V    +V    F+++    C  + +LDV   + +I++LC+IS+DRY  +  P+ Y NTR  S   + + IS+ W++ F I+CPL +F L          N+V     L              C   N  F++ S++++F +P  I ++ Y+  ++ ++R+  + R N      + ++ P+T +   D S +I + T+  D  +  ++I      C  ++ ++      V  G      +I+++N        P+   ++      +QN  +   S+L +      +    + P R GN  SI K  + +F I        + ++  +N         KKA Q+L I+ G+F++C+LPFF+ ++++ +C     +   L +   W+GY  S +NPI+Y  FN  FR  F +++ C
Sbjct:   29 RHQYNYYAMLLTLLIFVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWRFSTIH---CDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLY-NTRYSSKRRVTVMISVVWILSFAISCPL-LFGL---------NNTVTHDDAL--------------CVIANPAFVVYSSIVSFYVPFIITLLVYV-QIYVVLRK-RRKRVN------TKRTCPVTDM---DMSSTIKKCTHPDDVKLC-TVIVKSSGNCPVNNKNVIFIKEVVNNGDDIQMDEITNRN--------PSRQRKQDQSGGSQQNSRL-VNSNLRETDISPPSPEAGVKPERNGNTSSITKG-AKAFEIQVSPTGKTQTSVKTLNKRKISQQKEKKATQMLAIVLGVFIICWLPFFITHIVNTYC----QVPPELYTAFTWLGYVNSAVNPIIYTTFNIEFRKAFIKILHC 448          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Zebrafish
Match: drd2a (dopamine receptor D2a [Source:ZFIN;Acc:ZDB-GENE-021119-2])

HSP 1 Score: 154.451 bits (389), Expect = 2.107e-40
Identity = 129/474 (27.22%), Postives = 234/474 (49.37%), Query Frame = 3
Query:  228 RYQWPFLGLLIIPL--CTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMP-VSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSS--LPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGS----FKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMN-------SGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRC 1601
            R+Q+ +  +L+  L    ++GN LVC++V  EK LQ   N+ +VSLA++DLL A LVMP V    +V    F+++    C  + +LDV   + +I++LC+IS+DRY  +  P+ Y NTR  S   + + IS+ W++ F I+CPL +F L          N+V     L              C   N  F++ S++++F +P  I ++ Y+  ++ ++R+  + R N      + ++ P+T +   D S +I + T+  D  +  ++I      C  ++ ++      V  G      +I+++N        P+   ++      +QN  +   S+L +      +    + P R GN  SI K  + +F I        + ++  +N         KKA Q+L I+ G+F++C+LPFF+ ++++ +C     +   L +   W+GY  S +NPI+Y  FN  FR  F +++ C
Sbjct:   29 RHQYNYYAMLLTLLIFVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWRFSTIH---CDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLY-NTRYSSKRRVTVMISVVWILSFAISCPL-LFGL---------NNTVTHDDAL--------------CVIANPAFVVYSSIVSFYVPFIITLLVYV-QIYVVLRK-RRKRVN------TKRTCPVTDM---DMSSTIKKCTHPDDVKLC-TVIVKSSGNCPVNNKNVIFIKEVVNNGDDIQMDEITNRN--------PSRQRKQDQSGGSQQNSRL-VNSNLRETDISPPSPEAGVKPERNGNTSSITKG-AKAFEIQVSPTGKTQTSVKTLNKRKISQQKEKKATQMLAIVLGVFIICWLPFFITHIVNTYC----QVPPELYTAFTWLGYVNSAVNPIIYTTFNIEFRKAFIKILHC 448          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Zebrafish
Match: htr1aa (5-hydroxytryptamine (serotonin) receptor 1A a [Source:ZFIN;Acc:ZDB-GENE-071203-1])

HSP 1 Score: 147.517 bits (371), Expect = 2.978e-38
Identity = 125/459 (27.23%), Postives = 203/459 (44.23%), Query Frame = 3
Query:  243 FLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINET--TNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYK 1613
            FL  LI  L  I GNA V  ++ +E+ LQN  N+ + SLA++DL+ ++LV+P++A   V N    ++ + +C  + SLDV   +++I+HLC+I+LDRY+ + +P+ Y N R      + IS+ WLI F I+ P                   P  GW   E    + D        +  + I ST   F +PL +M+V Y        R    AR  +      T+     + KI D   +++       A+ +V  +                     P   G+ K S   E              S++ +  Q+++ K   SL +     F N                +N  N+    K +    ++T          V+ LGI+ G F+ C+LPFF++ L+  FC  C  M   L +   W+GYS S+LNP++Y  FN  F+N F ++++CKC +
Sbjct:   34 FLAALI--LFAILGNACVIAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNK--WTLGQEMCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAILISLTWLIGFSISIP-------------------PMLGWRKPE---DRADPDACTISQDHGYTIYSTFGAFYIPLILMLVLY-------GRIFRAARFRIRKTVKKTE-----KAKIADKCLAVSPALFPRKANGEVGKTW---------------RRSVEPCANGALKNSDDGE--------------SFEITEVQSIS-KNHLSLPNNPQPCFEN----------------RNEKNTEAKRKVALARERKT----------VKTLGIIMGTFIFCWLPFFIVALVLPFCQDC-FMPEWLGAVINWLGYSNSLLNPVIYAYFNKDFQNAFKKILKCKCIR 397          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Zebrafish
Match: drd2l (dopamine receptor D2 like [Source:ZFIN;Acc:ZDB-GENE-030910-1])

HSP 1 Score: 146.362 bits (368), Expect = 1.280e-37
Identity = 121/456 (26.54%), Postives = 212/456 (46.49%), Query Frame = 3
Query:  252 LLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAW-NMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRI--RSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAK---RTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRC 1601
            L+++  C ++GN LVCV+V  EK LQ   N+ +VSLA+SDLL A LVMP   +  +V    F+   R  C    +LDV   + +I++LC+IS+DRY  +  PL Y NTR   R  + L I++ W + F I+CPL +F L                    N T SQ+    + C   +  F++ S+V +F +P  + ++ Y+  +  ++R+  +         ++T+           D+Q   +   +   DV    + +                +P ++   K++   E  +H            D  P   L+  ++ +    S ++   S  ++P    +    R++     + H +   +AK   R   +    +KA Q+L I+ G+F++C+LPFF+ ++L   C  C  ++  L S   W+GY  S +NP++Y  FN  FR  F +++ C
Sbjct:   47 LVLLIFCVVFGNVLVCVAVSREKALQTTTNYLIVSLAVSDLLLATLVMPWGVYLEVVGEWRFS---RIHCDVLLTLDVMMCTASILNLCAISIDRYTAVAMPLLY-NTRYSSRRRVALMIAVVWFLSFAISCPL-LFGL--------------------NNTASQE---GRDCSFADPAFVVYSSVASFYVPFIVTLLVYV-QICVVLRRRGRRTAPTRRRAANTEP---------ADAQRTRKNKCTHPEDVKLCTLILKPP-----------AAAPQRK---KVTLVKEAVVH----------PLDVEPVCFLSADREQTQTQPSGRA-KLSLSVAPCAGQSGPGPRRDTLQE-KTHTEKHAAAKERVRGRLSQQKERKATQMLAIVLGVFIICWLPFFLTHVLKAHCGSC-CISPSLYSAVTWLGYLNSAVNPVIYTTFNIEFRKAFIKILHC 437          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Zebrafish
Match: drd2l (dopamine receptor D2 like [Source:ZFIN;Acc:ZDB-GENE-030910-1])

HSP 1 Score: 145.976 bits (367), Expect = 2.305e-37
Identity = 121/456 (26.54%), Postives = 212/456 (46.49%), Query Frame = 3
Query:  252 LLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAW-NMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRI--RSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAK---RTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRC 1601
            L+++  C ++GN LVCV+V  EK LQ   N+ +VSLA+SDLL A LVMP   +  +V    F+   R  C    +LDV   + +I++LC+IS+DRY  +  PL Y NTR   R  + L I++ W + F I+CPL +F L                    N T SQ+    + C   +  F++ S+V +F +P  + ++ Y+  +  ++R+  +         ++T+           D+Q   +   +   DV    + +                +P ++   K++   E  +H            D  P   L+  ++ +    S ++   S  ++P    +    R++     + H +   +AK   R   +    +KA Q+L I+ G+F++C+LPFF+ ++L   C  C  ++  L S   W+GY  S +NP++Y  FN  FR  F +++ C
Sbjct:   60 LVLLIFCVVFGNVLVCVAVSREKALQTTTNYLIVSLAVSDLLLATLVMPWGVYLEVVGEWRFS---RIHCDVLLTLDVMMCTASILNLCAISIDRYTAVAMPLLY-NTRYSSRRRVALMIAVVWFLSFAISCPL-LFGL--------------------NNTASQE---GRDCSFADPAFVVYSSVASFYVPFIVTLLVYV-QICVVLRRRGRRTAPTRRRAANTEP---------ADAQRTRKNKCTHPEDVKLCTLILKPP-----------AAAPQRK---KVTLVKEAVVH----------PLDVEPVCFLSADREQTQTQPSGRA-KLSLSVAPCAGQSGPGPRRDTLQE-KTHTEKHAAAKERVRGRLSQQKERKATQMLAIVLGVFIICWLPFFLTHVLKAHCGSC-CISPSLYSAVTWLGYLNSAVNPVIYTTFNIEFRKAFIKILHC 450          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Xenopus
Match: DRD2 (dopamine receptor D2 [Source:NCBI gene;Acc:100493063])

HSP 1 Score: 150.984 bits (380), Expect = 4.711e-39
Identity = 131/479 (27.35%), Postives = 220/479 (45.93%), Query Frame = 3
Query:  228 RYQWPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMP-VSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSS--LPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQ------TNQARQNLYPNKSSTKSRPLTQIKI------------TDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRC 1601
             Y +  + L ++    ++GN LVC++V  EK LQ   N+ +VSLA++DLL A LVMP V    +V    F+   R  C  + +LDV   + +I++LC+IS+DRY  +  P+ Y NTR  S   + + IS+ W++ F I+CPL +F L       NN  S                   K C   N  F+I S++++F +P  + ++ Y+  ++ ++R+      T +    +  N    K      +K+            TD  + ++E  N  + D+   M+                  SP ++   K +  N     L VP T  + +    P          S +D  +++  N      T+      I+   +   R     +  +KR L + +  KKA Q+L I+ G+F++C+LPFF+I++L+  C  C  +   L S   W+GY  S +NPI+Y  FN  FR  F +++ C
Sbjct:   27 HYNYYAMLLTLLIFVIVFGNVLVCIAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYMEVVGEWRFS---RIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLY-NTRYSSKRRVTVMISVVWVLSFAISCPL-LFGL-------NNTAS-------------------KVCIIDNPAFVIYSSIVSFYVPFIVTLLVYV-QIYIVLRKRRKRVNTKRNSHGVEVNAHKDKCTHPEDVKLCAVFVKSNGSFPTDKKKVVSEAGNHPE-DMDVEMMS---------------STSPPEKTKHKSASPNHH--QLAVPATSNQCNNANLP----------SPVDSPYKAEKNGHPKDSTKPAKVFEIQTMPNGKTR--TSIKTMSKRKL-SQHKEKKATQMLAIVLGVFIICWLPFFIIHILNMHC-NCN-IPQALYSAFTWLGYVNSAVNPIIYTTFNVEFRKAFIKILHC 440          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Xenopus
Match: slc25a29 (solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29 [Source:Xenbase;Acc:XB-GENE-5763797])

HSP 1 Score: 137.117 bits (344), Expect = 4.547e-34
Identity = 79/220 (35.91%), Postives = 119/220 (54.09%), Query Frame = 3
Query:  237 WPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNL 896
            WP L  + + L TI GN LV ++V +EK+LQN  N+FL+SLAI+D+L   LVMPVS  N++ +  +  + R +C  W  LDV F++ +I+HLC+ISLDRY  + NP+ +     R+    KI   W I   I+ P+ +F L+ D    +  N                      C   +  FIII + + F +PL IM++TY LT+ S+ ++      NL
Sbjct:   67 WPALLTVTVILVTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLNILNDYEW-PLHRKLCPVWIYLDVLFSTASIMHLCAISLDRYIAIRNPIHHSRFNSRTKALAKIIAVWTISVGISMPVPVFGLQDDSKVFDQEN----------------------CSLSDENFIIIGSFVAFFIPLIIMVITYFLTIKSLQKEATLCINNL 263          

HSP 2 Score: 77.411 bits (189), Expect = 2.306e-14
Identity = 35/105 (33.33%), Postives = 69/105 (65.71%), Query Frame = 3
Query: 1314 IHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKC--QTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYKVRK 1622
            + K+     ++T+ ++++ +KA +VLGI+F LF++ + PFF+  ++  FC +   + + G L+    WIGY +S +NP+VY +FN T+R+ F+R ++C+  + +K
Sbjct:  290 LQKELAPYGRKTMQSISNEQKASKVLGIVFFLFVIMWCPFFITNVMAVFCKESCNEHVIGELLKVFVWIGYLSSAVNPLVYTLFNQTYRSAFSRYIQCRYREEKK 394          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Xenopus
Match: slc25a29 (solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29 [Source:Xenbase;Acc:XB-GENE-5763797])

HSP 1 Score: 136.732 bits (343), Expect = 5.202e-34
Identity = 79/220 (35.91%), Postives = 119/220 (54.09%), Query Frame = 3
Query:  237 WPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNL 896
            WP L  + + L TI GN LV ++V +EK+LQN  N+FL+SLAI+D+L   LVMPVS  N++ +  +  + R +C  W  LDV F++ +I+HLC+ISLDRY  + NP+ +     R+    KI   W I   I+ P+ +F L+ D    +  N                      C   +  FIII + + F +PL IM++TY LT+ S+ ++      NL
Sbjct:   60 WPALLTVTVILVTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLNILNDYEW-PLHRKLCPVWIYLDVLFSTASIMHLCAISLDRYIAIRNPIHHSRFNSRTKALAKIIAVWTISVGISMPVPVFGLQDDSKVFDQEN----------------------CSLSDENFIIIGSFVAFFIPLIIMVITYFLTIKSLQKEATLCINNL 256          

HSP 2 Score: 77.411 bits (189), Expect = 2.339e-14
Identity = 35/105 (33.33%), Postives = 69/105 (65.71%), Query Frame = 3
Query: 1314 IHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKC--QTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYKVRK 1622
            + K+     ++T+ ++++ +KA +VLGI+F LF++ + PFF+  ++  FC +   + + G L+    WIGY +S +NP+VY +FN T+R+ F+R ++C+  + +K
Sbjct:  283 LQKELAPYGRKTMQSISNEQKASKVLGIVFFLFVIMWCPFFITNVMAVFCKESCNEHVIGELLKVFVWIGYLSSAVNPLVYTLFNQTYRSAFSRYIQCRYREEKK 387          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Xenopus
Match: slc25a29 (solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29 [Source:Xenbase;Acc:XB-GENE-5763797])

HSP 1 Score: 137.117 bits (344), Expect = 5.347e-34
Identity = 79/220 (35.91%), Postives = 119/220 (54.09%), Query Frame = 3
Query:  237 WPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNL 896
            WP L  + + L TI GN LV ++V +EK+LQN  N+FL+SLAI+D+L   LVMPVS  N++ +  +  + R +C  W  LDV F++ +I+HLC+ISLDRY  + NP+ +     R+    KI   W I   I+ P+ +F L+ D    +  N                      C   +  FIII + + F +PL IM++TY LT+ S+ ++      NL
Sbjct:   69 WPALLTVTVILVTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLNILNDYEW-PLHRKLCPVWIYLDVLFSTASIMHLCAISLDRYIAIRNPIHHSRFNSRTKALAKIIAVWTISVGISMPVPVFGLQDDSKVFDQEN----------------------CSLSDENFIIIGSFVAFFIPLIIMVITYFLTIKSLQKEATLCINNL 265          

HSP 2 Score: 77.411 bits (189), Expect = 2.265e-14
Identity = 35/105 (33.33%), Postives = 69/105 (65.71%), Query Frame = 3
Query: 1314 IHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKC--QTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYKVRK 1622
            + K+     ++T+ ++++ +KA +VLGI+F LF++ + PFF+  ++  FC +   + + G L+    WIGY +S +NP+VY +FN T+R+ F+R ++C+  + +K
Sbjct:  292 LQKELAPYGRKTMQSISNEQKASKVLGIVFFLFVIMWCPFFITNVMAVFCKESCNEHVIGELLKVFVWIGYLSSAVNPLVYTLFNQTYRSAFSRYIQCRYREEKK 396          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Xenopus
Match: slc25a29 (solute carrier family 25 (mitochondrial carnitine/acylcarnitine carrier), member 29 [Source:Xenbase;Acc:XB-GENE-5763797])

HSP 1 Score: 137.117 bits (344), Expect = 5.847e-34
Identity = 79/220 (35.91%), Postives = 119/220 (54.09%), Query Frame = 3
Query:  237 WPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNL 896
            WP L  + + L TI GN LV ++V +EK+LQN  N+FL+SLAI+D+L   LVMPVS  N++ +  +  + R +C  W  LDV F++ +I+HLC+ISLDRY  + NP+ +     R+    KI   W I   I+ P+ +F L+ D    +  N                      C   +  FIII + + F +PL IM++TY LT+ S+ ++      NL
Sbjct:   89 WPALLTVTVILVTIAGNILVIMAVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLNILNDYEW-PLHRKLCPVWIYLDVLFSTASIMHLCAISLDRYIAIRNPIHHSRFNSRTKALAKIIAVWTISVGISMPVPVFGLQDDSKVFDQEN----------------------CSLSDENFIIIGSFVAFFIPLIIMVITYFLTIKSLQKEATLCINNL 285          

HSP 2 Score: 77.411 bits (189), Expect = 2.300e-14
Identity = 35/105 (33.33%), Postives = 69/105 (65.71%), Query Frame = 3
Query: 1314 IHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKC--QTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYKVRK 1622
            + K+     ++T+ ++++ +KA +VLGI+F LF++ + PFF+  ++  FC +   + + G L+    WIGY +S +NP+VY +FN T+R+ F+R ++C+  + +K
Sbjct:  312 LQKELAPYGRKTMQSISNEQKASKVLGIVFFLFVIMWCPFFITNVMAVFCKESCNEHVIGELLKVFVWIGYLSSAVNPLVYTLFNQTYRSAFSRYIQCRYREEKK 416          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Mouse
Match: Drd3 (dopamine receptor D3 [Source:MGI Symbol;Acc:MGI:94925])

HSP 1 Score: 147.132 bits (370), Expect = 8.596e-38
Identity = 124/459 (27.02%), Postives = 205/459 (44.66%), Query Frame = 3
Query:  267 LCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNN--NFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSS---LPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRP-LTQIKITDDSQSINETTNSAD--NDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMN------SGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRC 1601
            L  I+GN LVC +V  E+ LQ   N+ +VSLA++DLL A LVMP   +  V     NF+   R  C  + +LDV   + +I++LC+IS+DRY  +  P+ Y +   +SS   + L I+  W++ F ++CPL           G N    P    +SN                   F+I S+V++F +P  + ++ Y   ++ ++RQ  + R     N      RP   Q         I + +  A   +D +  M  ++DK              P K     +SH    +        +++R Y        +I + ++L   +F+      ++  TR     ++   LS   R     R S    L  +         KKA Q++ I+ G F++C+LPFF+ ++L+  C  C  ++  L   T W+GY  S LNP++Y  FN  FR  F +++ C
Sbjct:   41 LAIIFGNGLVCAAVLRERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFS---RICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLF---------GFNTTGDPSICSISNPD-----------------FVIYSSVVSFYVPFGVTVLVYA-RIYMVLRQRRRKRILTRQNSQCISIRPGFPQQSSCLRLHPIRQFSIRARFLSDATGQMEHIEDK------------PYPQKCQDPLLSHLQPLSPGQT--HGELKRYY--------SICQDTALRHPNFEGGGGMSQVERTRNSLSPTMAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKKATQMVVIVLGAFIVCWLPFFLTHVLNTHCQACH-VSPELYRATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC 446          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Mouse
Match: Drd3 (dopamine receptor D3 [Source:MGI Symbol;Acc:MGI:94925])

HSP 1 Score: 146.747 bits (369), Expect = 2.001e-37
Identity = 127/469 (27.08%), Postives = 209/469 (44.56%), Query Frame = 3
Query:  267 LCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNN--NFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSS---LPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQ----ARQNL--------YPNKSST-KSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMN------SGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRC 1601
            L  I+GN LVC +V  E+ LQ   N+ +VSLA++DLL A LVMP   +  V     NF+   R  C  + +LDV   + +I++LC+IS+DRY  +  P+ Y +   +SS   + L I+  W++ F ++CPL           G N    P    +SN                   F+I S+V++F +P  + ++ Y   ++ ++RQ  +     RQN         +P +SS  +  P+ Q  I     S          D +  M  ++DK              P K     +SH    +        +++R Y        +I + ++L   +F+      ++  TR     ++   LS   R     R S    L  +         KKA Q++ I+ G F++C+LPFF+ ++L+  C  C  ++  L   T W+GY  S LNP++Y  FN  FR  F +++ C
Sbjct:   73 LAIIFGNGLVCAAVLRERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFS---RICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLF---------GFNTTGDPSICSISNPD-----------------FVIYSSVVSFYVPFGVTVLVYA-RIYMVLRQRRRKRILTRQNSQCISIRPGFPQQSSCLRLHPIRQFSIRARFLS----------DATGQMEHIEDK------------PYPQKCQDPLLSHLQPLSP--GQTHGELKRYY--------SICQDTALRHPNFEGGGGMSQVERTRNSLSPTMAPKLSLEVRKLSNGRLSTSLKLGPLQPRGVPLREKKATQMVVIVLGAFIVCWLPFFLTHVLNTHCQACH-VSPELYRATTWLGYVNSALNPVIYTTFNIEFRKAFLKILSC 478          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Mouse
Match: Htr1a (5-hydroxytryptamine (serotonin) receptor 1A [Source:MGI Symbol;Acc:MGI:96273])

HSP 1 Score: 141.739 bits (356), Expect = 4.279e-36
Identity = 123/458 (26.86%), Postives = 204/458 (44.54%), Query Frame = 3
Query:  243 FLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSI---IRQTNQARQNLYPNKS-STKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCK 1604
             LG LI   C + GNA V  ++ +E+ LQN  N+ + SLA++DL+ ++LV+P++A   V N    ++ +  C  + +LDV   +++I+HLC+I+LDRY+ + +P+ Y N R        IS+ WLI F I+ P                   P  GW + E  S   +        +  + I ST   F +PL +M+V Y     +    IR+T +  +      S  T S P          +S+N    S D   S     V                +P   G+ +   +++ T+ +     ++ R  +   K +L +  +S                  T Y      RKN   +    K +    ++T+          + LGI+ G F+LC+LPFF++ L+  FC     M   L +   W+GYS S+LNP++Y  FN  F+N F ++++CK
Sbjct:   42 LLGTLI--FCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNK--WTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIP-------------------PMLGWRTPEDRSNPNECTIS---KDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKKGAGTSFGTSSAP-------PPKKSLNGQPGSGDCRRSAENRAVG---------------TPCANGAVR-QGEDDATLEV----IEVHRVGN--SKGHLPLPSES----------------GATSYVPACLERKNERTAEAKRKMALARERKTV----------KTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPELLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCK 418          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Mouse
Match: Drd2 (dopamine receptor D2 [Source:MGI Symbol;Acc:MGI:94924])

HSP 1 Score: 140.198 bits (352), Expect = 2.611e-35
Identity = 130/482 (26.97%), Postives = 217/482 (45.02%), Query Frame = 3
Query:  225 DRYQWPFLGLLIIPLC--TIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMP-VSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSS--LPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKIS--------HKNEFTIHLNVPTTDMRRS-YDFSPKQNLAIKKQSSLIDKSFQSF--NNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMN-------SGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRC 1601
            DR  + +  +L+  L    ++GN LVC++V  EK LQ   N+ +VSLA++DLL A LVMP V    +V    F+   R  C  + +LDV   + +I++LC+IS+DRY  +  P+ Y NTR  S   + + I+I W++ F I+CPL +F L       NN +         NE           C   N  F++ S++++F +P  + ++ YI  ++ ++R   + R+ +   +SS   R   +  +  +                      D K C+               GSF ++           E  + +   T+   R+ Y   P  +     Q +L D S      N      P + G+   +   ++  F I        + +L  M+         KKA Q+L I+ G+F++C+LPFF+ ++L+  C  C  +   L S   W+GY  S +NPI+Y  FN  FR  F +++ C
Sbjct:   30 DRPHYNYYAMLLTLLIFIIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFS---RIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLY-NTRYSSKRRVTVMIAIVWVLSFTISCPL-LFGL-------NNTD--------QNE-----------CIIANPAFVVYSSIVSFYVPFIVTLLVYI-KIYIVLR---KRRKRVNTKRSSRAFRANLKTPLKGNCTHPE-----------------DMKLCTVIMK---------SNGSFPVNRRRMDAARRAQELEMEMLSSTSPPERTRYSPIPPSH----HQLTLPDPSHHGLHSNPDSPAKPEKNGHAKIVNPRIAKFFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHC-DCN-IPPVLYSAFTWLGYVNSAVNPIIYTTFNIEFRKAFMKILHC 444          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Mouse
Match: Htr2c (5-hydroxytryptamine (serotonin) receptor 2C [Source:MGI Symbol;Acc:MGI:96281])

HSP 1 Score: 140.198 bits (352), Expect = 2.831e-35
Identity = 79/213 (37.09%), Postives = 126/213 (59.15%), Query Frame = 3
Query:  237 WPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQT 875
            WP L +++I + TI GN LV ++V +EK+L N  N+FL+SLAI+D+L  LLVMP+S   ++ +  +  +PR +C  W SLDV F++ +I+HLC+ISLDRY  + NP+++     R+   +KI+I W I   ++ P+ +  LR             ES    N T          C  ++  F++I + + F +PL IM++TY LT++ + RQT
Sbjct:   56 WPALSIVVIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW-PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGVSVPIPVIGLR------------DESKVFVNNT---------TCVLNDPNFVLIGSFVAFFIPLTIMVITYFLTIYVLRRQT 246          

HSP 2 Score: 73.9442 bits (180), Expect = 2.132e-13
Identity = 39/94 (41.49%), Postives = 59/94 (62.77%), Query Frame = 3
Query: 1347 TLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKC--QTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYKVRK 1622
            T+ A+N+ KKA +VLGI+F +FL+ + PFF+  +L   C K   Q +   L++   WIGY  S +NP+VY +FN  +R  F++ +RC  YK  K
Sbjct:  300 TMQAINNEKKASKVLGIVFFVFLIMWCPFFITNILSVLCGKACNQKLMEKLLNVFVWIGYVCSGINPLVYTLFNKIYRRAFSKYLRCD-YKPDK 392          
BLAST of 5-hydroxytryptamine receptor 2C vs. UniProt/SwissProt
Match: sp|P19327|5HT1A_RAT (5-hydroxytryptamine receptor 1A OS=Rattus norvegicus OX=10116 GN=Htr1a PE=1 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 3.678e-39
Identity = 128/455 (28.13%), Postives = 209/455 (45.93%), Query Frame = 3
Query:  243 FLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTN-QARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCK 1604
             LG LI   C + GNA V  ++ +E+ LQN  N+ + SLA++DL+ ++LV+P++A   V N    ++ +  C  + +LDV   +++I+HLC+I+LDRY+ + +P+ Y N R        IS+ WLI F I+ P                   P  GW + E  S   D+      H   + I ST   F +PL +M+V Y      I R    + R+ +   +       L         +S+N    S D            + C        +  +P   G+ +    +E T+ +     ++ R  +   K++L +  +S          +NS       Y      RKN  N+          AKR + A+   +K V+ LGI+ G F+LC+LPFF++ L+  FC     M   L +   W+GYS S+LNP++Y  FN  F+N F ++++CK
Sbjct:   42 LLGTLI--FCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNK--WTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIP-------------------PMLGWRTPEDRSDP-DACTISKDHG--YTIYSTFGAFYIPLLLMLVLY----GRIFRAARFRIRKTVRKVEKKGAGTSLGTSSAPPPKKSLNGQPGSGDW-----------RRC----AENRAVGTPCTNGAVR-QGDDEATLEV----IEVHRVGN--SKEHLPLPSESG---------SNS-------YAPACLERKNERNA---------EAKRKM-ALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCK 418          
BLAST of 5-hydroxytryptamine receptor 2C vs. UniProt/SwissProt
Match: sp|Q9N298|5HT1A_PANTR (5-hydroxytryptamine receptor 1A OS=Pan troglodytes OX=9598 GN=HTR1A PE=3 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 1.391e-38
Identity = 124/456 (27.19%), Postives = 208/456 (45.61%), Query Frame = 3
Query:  243 FLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTK--SRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCK 1604
             LG LI   C + GNA V  ++ +E+ LQN  N+ + SLA++DL+ ++LV+P++A   V N    ++ +  C  + +LDV   +++I+HLC+I+LDRY+ + +P+ Y N R        IS+ WLI F I+ P                   P  GW + E  S   D+      H   + I ST   F +PL +M+V Y     +   +  +  + +    + T+  + P  Q K     +S+N  + S +       +GV+ K                  G+                   +R+  D +  + + + +    +  S +      +  PT        RKN  N+          AKR + A+   +K V+ LGI+ G F+LC+LPFF++ L+  FC     M   L +   W+GYS S+LNP++Y  FN  F+N F ++++CK
Sbjct:   42 LLGTLI--FCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNK--WTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIP-------------------PMLGWRTPEDRSDP-DACTISKDHG--YTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASPAQQPK-----KSVNGESGSRN-----WRLGVESK----------------AGGAL-------------CANGAVRQGDDGAALEVIEVHR----VGNSKEHLPLPSEAGPTPCAPASFERKNERNA---------EAKRKM-ALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCK 418          
BLAST of 5-hydroxytryptamine receptor 2C vs. UniProt/SwissProt
Match: sp|P08908|5HT1A_HUMAN (5-hydroxytryptamine receptor 1A OS=Homo sapiens OX=9606 GN=HTR1A PE=1 SV=3)

HSP 1 Score: 150.984 bits (380), Expect = 1.675e-38
Identity = 124/456 (27.19%), Postives = 208/456 (45.61%), Query Frame = 3
Query:  243 FLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTK--SRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCK 1604
             LG LI   C + GNA V  ++ +E+ LQN  N+ + SLA++DL+ ++LV+P++A   V N    ++ +  C  + +LDV   +++I+HLC+I+LDRY+ + +P+ Y N R        IS+ WLI F I+ P                   P  GW + E  S   D+      H   + I ST   F +PL +M+V Y     +   +  +  + +    + T+  + P  Q K     +S+N  + S +       +GV+ K                  G+                   +R+  D +  + + + +    +  S +      +  PT        RKN  N+          AKR + A+   +K V+ LGI+ G F+LC+LPFF++ L+  FC     M   L +   W+GYS S+LNP++Y  FN  F+N F ++++CK
Sbjct:   42 LLGTLI--FCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNK--WTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIP-------------------PMLGWRTPEDRSDP-DACTISKDHG--YTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASPAPQPK-----KSVNGESGSRN-----WRLGVESK----------------AGGAL-------------CANGAVRQGDDGAALEVIEVHR----VGNSKEHLPLPSEAGPTPCAPASFERKNERNA---------EAKRKM-ALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCK 418          
BLAST of 5-hydroxytryptamine receptor 2C vs. UniProt/SwissProt
Match: sp|Q9N297|5HT1A_GORGO (5-hydroxytryptamine receptor 1A OS=Gorilla gorilla gorilla OX=9595 GN=HTR1A PE=3 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 1.865e-38
Identity = 124/456 (27.19%), Postives = 208/456 (45.61%), Query Frame = 3
Query:  243 FLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTK--SRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCK 1604
             LG LI   C + GNA V  ++ +E+ LQN  N+ + SLA++DL+ ++LV+P++A   V N    ++ +  C  + +LDV   +++I+HLC+I+LDRY+ + +P+ Y N R        IS+ WLI F I+ P                   P  GW + E  S   D+      H   + I ST   F +PL +M+V Y     +   +  +  + +    + T+  + P  Q K     +S+N  + S +       +GV+ K                  G+                   +R+  D +  + + + +    +  S +      +  PT        RKN  N+          AKR + A+   +K V+ LGI+ G F+LC+LPFF++ L+  FC     M   L +   W+GYS S+LNP++Y  FN  F+N F ++++CK
Sbjct:   42 LLGTLI--FCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNK--WTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIP-------------------PMLGWRTPEDRSDP-DACTISKDHG--YTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASPAPQPK-----KSVNGESGSRN-----WRLGVESK----------------AGGAL-------------CANGAVRQGDDGAALEVIEVHR----VGNSKEHLPLPSEAGPTPCAPASFERKNERNA---------EAKRKM-ALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCK 418          
BLAST of 5-hydroxytryptamine receptor 2C vs. UniProt/SwissProt
Match: sp|Q17232|OAR_BOMMO (Octopamine receptor OS=Bombyx mori OX=7091 PE=2 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 9.860e-38
Identity = 125/460 (27.17%), Postives = 226/460 (49.13%), Query Frame = 3
Query:  252 LLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVS-AWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYI-LTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIH-LNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKM---SPTRYGNQLSIRKNLSNSFR--IHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKC 1607
            L +I + T+ GN LV +SVF  K L+   NFF+VSLA++DL  A+LV+P++ A++++    F      +C  W + D+   +++I++LC+I+LDRY+ + +P+ Y   R    +   I I W++   I+ P  +             N  PE   +       +L S  G       F+I S+  +F +PL IM V Y  + + +  R  ++A+       SS +++  T+    +D  S++   N  ++     ++  ++K             +P K+   +   K++ + + L +P      S      +NL  +  SS  +      +N  ++   +P +   Q   ++N +N+    I ++ R S  R        ++A + LGI+ G+F++C+LPFFVIYL+  FC+ C  ++   ++   W+GY  S LNP++Y IFN  FR  F +L+  KC
Sbjct:   61 LTMIIISTVVGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVAILVLPLNVAYSILGQWVFGIY---VCKMWLTCDIMCCTSSILNLCAIALDRYWAITDPINYAQKRTLERVLFMIGIVWILSLVISSPPLL-----------GWNDWPE---VFEPDTPCRLTSQPG-------FVIFSSSGSFYIPLVIMTVVYFEIYLATKKRLRDRAKATKISTISSGRNKYETKESDPNDQDSVSSDANPNEHQGGTRLVAENEK------KHRTRKLTPKKKPKRRYWSKDDKSHNKLIIPILSNENSVT-DIGENLENRNTSSESNSKETHEDNMIEITEAAPVKI--QKRPKQNQTNAVYQFIEEKQRISLTRE-------RRAARTLGIIMGVFVVCWLPFFVIYLVIPFCVSC-CLSNKFINFITWLGYVNSALNPLIYTIFNMDFRRAFKKLLFIKC 479          
BLAST of 5-hydroxytryptamine receptor 2C vs. TrEMBL
Match: A0A193KUM1 (GCR037 OS=Schmidtea mediterranea OX=79327 GN=gcr037 PE=2 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 1.963e-119
Identity = 215/488 (44.06%), Postives = 301/488 (61.68%), Query Frame = 3
Query:  234 QWPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSI--RKNLSNSFRIHKQSRNSAKR-------------------------TLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYKV 1616
            +W FL LL+IP+ TI+GN LV VSV++EKRLQNRFN+FLVSLA+SD LCA+LVMPVS   MV  +     P  +CLAWYSLDVFFT+TTIIHLC+IS+DRY  LNNPL++H T+ + SL +KISI+WLIPF IACPLF+ +L++                   ET++Q+  S+KGCGP+N  FI+ + ++TF+LPL IM+++YILTV +I +QT     + +      KSR  +Q +I   S             ++ S++ V+ K C   + SLN     +   S   S ++  + + N PTT  +       ++N+   K++             F+   +R   Q+SI  RK   N+ R+H+ S  +++R                         +L  +   +KAVQVLGI+FGLF+ CY+PFFVIYL DFFC+ C+++T  ++S +EWIGYSASM+NP+VYHIFNPTFR TFNRL+RC+CYKV
Sbjct:   28 KWAFLFLLLIPIITIFGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKI-------------------ETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNL--DSFSTNGHRKSR-FSQSEIYKKSM--------PSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCN-NFPTTPSK------IQENIDGDKETYF----------DFRGKFSRLSRQMSIPFRK---NTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKV 465          
BLAST of 5-hydroxytryptamine receptor 2C vs. TrEMBL
Match: A0A193KU74 (GCR027 OS=Schmidtea mediterranea OX=79327 GN=gcr027 PE=2 SV=1)

HSP 1 Score: 340.887 bits (873), Expect = 2.414e-106
Identity = 190/502 (37.85%), Postives = 279/502 (55.58%), Query Frame = 3
Query:  225 DRYQWPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSST------KSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKI------SHKNEFTIHLNV---------PTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQ---------------SFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKC--QTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYKV 1616
             RY W ++GL IIP+ ++WGN+LVC+SV++E  L+ RFN+FLVSLA+SD LCA+LVMP+SAW M+ N    ++    CL WYSLDVFFT++TIIHLC+IS+DRY  L NPLK H  +   SL +++  AW+IPF IACPLF+FAL LD                     +++  S+KGCGP N YFI+I+T++TF +PL IM VTY+LTV  +  Q  +A  NLY N  ++       S  L +   T  ++ ++E   +  N+ S +M           +   + F        F++      + +N F  + ++         P     +     P++ ++ ++Q    +  ++               S   SFKMS           K  ++ +      +   ++ L  +N  +KAVQ LGILF LF++CYLPFFV YL+DFF   C   +    +++  EW+GYS SM NPIVYH FNP FR+T+ RLM+C+CY+V
Sbjct:   15 SRYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDK--------------------TREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPPLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMS----------NKTKTDEYSAFYTKKKETEKQLKQINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRV 486          
BLAST of 5-hydroxytryptamine receptor 2C vs. TrEMBL
Match: A0A4S2M3D3 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002997 PE=3 SV=1)

HSP 1 Score: 298.13 bits (762), Expect = 6.565e-90
Identity = 193/491 (39.31%), Postives = 278/491 (56.62%), Query Frame = 3
Query:  243 FLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMV--RNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNT--RIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQ-NLYPNKSSTKSRPLTQIKI----TDDSQSINETTNS-------ADNDVSY---------SMIGVDDKYCXXXXXX--XXXXXXPVKRGSFKI-------SHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLA--AMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKC 1607
            ++ L +IPL TIWGN  VC++V++E+RL++RFN FLVSLAISDLLCA+LVMPVSAW+M+  R  N     R +CL  YS+D+FFT+TTIIHLCSISLDRY  L  P   +    +I  SL L+I ++W +PF IA PLF+FAL+ +   G+   +V  +   +N TIS+   SYKGCGP++  F++ +  +TFVLPL IM  TY+LTV  + R   Q +   LY    +T+ RP++   +     D+S    ET  S        D   +          S  G D+K     SLS  L+  + P ++   +I       S ++E ++  N      +   D S  Q   IK   +L   S    ++         G +LS    L    +  +   +SA+ T A   ++SGK+AV+V+ +LFGLF+ CY PFF++Y +   C +C++   P +   EW+GY  SMLNP+VYH FN TFR TF R+++C C
Sbjct:    9 YIALCLIPLGTIWGNICVCLAVYMERRLRHRFNLFLVSLAISDLLCAILVMPVSAWHMIATRPQN-----RILCLVSYSMDIFFTATTIIHLCSISLDRYLALRRPFGRNRALPKIFQSLVLRIFMSWFVPFSIAGPLFVFALKWER--GDEEFNVTMTPEAANITISK---SYKGCGPNDKSFVLTAIGVTFVLPLIIMTATYVLTVKMLRRHMAQVKAIQLY----ATRPRPVSTSSVLWLRRDNSFRPTETNRSTKAWFRQTDQQTTIPKTAKYMPPSDCGCDEKTVKTCSLSDPLSYHNRPAEKPRTRIPIGVENPSTQDEASLSGN--RVSGKDPSDRSNDQQSYIKASETLFLTSTAKTDHDIS------GLELSSNHELGLPSQGRRTDISSAQTTTAIDRIHSGKRAVRVIAVLFGLFVTCYTPFFIVYTISVVCPQCRSWAEPAIPHLEWLGYLNSMLNPVVYHSFNSTFRRTFRRILQCAC 477          
BLAST of 5-hydroxytryptamine receptor 2C vs. TrEMBL
Match: A0A1S8WK07 (7 transmembrane receptor (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_09436 PE=3 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 1.436e-87
Identity = 189/487 (38.81%), Postives = 271/487 (55.65%), Query Frame = 3
Query:  243 FLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMV--RNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNT--RIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQ-NLYPNKSSTKSRPLTQIKI----TDDS---QSINETTNS----ADNDVSY----SMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISH-KNEFTIHLNVPTTDMRRSY--------DFSPKQNLAIKKQSSLIDKSFQSF-NNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLA--AMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKC 1607
            ++ L +IPL TIWGN  VC++V++E+RL++RFN FLVSLAISDLLCA+LVMPVSAW+M+  R  N     R +CL  YS+D+FFT+TTIIHLCSISLDRY  L  P   +    +I  SL  +I ++W +PF IA PLF+FAL+ +   G+    V  +   +N T S+   SYKGCGP++  F++ +  +TFVLPL IM  TY+LTV  + R   Q +   LY    +T+ RP++   +     D+S     IN +T +    AD   +       +   D  C   ++   S   P+   +    +      I +  P+T    S         D S K N     Q S +  S   F  ++ K      G +LS    L    +  +   +SA+ T A   ++SGK+AV+V+ +LFGLF+ CY PFF++Y +   C +C++   P +   EW+GY  SMLNP+VYH FN TFR TF R+ +C C
Sbjct:    9 YIALCLIPLGTIWGNICVCLAVYLERRLRHRFNLFLVSLAISDLLCAILVMPVSAWHMIATRPQN-----RILCLVSYSMDIFFTATTIIHLCSISLDRYLALRRPFGRNRAVPKIFQSLVFRIFMSWFVPFSIAGPLFVFALKWER--GDEEFIVTMTPESANITTSK---SYKGCGPNDKSFVLTAIGVTFVLPLIIMTATYVLTVKMLRRHMAQVKAIQLY----ATRPRPVSTSSVLWLRRDNSFRPTEINRSTKAWFRQADQQSTIPKTTKYMPASDSGCDEKTVKTCSLSDPLSYHNRPAENPPRRIPIGVENPSTQDEASLSGNRVCGKDPSDKSN----DQQSYVKASETLFLTSTAKNDHDISGLELSSNHELGLPSQGRRTDISSAQTTTAIDRIHSGKRAVRVIAVLFGLFVTCYTPFFIVYTISVVCPQCRSWAEPAIPHLEWLGYLNSMLNPVVYHSFNSTFRRTFRRIFQCAC 477          
BLAST of 5-hydroxytryptamine receptor 2C vs. TrEMBL
Match: A0A074ZZH1 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_02329 PE=3 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 1.932e-87
Identity = 189/487 (38.81%), Postives = 271/487 (55.65%), Query Frame = 3
Query:  243 FLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMV--RNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNT--RIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQ-NLYPNKSSTKSRPLTQIKI----TDDS---QSINETTNS----ADNDVSY----SMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISH-KNEFTIHLNVPTTDMRRSY--------DFSPKQNLAIKKQSSLIDKSFQSF-NNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLA--AMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKC 1607
            ++ L +IPL TIWGN  VC++V++E+RL++RFN FLVSLAISDLLCA+LVMPVSAW+M+  R  N     R +CL  YS+D+FFT+TTIIHLCSISLDRY  L  P   +    +I  SL  +I ++W +PF IA PLF+FAL+ +   G+    V  +   +N T S+   SYKGCGP++  F++ +  +TFVLPL IM  TY+LTV  + R   Q +   LY    +T+ RP++   +     D+S     IN +T +    AD   +       +   D  C   ++   S   P+   +    +      I +  P+T    S         D S K N     Q S +  S   F  ++ K      G +LS    L    +  +   +SA+ T A   ++SGK+AV+V+ +LFGLF+ CY PFF++Y +   C +C++   P +   EW+GY  SMLNP+VYH FN TFR TF R+ +C C
Sbjct:    9 YIALCLIPLGTIWGNICVCLAVYLERRLRHRFNLFLVSLAISDLLCAILVMPVSAWHMIATRPQN-----RILCLVSYSMDIFFTATTIIHLCSISLDRYLALRRPFGRNRAVPKIFQSLVFRIFMSWFVPFSIAGPLFVFALKWER--GDEEFIVTMTPESANITTSK---SYKGCGPNDKSFVLTAIGVTFVLPLIIMTATYVLTVKMLRRHMAQVKAIQLY----ATRPRPVSTSSVLWLRRDNSFRPTEINRSTKAWFRQADQQSTIPKTTKYMPASDSGCDEKTVKTCSLSDPLSYHNRPAENPPRRIPIGVENPSTQDEASLSGNRVCGKDPSDKSN----DQQSYVKASETLFLTSTAKNDHDISGLELSSNHELGLPSQGRRTDISSAQTTTAIDRIHSGKRAVRVIAVLFGLFVTCYTPFFIVYTISVVCPQCRSWAEPAIPHLEWLGYLNSMLNPVVYHSFNSTFRRTFRRIFQCAC 477          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Cavefish
Match: drd2a (D(2)-like dopamine receptor [Source:NCBI gene;Acc:103036974])

HSP 1 Score: 143.28 bits (360), Expect = 1.505e-36
Identity = 127/483 (26.29%), Postives = 220/483 (45.55%), Query Frame = 3
Query:  228 RYQWPFLGLLIIPL--CTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMP-VSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRI--RSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIK-------KQSSLIDKSFQSFNNSF------KMSPTRYGN-------QLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRC 1601
            ++Q+ +  +L+  L    ++GN LVC++V  EK LQ   N+ +VSLA++DLL A LVMP V    +V    F+++    C  + +LDV   + +I++LC+IS+DRY  +  P+ Y NTR   R  + + IS+ W++ F I+CPL +F L       NN  S  ++                 C   N  F++ S++++F +P  I ++ Y+  ++ ++R+  +         SST  R  T  K T                        D K C+               G+F +++KN   I   V   D  ++ + +  + L  +        Q  L+  S  S            + P+R GN         +    +S S +     ++  KR  +     KKA Q+L I+ G+F++C+LPFF+ ++++ +      +   L +   W+GY  S +NPI+Y  FN  FR  F +++ C
Sbjct:   29 KHQYNYYAMLLTLLIFVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWRFSTIH---CDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLY-NTRYSSRRRVTVMISVVWILSFAISCPL-LFGL-------NNTESRDDA----------------LCVIANPAFVVYSSIVSFYVPFIITLLVYV-QIYVVLRKRRKRVSTKRTFPSSTAERGTTLKKCTHPD---------------------DVKLCTVIVK---------SNGNFPVNNKNVIFIKEVVNNADDVQADEVTNPEPLNQRTLEQTGASQHGLLLVSTHSETEVLPTVPEAPIKPSRNGNTGDAPRVTKAFETQVSPSGKTQSSVKSFNKRKFSQQKE-KKATQMLAIVLGVFIICWLPFFITHIVNTY----YNVPAELYTAFTWLGYVNSAVNPIIYTTFNIEFRKAFIKILHC 447          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Cavefish
Match: drd2b (D(2) dopamine receptor A [Source:NCBI gene;Acc:103035621])

HSP 1 Score: 142.51 bits (358), Expect = 3.388e-36
Identity = 120/471 (25.48%), Postives = 224/471 (47.56%), Query Frame = 3
Query:  228 RYQWPFLGLLIIPL--CTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMP-VSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSS--LPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNV-PTTDMRRSYDFSPKQNLAIKK---QSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLA----AMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRC 1601
            ++Q+ +  +L+  L    ++GN LVC++V  EK LQ   N+ +VSLA++DLL A LVMP V    +V    F+ +    C  + +LDV   + +I++LC+IS+DRY  +  P+ Y NTR  S   + + IS+ W++ F I+CPL +F L       NN  +  +S                 C   N  F++ S++++F +P  I ++ Y+  ++ ++R+  + R N   N     + P   +K         + T+  D  +   ++  +      +  +       V+ G+       E  +  +  P   M+ +    P  NL   +    +S + + +Q  ++  K    +        K+       + ++R +  +T++    + +  KKA Q+L I+ G+F++C+LPFF+ ++L   C  C  +   + +   W+GY  S +NPI+Y  FN  FR  F +++ C
Sbjct:   29 KHQYNYYAMLLTLLIFVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWRFSKIH---CDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLY-NTRYSSKRRVTVMISVVWVLSFAISCPL-LFGL-------NNTATRDDS----------------VCEIANPAFVVYSSIMSFYVPFIITLLVYV-QIYVVLRK-RRKRVNTKRNCQKADAEPQPPLK--------EKCTHPEDVKLCTVIVKTNGSLPVKNKKAQLLIKEVVQPGT-----GVEMGLMTSTSPPEKMKLAA--PPAVNLLATQSPSHASPLHEEWQPHDDE-KNGHAKDAQTPKETKSFETQALPNGKTRTTVTKTMSKRKMSQHKEKKATQMLAIVLGVFIICWLPFFITHILKTHCTSCY-VPLEMYNAFTWLGYVNSAVNPIIYTTFNVEFRKAFMKILHC 452          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Cavefish
Match: drd2b (D(2) dopamine receptor A [Source:NCBI gene;Acc:103035621])

HSP 1 Score: 141.739 bits (356), Expect = 5.586e-36
Identity = 121/471 (25.69%), Postives = 221/471 (46.92%), Query Frame = 3
Query:  228 RYQWPFLGLLIIPL--CTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMP-VSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSS--LPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQS----SLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLA----AMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRC 1601
            ++Q+ +  +L+  L    ++GN LVC++V  EK LQ   N+ +VSLA++DLL A LVMP V    +V    F+ +    C  + +LDV   + +I++LC+IS+DRY  +  P+ Y NTR  S   + + IS+ W++ F I+CPL +F L                    N T ++  DS   C   N  F++ S++++F +P  I ++ Y+  ++ ++R+  + R N   N     + P   +K         + T+  D  +   ++  +                PVK     +       + L   T+   +    +P     +  QS    S + + +Q  ++  K    +        K+       + ++R +  +T++    + +  KKA Q+L I+ G+F++C+LPFF+ ++L   C  C  +   + +   W+GY  S +NPI+Y  FN  FR  F +++ C
Sbjct:   23 KHQYNYYAMLLTLLIFVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWRFSKIH---CDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLY-NTRYSSKRRVTVMISVVWVLSFAISCPL-LFGL--------------------NNTATRD-DSV--CEIANPAFVVYSSIMSFYVPFIITLLVYV-QIYVVLRK-RRKRVNTKRNCQKADAEPQPPLK--------EKCTHPEDVKLCTVIVKTNGS-------------LPVKNKKV-VQPGTGVEMGLMTSTSPPEKMKLAAPPAVNLLATQSPSHASPLHEEWQPHDDE-KNGHAKDAQTPKETKSFETQALPNGKTRTTVTKTMSKRKMSQHKEKKATQMLAIVLGVFIICWLPFFITHILKTHCTSCY-VPLEMYNAFTWLGYVNSAVNPIIYTTFNVEFRKAFMKILHC 439          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Cavefish
Match: drd2b (D(2) dopamine receptor A [Source:NCBI gene;Acc:103035621])

HSP 1 Score: 140.198 bits (352), Expect = 1.341e-35
Identity = 123/463 (26.57%), Postives = 219/463 (47.30%), Query Frame = 3
Query:  228 RYQWPFLGLLIIPL--CTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMP-VSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSS--LPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRC 1601
            ++Q+ +  +L+  L    ++GN LVC++V  EK LQ   N+ +VSLA++DLL A LVMP V    +V    F+ +    C  + +LDV   + +I++LC+IS+DRY  +  P+ Y NTR  S   + + IS+ W++ F I+CPL +F L       NN  +  +S                 C   N  F++ S++++F +P  I ++ Y+  ++ ++R+  + R N   N     + P   +K     + +   T      ++ +      K  +  +++L +  SP        SH +        P  +  + +D   K   A   Q+    KSF++                   + L N       ++  +KR + + +  KKA Q+L I+ G+F++C+LPFF+ ++L   C  C  +   + +   W+GY  S +NPI+Y  FN  FR  F +++ C
Sbjct:   29 KHQYNYYAMLLTLLIFVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWRFSKIH---CDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLY-NTRYSSKRRVTVMISVVWVLSFAISCPL-LFGL-------NNTATRDDS----------------VCEIANPAFVVYSSIMSFYVPFIITLLVYV-QIYVVLRK-RRKRVNTKRNCQKADAEPQPPLKQLLIKEVVQPGTGVEMGLMTSTSPPEKMKLAAPPAVNLLATQSP--------SHAS--------PLHEEWQPHD-DEKNGHAKDAQTPKETKSFET-------------------QALPNGKTRTTVTKTMSKRKM-SQHKEKKATQMLAIVLGVFIICWLPFFITHILKTHCTSCY-VPLEMYNAFTWLGYVNSAVNPIIYTTFNVEFRKAFMKILHC 423          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Cavefish
Match: drd3 (dopamine receptor D3 [Source:NCBI gene;Acc:103024755])

HSP 1 Score: 140.969 bits (354), Expect = 1.363e-35
Identity = 123/459 (26.80%), Postives = 208/459 (45.32%), Query Frame = 3
Query:  267 LCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTR-IRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQS-INETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIR----KNLSNSFRIHK--------QSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRC 1601
            L  ++GN LVC++V  EK LQ   N+ +VSLA+SDLL A LVMP + +  V    +    R  C  + +LDV   + +I++LC+IS+DRY  +  P+ Y+ T   R  + + I+  W++ F ++CPL           G N    P                   C   N  F+I S+V++F LP  + ++ Y+  ++  +R+    R+ +   ++S +   + Q      +++ + E T     D+S   I V ++                ++    +  +N       +P  D+         QN     Q+S      +      +       +Q+++R    K +SN  R H          +R S  R  +  +  KKA Q+L I+ G+FL+C+LPFFV ++L+  C  C  +   L S   W+GY  S LNP++Y  FN  FR  F +++ C
Sbjct:   66 LAIVFGNVLVCMAVLREKSLQTTTNYLVVSLAVSDLLVASLVMPWAVYLEVVGGAWL-FSRLYCNIFVTLDVMMCTASILNLCAISIDRYTAVVMPVLYNTTHSSRKRVSVMIATVWILAFAVSCPLLF---------GFNTTDDP-----------------LVCSISNPDFVIYSSVVSFYLPFVVTLLVYV-RIYVFLRKR---RKKITFRQTSGE---VQQGSAQPSAETCLQEETRKVRRDLSPIRINVVNESTEKVVRPRLLSGCLRRKRPRTVPVENSL-----LPPMDL---------QNYCSISQASFARTEQEPNREEEEGR---EEDQVTVRSCEVKEISNG-RTHTTLRPAPRVTTRASQARYRSIHSREKKATQMLAIVLGVFLICWLPFFVTHILNTHCRSCY-IPPELYSAFTWLGYVNSALNPVIYTTFNIEFRRAFIKILTC 471          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004593.1 (pep scaffold:Pmarinus_7.0:GL476854:168999:207459:1 gene:ENSPMAG00000004184.1 transcript:ENSPMAT00000004593.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.939 bits (302), Expect = 5.447e-30
Identity = 77/207 (37.20%), Postives = 116/207 (56.04%), Query Frame = 3
Query:  237 WPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVY-FIIISTVITFVLPLCIMIVTYILTV 854
            WP L  L++ + T+ GN LV ++V++EK+LQ   N+FL+SLA++DLL  L VMP+S  N++ N  +  +P  +C  W  LDV F++ +I+HLC+ISLDRY  +  P+++     RS   LKI+  W I   IA P+ +  L+                        QQ     G    N+  FII  +V++F LPL IM+V Y+LT+
Sbjct:    6 WPALLFLLVVVLTVGGNLLVILAVWLEKKLQTATNYFLMSLAVADLLVGLTVMPISVINILYNMRW-PLPCEMCPVWVFLDVLFSTASIMHLCAISLDRYIAIKRPIQHSRFNSRSKTLLKITAVWAISIGIASPIPVLGLQ-----------------------DQQHVFVNGACILNIQNFIIYGSVVSFFLPLLIMVVIYVLTI 188          

HSP 2 Score: 67.3958 bits (163), Expect = 3.178e-12
Identity = 35/109 (32.11%), Postives = 62/109 (56.88%), Query Frame = 3
Query: 1320 KQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIK--CQTMT-GPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYKVRKAFSAN 1637
            ++++ +  R+  A+++ ++A +VLGI+F LFL+ + PFFV  +    C +  C       L+    W+GY +S +NP+VY +FN T+R  F R + C   + R   S+ 
Sbjct:  262 RRTQAAHSRSAQALSNERRASKVLGIVFTLFLVMWCPFFVTNVTSALCPESLCSVEAMAKLMDIFVWVGYVSSGVNPLVYTLFNQTYRQAFRRYVACDFRRARHRSSSK 370          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Sea Lamprey
Match: HTR1F (5-hydroxytryptamine receptor 1F [Source:HGNC Symbol;Acc:HGNC:5292])

HSP 1 Score: 119.013 bits (297), Expect = 4.646e-29
Identity = 109/439 (24.83%), Postives = 185/439 (42.14%), Query Frame = 3
Query:  285 NALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMS--PTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLM 1595
            NALV  ++   ++L+   N+ + SLA++DLL A LVMPV+A  +V      ++   +C  W SLDV   + +I+HLC+I+LDR++ + +  +Y + R      L I+ +WL+  CI                    SVP   W   +    +          +V + I ST   F +PL +++  Y         +  +A + LY  + S +   L+                SA++ VS                +   F  P     F +S  +                   S  Q LA  ++S    +S  +     K S  P R    +S R +     R   Q R S  R        ++A + LG++ G F++C+LPFF+  L+   C  C  ++  +     W+GY  S++NP++Y +FN  F++ F +L+
Sbjct:   65 NALVIAAISATRKLRQPANYLIGSLAVADLLVAALVMPVAAAYVVTGE--WALGGALCDLWLSLDVTCCTASILHLCAIALDRFWAITDAAEYAHKRTPGRAALMIAASWLLAACI--------------------SVPPLFWRRRDPAKPRCIIEH----DHVLYTIYSTFGAFYVPLALLLALYC--------RIFRAAKRLYEKRESKQREKLSV---------------SAESAVSLEQPSQSQHQQQQQQPAGKLFRLP---QPFCMSETS-------------------SSDQTLAQAERSGQHQQSVSAVARRSKRSLRPPRSVRFMSARLD---QRRPCLQERISGSRE-------RRAAKTLGLILGAFVVCWLPFFIKELVVNLCKSC-AVSPEVADLLTWLGYMNSLINPLIYTMFNEDFKSAFRKLV 421          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006953.1 (pep scaffold:Pmarinus_7.0:GL477632:7596:14007:1 gene:ENSPMAG00000006283.1 transcript:ENSPMAT00000006953.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.997 bits (271), Expect = 6.735e-26
Identity = 66/200 (33.00%), Postives = 110/200 (55.00%), Query Frame = 3
Query:  273 TIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQ 872
            TI GN LV ++V +EK+LQ   N+FL+SLA++D+L  +LVMP+S  N++    +  +P  +C  W  LDV F++ +I+HLC+ISLDRY  +  P+++     R+   LKI   W+I   I+ P+ +  L+             +  ++  +           C  +   FII  ++ +F LPL IM+ +Y+ T   ++RQ
Sbjct:   38 TIAGNVLVILAVSLEKKLQTATNYFLMSLAVADMLVGILVMPISLLNILYGFKW-PLPLSLCPVWIYLDVLFSTASIMHLCAISLDRYIAIKKPIEHSRFNSRTKALLKILAVWVISVGISMPVPVLGLQ-------------DLAYVYTD---------GSCQMNISDFIIYGSLSSFFLPLIIMVASYVSTT-RVLRQ 213          

HSP 2 Score: 65.4698 bits (158), Expect = 1.469e-11
Identity = 35/92 (38.04%), Postives = 55/92 (59.78%), Query Frame = 3
Query: 1335 SAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIK--C-QTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRC 1601
            S KRT+ A+ + ++A +VLGI+F LF+  + PFF+  +L   C    C +     L+    W+GY +S +NP+VY +FN T+R  F R + C
Sbjct:  301 SQKRTMQAITNEQRASKVLGIVFLLFVGMWCPFFITNVLSALCPADACNRHAMAALLDVFVWVGYVSSGVNPLVYTLFNRTYRQAFARYIAC 392          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009127.1 (pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 gene:ENSPMAG00000008256.1 transcript:ENSPMAT00000009127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.2117 bits (243), Expect = 2.711e-22
Identity = 64/199 (32.16%), Postives = 107/199 (53.77%), Query Frame = 3
Query:  246 LGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTY 842
            L L  + LC I+GN+ V  ++ +E+ LQN  N+ + SLA++DLL ++LV+P++A   V +    ++ + +C  + +LDV   +++I+HLC I+LDRY+ + NP+ Y N R      + IS+ WL+ F I+ P                   P  GW + E  +   ++ K    H   + I ST   F +PL +M+V Y
Sbjct:   41 LCLTALILCAIFGNSCVIAAIALERTLQNVANYLIGSLAVTDLLVSILVLPMAALYQVLDR--WTLGQVVCDIFIALDVLCCTSSILHLCVIALDRYWAITNPIDYVNKRTPRRAVIMISLTWLVGFSISIP-------------------PMLGWRTPEDRADP-NACKISQDHG--YTIYSTFGAFYIPLILMLVLY 215          

HSP 2 Score: 47.3654 bits (111), Expect = 6.756e-6
Identity = 22/54 (40.74%), Postives = 34/54 (62.96%), Query Frame = 3
Query: 1446 LLDFFC-IKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCK 1604
            L+  FC  +C    G + +   W+GYS S+LNPI+Y  FN  F+N F ++++CK
Sbjct:  332 LISPFCGERCHLPPG-VFAVINWLGYSNSLLNPIIYAYFNKDFQNAFKKIIKCK 384          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Sea Lamprey
Match: CHRM3 (cholinergic receptor muscarinic 3 [Source:HGNC Symbol;Acc:HGNC:1952])

HSP 1 Score: 94.7449 bits (234), Expect = 1.164e-20
Identity = 113/503 (22.47%), Postives = 205/503 (40.76%), Query Frame = 3
Query:  258 IIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITD--------------DSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKR------------GSFKISHKNEFTIHLNVPTTDMR-------------RSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRK--NLSNSFRIHKQSRNSAKR-TLAAMN------------SGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCK 1604
            ++ L TI GN LV VS  + K+L    N++L+SLA++DL+  +  M +    M+  +   ++    C  W +LD   ++ ++++L  IS DR+F +  PL Y   R      L I +AW++ F +  P  +F     ++ G  R   P+   +  + +S+ + ++             + +  F LP+ IM   Y    W I ++     ++L   + S         +  D               +Q+++    S +     +    D+   S SS      D+P K             G     H ++ T  L     D R             RSY+ S +         SL  +   S  +  +   + + +    R+    S+S RI  +  ++AKR T AA+               KKA + L  +   F++ + P+ ++ L+  FC +C  +   L +   W+ Y  S +NP+ Y + N  FR TF +L+ C+
Sbjct:   69 VMSLATIVGNVLVLVSFKVNKQLHTVNNYYLLSLAVADLIIGIFSMNLFTCYMIMGH--WALGSLACDLWLALDYVASNASVMNLLVISFDRFFSITRPLTYRAKRTPHRAALLIGLAWVVSFVLWAPAILF---WQYIVG-ERTVPPDECRI--QFLSEPIITF------------CTAIAAFYLPVTIMATIY----WRIFKEIQNRARDLAMLQGSVSEGREELEQEEDMVELGDEKEEEEEESTQAVDTPQASGERRRVGNNSSKDNGATSASSHYSEKDDAPKKHRAIYSMVMVLPSGRCSAMHASKVTGRLTAQNVDTRDPMPSHETRIRAVRSYNCSDRSGQTDGASPSL--RQTASERSPAESDASDHSSTSDTREVCAASSSTRISMRDLSTAKRFTSAALKVNVTARKRMSLIKEKKAARTLSAILLAFIITWTPYNIMVLMSTFCPEC--VPPVLWNIGYWLCYVNSTVNPVCYALCNRIFRKTFRQLLLCQ 543          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Nematostella
Match: EDO47359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMJ9])

HSP 1 Score: 87.8113 bits (216), Expect = 1.473e-18
Identity = 70/270 (25.93%), Postives = 118/270 (43.70%), Query Frame = 3
Query:  252 LLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTS-VPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQ-------NLYP----------NKSSTKSRPLTQIKITDDSQSINETTNSADNDVSY 1007
            ++I+ L TI GN LVC SVF  +RL++  N+ +VSLA+SDLL   L +P     ++   N+ S + R  C  W  +D+  +  ++++L  IS DR   +  PL+Y          + I + W+  +  +C    F                   W    TI+    +Y  CG     +I +  +  F  PL I+I+ Y + +   IR   Q ++       N+ P           ++S  S P+ ++K T  S S  +  N A+    +
Sbjct:   30 IVIVMLLTIMGNLLVCYSVFYYRRLRSPTNYLVVSLAVSDLLVGTLSLPFRLAQLLNEENWPSHLGREGCQFWIWVDMLCSGASMVNLAGISFDRLLAIKQPLRYREKMTSKRALILILVVWI--YAASCAFLSFV-----------------EWEGESTIA----AYPQCGIRARVYITLMALAAFFCPLLIVIICYGMVLQVAIRHALQVQKEKEQIALNVSPEPNSNNHEESGETSLASPPVIRLK-TSRSSSHRKDINFANGHAKH 275          

HSP 2 Score: 52.7582 bits (125), Expect = 2.846e-7
Identity = 38/123 (30.89%), Postives = 60/123 (48.78%), Query Frame = 3
Query: 1317 HKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFC-IKC--QTMTGPLVSKTEWIGY------SASMLNPIVYHIFNPTFRNTFNRL---MRCKCYKVRKAFSANTKSY 1649
            H + RN A  T   M    KA + L ++ G+F+LC+ PFFVI++   +C  +C  +    P V +   I +      S S  NPI+Y  FN  FR  F ++   M  K Y+ +  + +   +Y
Sbjct:  272 HAKHRNPASSTFHIMKQ-IKATKTLAVVVGVFILCWFPFFVIFVTFQYCDTECFGEERIPPAVKRVLLIIFVYVLPVSNSAANPIIYSCFNQEFRVAFLKIFYKMVGKRYRQKYDYYSTPTAY 393          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Nematostella
Match: EDO35213 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM59])

HSP 1 Score: 77.0258 bits (188), Expect = 1.683e-15
Identity = 37/108 (34.26%), Postives = 68/108 (62.96%), Query Frame = 3
Query:  246 LGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHN 569
            + L+ + +  + GN +VC++ +    LQ+    F++SLA++D+L A + MP+  +    +++FT +P  +  AW  LDV F++ +I++LC+IS+DR F +  PL YH 
Sbjct:   25 VALIAVIMLALAGNTVVCIAFYRSSNLQSLTVLFILSLAVTDILVASISMPIWLYFQFSHSSFTCLP-DLFTAWKCLDVLFSTASIMNLCAISIDRQFAITKPLHYHT 131          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Nematostella
Match: EDO32939 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STN0])

HSP 1 Score: 75.8702 bits (185), Expect = 6.097e-15
Identity = 56/197 (28.43%), Postives = 87/197 (44.16%), Query Frame = 3
Query:  252 LLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTY 842
            L +I + T+ GNA VC++VF+   L    N+ + SLA+SDL+ AL  +P      V N ++  +    C  W   D+F    +I++L  ISLDR+     PL Y     R+     +   WL  F +A                   S+    W S E     + +  GC   + YF   +  + F LPL ++I+ Y
Sbjct:   27 LSVIFVITLLGNATVCLTVFLTSSLHAFTNYIVASLAVSDLMVALFSLPFRIHQTVHNTHW-CLGASACAFWIWADMFCCCASIMNLALISLDRFLATKYPLNYQELINRAGKIAMVVTVWLYSFVVA-------------------SLSLRNWTSPE--GPLVKTINGCFKPDPYFYTFAAALGFFLPLIVIILAY 201          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Nematostella
Match: EDO49367 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG65])

HSP 1 Score: 72.7886 bits (177), Expect = 4.544e-14
Identity = 49/205 (23.90%), Postives = 94/205 (45.85%), Query Frame = 3
Query:  273 TIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQAR 887
            T+ GN+LVC+++ ++ RL+N  N+F+ SLA++DLL  L+ +P   + +V+ +         C  W   D+   + +I +L  IS+DRY  +  P +YH         L +   W+    +A                + + +P  G        Q       C   N  F  ++ ++ F+LPL I+++ Y++     ++Q  + +
Sbjct:   10 TVAGNSLVCLAICLDHRLRNSTNWFIASLAVADLLYGLIGLP---FRIVQTSGTRVFTLNECFLWIWADMVCAAASIANLAVISVDRYLKITKPFQYHIRMTHKRALLAVVAVWIYSAILA----------------SLSIMPWPGAKGVHLFEQ------SCTNLNQVFYTVANIVAFILPLLILVLNYVMVYVEALKQFRKMK 189          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Nematostella
Match: EDO28603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T607])

HSP 1 Score: 71.633 bits (174), Expect = 1.671e-13
Identity = 58/232 (25.00%), Postives = 110/232 (47.41%), Query Frame = 3
Query:  252 LLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRL-DHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTV------WSIIRQTNQARQNL-YPNKSSTKS 923
            +++I    ++GN LVCV+++  +RL++  N+ + SLA+SDLL A L MP   ++ +    +  +   +C  W  +D   +  +I +L  I++DRY VL+ P  Y     +    + I   WL  F IA      +L L +  + +  N+                 S+  C   + Y+   +  ++F LPL ++I+ Y +          ++R+ N ++ +L Y  ++S  S
Sbjct:   26 VVVILFLDLFGNLLVCVAIYRYRRLRSVTNYLIGSLAVSDLLVACLSMPFRIYHTLHLMCW-DLGLSVCKFWIFVDALCSGASICNLSLIAIDRYLVLSCPFSYREKMRKPRGFIAILAVWLYAFVIA------SLSLTEPWSPDGFNA-----------------SFPACAKMDKYYYAFAITMSFFLPLVVLIIAYSMVFKVARKQACLVRRANDSQGHLEYRTETSVVS 233          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Medaka
Match: drd3 (dopamine receptor D3 [Source:NCBI gene;Acc:101163209])

HSP 1 Score: 147.902 bits (372), Expect = 4.192e-38
Identity = 136/476 (28.57%), Postives = 218/476 (45.80%), Query Frame = 3
Query:  225 DRYQWPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRI-RSSLPLKISIAWLIPFCIACP-LFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYI-LTVWSIIRQT----NQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRR----SYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSN-----SFRIHKQSRNSAK-RTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRC 1601
            +R  +  L  L+I L  ++GN LVC++V  E+ LQ   N+ +VSLA++DLL A LVMP + +  V    +    R  C  + +LDV   + +I++LC+IS+DRY  +  P+ Y+ T   R  +   I+  W++ F ++CP LF F    D M                            C   N  F+I S+V++F LP  + ++ YI + V+  +R+      QAR  + P  +        Q           E T  A  D+S   I V     S +S          ++       +N       +P  DM+     S+    +    +++     D    S +N  ++ P R   ++   K LSN     S R    S+N+ + R++ A    KKA Q+L I+ G+FL+C+LPFFV ++L+  C  CQ +   L     W+GY  S LNP++Y  FN  FR  F +++ C
Sbjct:   35 ERNYYAMLYSLLI-LAIVFGNVLVCLAVLRERSLQTTTNYLVVSLAVADLLVASLVMPWAVYLEVVGGAWL-FNRLYCNIFVTLDVMMCTASILNLCAISIDRYTAVVMPVLYNTTHCSRKRVFAMIATVWVLAFAVSCPLLFGFNTTDDPMV---------------------------CSISNPDFVIYSSVVSFYLPFIVTLLVYIRIYVFLRMRRKRIAFGQARGKVQPGSTHPSVETCLQ-----------EETPKAKQDLSPIRIKVQSVESSGTSKPSLLSGCLWRKRPKTGPAQNS-----GLPPVDMQNYCSISHASCGRTEFDLEQGQVEQDA---SDSNQLELPPIRMNCEV---KELSNGRTHTSLRPISHSQNNPRFRSMHARE--KKATQMLAIVLGVFLICWLPFFVTHILNTHCRTCQ-IPPALYGAFTWLGYVNSALNPVIYTTFNIEFRRAFIKILSC 456          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Medaka
Match: ENSORLT00000042787.1 (alpha-2B adrenergic receptor-like [Source:NCBI gene;Acc:101155866])

HSP 1 Score: 140.198 bits (352), Expect = 2.256e-35
Identity = 127/469 (27.08%), Postives = 203/469 (43.28%), Query Frame = 3
Query:  273 TIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVS-AWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHN-VYFIIISTVITFVLPLCIMIVTYILTVWSIIRQ-----TNQARQNLYPNKSSTKSRPLTQIK-ITDDSQSINETTNSADNDVSYSMIGVD-----DKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFK-----------MSPT-RYGNQL---SIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLM 1595
            TI GN LV ++V + + L+   N FLVSLA +D+L AL+V+P S A+ ++    F+S+    C    +LDV F + +I+HLC+I+LDRY  ++ P+ Y  TR R  +   I + WLI   ++ P  ++    D + G                          C P +  ++I+ ST+ +F  P  IMI+ YI  ++ I ++       + R++ Y   +       T++K + ++SQ        A  ++S + +  D     DK                K           F+  +     D+ ++     +   A+   SS  D   QS     +            SPT RY N +   S  K L       K       R  A +N  K+   VL ++ G+F++C+ PFF  Y L   C +   +  PL     W GY  S LNPI+Y IFN  FR  F R++
Sbjct:   41 TIVGNILVIIAVLMSRSLRGPQNLFLVSLAAADILVALIVVPFSMAYELLGCWVFSSI---WCEIHKALDVLFCTASIVHLCAIALDRYLSISRPVSYGTTRSRRRIKSAIVMVWLIAAVVSFPPLLYLDTKDKVKGK-------------------------CEPDDKPWYILYSTIGSFFAPCVIMILVYI-RIYQIAKRHMHCPPGEKRRSFYGAATDD-----TEMKSLPEESQKDVGQRAPAAPELSLTTVHTDCAQWNDK----------------KPAESPTEGPPLFSTAVPNAARDLPKA-----EGEDAVHTSSSESDTELQSIEEGDRAGGGGSPKAQVQSPTCRYKNTIKTSSGTKLLPED--TAKTQETPISRHKAMINREKRFTLVLAVVMGVFVVCWFPFFFSYSLKAVCPEKYQVPDPLFRFFFWSGYCNSCLNPIIYTIFNRDFRTAFKRIL 452          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Medaka
Match: adra2a (adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750])

HSP 1 Score: 137.502 bits (345), Expect = 8.667e-35
Identity = 121/449 (26.95%), Postives = 187/449 (41.65%), Query Frame = 3
Query:  276 IWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYKVRK 1622
            ++GN LV ++VF  + L+   N FLVSLA +D+L A LVMP S  N +    F    +  C  + +LDV F + +I HLC+ISLDRY+ +   ++Y+  R    +   I I W+I   I+ P  I       M   N +  P            +++  K       +++I S + +F LP  IM++ Y+      I Q  + R    P     K   L+        Q  N      D      + G  D                V+RG+      +E  + +N    +   S D       +I K+S+             ++S  + G+    R+  S            A R     N  K+   VL ++ G+F++C+ PFF  Y+L   C  C   T  L +   W GY  S LNPI+Y IFN  FR  F +++   C + RK
Sbjct:   31 VFGNVLVVIAVFTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMG--FWYFGKVWCEIYLALDVLFCTASIAHLCAISLDRYWSITQAIEYNLKRTPRRIKSIIVIVWVIAAVISFPPLI------TMEKENGSESPVC----------KINDEK-------WYVISSCIGSFFLPCIIMVLVYVR-----IYQIAKKRTRAPPGDRQQKG--LSGPGAAAAGQRENGVGEPDDGLCHEKLNGEQD----------VELKEGVERGA------DEAKVEVNGGDMEESSSSDHKADHPCSIPKKSA---------KGKTRLSQVKPGDADPQRRAQS----------AKASRWKGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYMLKTLCSSCYVPTA-LFNFFFWFGYCNSALNPIIYTIFNHDFRRAFKKIL---CRERRK 408          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Medaka
Match: htr2b (5-hydroxytryptamine receptor 2B [Source:NCBI gene;Acc:101162203])

HSP 1 Score: 137.887 bits (346), Expect = 1.929e-34
Identity = 84/238 (35.29%), Postives = 138/238 (57.98%), Query Frame = 3
Query:  228 RYQWPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQI 941
            + +W  L ++++ + TI GN LV ++V +E++LQN  N+FL+SLA++DLL  LLVMP++   ++ N+ +  +P  +C  W  LDV F++ +I+HLC+ISLDRY  +  P+++   + R+   +KI++ WLI  CIA P+ I  L   H + N         + SN T   + D+++        FII  ++  F +PL IM+V Y+LTV  +       R+ +Y  KS    R  +QI
Sbjct:   23 QLKWAALLIIMVIIPTIGGNILVILAVSLERKLQNATNYFLMSLAVADLLVGLLVMPIALVTVLYNSGW-PLPDFLCPIWLFLDVLFSTASIMHLCAISLDRYIAIKKPIQHSQYKSRAKAIVKIALVWLISICIAIPIPIKGLTNYHPSNN-------ITFNSNHTCLLKTDTFRD-------FIIFGSLAAFFIPLMIMMVIYLLTVQVL-------RKKVYLLKSKVTQRFNSQI 238          

HSP 2 Score: 69.707 bits (169), Expect = 3.760e-12
Identity = 31/89 (34.83%), Postives = 55/89 (61.80%), Query Frame = 3
Query: 1338 AKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQ-TMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRC 1601
             K+++  +++ ++A +VLGI+F LF++ + PFF+  +    C  C  ++   L+    W+GY +S +NP+VY +FN TFR  F R + C
Sbjct:  293 GKKSMQTLSNEQRASKVLGIVFLLFVVMWCPFFITNITSALCTSCSASIVSRLMEIFVWVGYVSSGINPLVYTLFNKTFREAFTRYITC 381          
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Medaka
Match: ADRA2C (adrenoceptor alpha 2C [Source:HGNC Symbol;Acc:HGNC:283])

HSP 1 Score: 130.954 bits (328), Expect = 2.438e-32
Identity = 132/472 (27.97%), Postives = 203/472 (43.01%), Query Frame = 3
Query:  267 LCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNN-NFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKIS---HKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQ--SRNSAKR---------TLAAMNSGKKAVQ--------VLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYK 1613
            L T+ GN LV ++V   + L+   N FLVSLA +D+L A LVMP S  N +     F  V  GI LA   LDV F +++I+HLC+ISLDRY+ +   ++Y+  R    +   I I WL+   I+ P  +   R      N+ +S P+   L++ET                ++I+ S++ +F  P  IMI+ YI  ++ + +               T++R +++ K   D   + +T N                                  G  K+S   H      H + P T  +R+    P        Q+  +D    S +     +P R  +Q + RK   +SF  H    SR S K             +  + KK  Q        VL ++ G+F++C+ PFF  Y L   C     +  PL     WIGY  S LNP +Y IFN  FR+ F +++ CK +K
Sbjct:   47 LFTVVGNILVVIAVLTSRALKAPQNLFLVSLATADILVATLVMPFSLANELMGYWYFGKVWCGIYLA---LDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRIKCTILIVWLVSAFISSPPLVSIDR-----NNDISSQPQCE-LNDET----------------WYILSSSIASFFAPCLIMILVYI-RIYQVAK---------------TRTRSMSEKKPKPD--GVTQTEN----------------------------------GLSKVSSPLHGEAENGHCHCPPTPSQRTVTTGP--------QTQEVDVEESSSSEGKGHNPQRQDSQRA-RKARKSSFSKHSAHISRVSNKSMDLFASRRKRRRSSFARKKVSQAREKRFTFVLAVVMGVFVMCWFPFFFSYSLYGVCRDSCRIPDPLFKFFFWIGYCNSSLNPAIYTIFNRDFRHAFQKIL-CKAWK 431          
BLAST of 5-hydroxytryptamine receptor 2C vs. Planmine SMEST
Match: SMESG000032679.1 (SMESG000032679.1)

HSP 1 Score: 952.584 bits (2461), Expect = 0.000e+0
Identity = 476/478 (99.58%), Postives = 477/478 (99.79%), Query Frame = 3
Query:  219 AFDRYQWPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYKVRKAFSANTKSYV 1652
            AFDRYQWPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCSHSSLSLNSFDSPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSL DK+FQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYKVRKAFSANTKSYV
Sbjct:   26 AFDRYQWPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCSHSSLSLNSFDSPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLTDKNFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYKVRKAFSANTKSYV 503          
BLAST of 5-hydroxytryptamine receptor 2C vs. Planmine SMEST
Match: SMESG000032682.1 (SMESG000032682.1)

HSP 1 Score: 936.021 bits (2418), Expect = 0.000e+0
Identity = 460/462 (99.57%), Postives = 461/462 (99.78%), Query Frame = 3
Query:  219 AFDRYQWPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCK 1604
            AFDRYQWPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCSHSSLSLNSFDSPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSL DK+FQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCK
Sbjct:   26 AFDRYQWPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCSHSSLSLNSFDSPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLTDKNFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCK 487          
BLAST of 5-hydroxytryptamine receptor 2C vs. Planmine SMEST
Match: SMESG000065390.1 (SMESG000065390.1)

HSP 1 Score: 374.015 bits (959), Expect = 5.458e-123
Identity = 215/488 (44.06%), Postives = 301/488 (61.68%), Query Frame = 3
Query:  234 QWPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQSFNNSFKMSPTRYGNQLSI--RKNLSNSFRIHKQSRNSAKR-------------------------TLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYKV 1616
            +W FL LL+IP+ TI+GN LV VSV++EKRLQNRFN+FLVSLA+SD LCA+LVMPVS   MV  +     P  +CLAWYSLDVFFT+TTIIHLC+IS+DRY  LNNPL++H T+ + SL +KISI+WLIPF IACPLF+ +L++                   ET++Q+  S+KGCGP+N  FI+ + ++TF+LPL IM+++YILTV +I +QT     + +      KSR  +Q +I   S             ++ S++ V+ K C   + SLN     +   S   S ++  + + N PTT  +       ++N+   K++             F+   +R   Q+SI  RK   N+ R+H+ S  +++R                         +L  +   +KAVQVLGI+FGLF+ CY+PFFVIYL DFFC+ C+++T  ++S +EWIGYSASM+NP+VYHIFNPTFR TFNRL+RC+CYKV
Sbjct:   28 KWAFLFLLLIPIITIFGNILVGVSVYLEKRLQNRFNYFLVSLAVSDFLCAILVMPVSTVKMVHVDLTNGWPHQLCLAWYSLDVFFTATTIIHLCTISIDRYVALNNPLRFHQTKRKYSLFIKISISWLIPFGIACPLFLSSLKI-------------------ETMNQEESSFKGCGPNNAIFIMTAVIVTFILPLLIMMISYILTVKTIRKQTKNL--DSFSTNGHRKSR-FSQSEIYKKSM--------PSTSLTTSILNVNSKVCDDLNHSLNQEKLSLLSISTDFSRRSLMSCN-NFPTTPSK------IQENIDGDKETYF----------DFRSKFSRLSRQMSIPFRK---NTLRLHRNSSVNSERLRLCANVLLNSRLSVNSRRIATSDLSLRYIQKSRKAVQVLGIVFGLFVCCYMPFFVIYLTDFFCVSCKSITSWMISYSEWIGYSASMMNPVVYHIFNPTFRRTFNRLIRCRCYKV 465          
BLAST of 5-hydroxytryptamine receptor 2C vs. Planmine SMEST
Match: SMESG000000740.1 (SMESG000000740.1)

HSP 1 Score: 342.813 bits (878), Expect = 1.050e-110
Identity = 190/502 (37.85%), Postives = 280/502 (55.78%), Query Frame = 3
Query:  225 DRYQWPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSST------KSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKI------SHKNEFTIHLNV---------PTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQ---------------SFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKC--QTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYKV 1616
             RY W ++GL IIP+ ++WGN+LVC+SV++E  L+ RFN+FLVSLA+SD LCA+LVMP+SAW M+ N    ++    CL WYSLDVFFT++TIIHLC+IS+DRY  L NPLK H  +   SL +++  AW+IPF IACPLF+FAL LD                     +++  S+KGCGP N YFI+I+T++TF +PL IM VTY+LTV  +  Q  +A  NLY N  ++       S  L +   T  ++ ++E   +  N+ S +M           +   + F        F++      + +N F  + ++         P+    +     P++ ++ ++Q    +  ++               S   SFKMS           K  ++ +      +   ++ L  +N  +KAVQ LGILF LF++CYLPFFV YL+DFF   C   +    +++  EW+GYS SM NPIVYH FNP FR+T+ RLM+C+CY+V
Sbjct:    5 SRYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDK--------------------TREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMS----------NKTKTDEYSAFYTKKKETEKQLKQINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRV 476          
BLAST of 5-hydroxytryptamine receptor 2C vs. Planmine SMEST
Match: SMESG000000740.1 (SMESG000000740.1)

HSP 1 Score: 342.428 bits (877), Expect = 2.025e-110
Identity = 190/502 (37.85%), Postives = 280/502 (55.78%), Query Frame = 3
Query:  225 DRYQWPFLGLLIIPLCTIWGNALVCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSVPRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLPLKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQLDSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQNLYPNKSST------KSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCXXXXXXXXXXXXPVKRGSFKI------SHKNEFTIHLNV---------PTTDMRRSYDFSPKQNLAIKKQSSLIDKSFQ---------------SFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAKRTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKC--QTMTGPLVSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYKV 1616
             RY W ++GL IIP+ ++WGN+LVC+SV++E  L+ RFN+FLVSLA+SD LCA+LVMP+SAW M+ N    ++    CL WYSLDVFFT++TIIHLC+IS+DRY  L NPLK H  +   SL +++  AW+IPF IACPLF+FAL LD                     +++  S+KGCGP N YFI+I+T++TF +PL IM VTY+LTV  +  Q  +A  NLY N  ++       S  L +   T  ++ ++E   +  N+ S +M           +   + F        F++      + +N F  + ++         P+    +     P++ ++ ++Q    +  ++               S   SFKMS           K  ++ +      +   ++ L  +N  +KAVQ LGILF LF++CYLPFFV YL+DFF   C   +    +++  EW+GYS SM NPIVYH FNP FR+T+ RLM+C+CY+V
Sbjct:   15 SRYNWAYVGLFIIPMLSMWGNSLVCISVWVEVGLRKRFNYFLVSLAMSDFLCAILVMPISAWKMIDNYYLETINHQWCLIWYSLDVFFTASTIIHLCTISIDRYNALKNPLKIHGQKRYRSLVVQLVCAWIIPFSIACPLFLFALELDK--------------------TREHSSFKGCGPQNAYFILIATIVTFFIPLIIMTVTYVLTVKILYVQRKEAEANLYSNAVASLVFKPKLSSSLAKFTRTPSTKVMSEKKLNGKNENSSAMHRRSISTSCLVNSLDSEFKETENHNHFEMTPLLAKTTRNNFVENTSMNLCGSDNLKPSLQEDQYKQTLPQRQVSFREQQKTKNHYWKSNTVCTVLENPLALLSHQRSFKMS----------NKTKTDEYSAFYTKKKETEKQLKQINRSRKAVQTLGILFLLFVICYLPFFVAYLVDFFFKICSVSSTAEKMLTFLEWMGYSGSMFNPIVYHFFNPIFRHTYQRLMKCQCYRV 486          
The following BLAST results are available for this feature:
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HTR1A3.488e-3927.195-hydroxytryptamine receptor 1A [Source:HGNC Symbo... [more]
DRD31.729e-3726.55dopamine receptor D3 [Source:HGNC Symbol;Acc:HGNC:... [more]
DRD31.729e-3726.55dopamine receptor D3 [Source:HGNC Symbol;Acc:HGNC:... [more]
DRD31.729e-3726.55dopamine receptor D3 [Source:HGNC Symbol;Acc:HGNC:... [more]
DRD21.928e-3427.25dopamine receptor D2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tyra-39.463e-3626.95TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
tyra-31.087e-3526.95TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
tyra-31.167e-3526.67TYRAmine receptor [Source:UniProtKB/TrEMBL;Acc:Q2... [more]
octr-19.669e-3125.68OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
octr-11.056e-3026.35OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dop2R9.542e-3926.23gene:FBgn0053517 transcript:FBtr0343171[more]
5-HT2B1.370e-2934.70gene:FBgn0261929 transcript:FBtr0303603[more]
5-HT2B1.370e-2934.70gene:FBgn0261929 transcript:FBtr0339322[more]
5-HT2B1.656e-2934.70gene:FBgn0261929 transcript:FBtr0330144[more]
5-HT71.399e-2133.84gene:FBgn0004573 transcript:FBtr0334508[more]
back to top
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drd2a2.107e-4027.22dopamine receptor D2a [Source:ZFIN;Acc:ZDB-GENE-02... [more]
drd2a2.107e-4027.22dopamine receptor D2a [Source:ZFIN;Acc:ZDB-GENE-02... [more]
htr1aa2.978e-3827.235-hydroxytryptamine (serotonin) receptor 1A a [Sou... [more]
drd2l1.280e-3726.54dopamine receptor D2 like [Source:ZFIN;Acc:ZDB-GEN... [more]
drd2l2.305e-3726.54dopamine receptor D2 like [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DRD24.711e-3927.35dopamine receptor D2 [Source:NCBI gene;Acc:1004930... [more]
slc25a294.547e-3435.91solute carrier family 25 (mitochondrial carnitine/... [more]
slc25a295.202e-3435.91solute carrier family 25 (mitochondrial carnitine/... [more]
slc25a295.347e-3435.91solute carrier family 25 (mitochondrial carnitine/... [more]
slc25a295.847e-3435.91solute carrier family 25 (mitochondrial carnitine/... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Drd38.596e-3827.02dopamine receptor D3 [Source:MGI Symbol;Acc:MGI:94... [more]
Drd32.001e-3727.08dopamine receptor D3 [Source:MGI Symbol;Acc:MGI:94... [more]
Htr1a4.279e-3626.865-hydroxytryptamine (serotonin) receptor 1A [Sourc... [more]
Drd22.611e-3526.97dopamine receptor D2 [Source:MGI Symbol;Acc:MGI:94... [more]
Htr2c2.831e-3537.095-hydroxytryptamine (serotonin) receptor 2C [Sourc... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 2C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P19327|5HT1A_RAT3.678e-3928.135-hydroxytryptamine receptor 1A OS=Rattus norvegic... [more]
sp|Q9N298|5HT1A_PANTR1.391e-3827.195-hydroxytryptamine receptor 1A OS=Pan troglodytes... [more]
sp|P08908|5HT1A_HUMAN1.675e-3827.195-hydroxytryptamine receptor 1A OS=Homo sapiens OX... [more]
sp|Q9N297|5HT1A_GORGO1.865e-3827.195-hydroxytryptamine receptor 1A OS=Gorilla gorilla... [more]
sp|Q17232|OAR_BOMMO9.860e-3827.17Octopamine receptor OS=Bombyx mori OX=7091 PE=2 SV... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 2C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUM11.963e-11944.06GCR037 OS=Schmidtea mediterranea OX=79327 GN=gcr03... [more]
A0A193KU742.414e-10637.85GCR027 OS=Schmidtea mediterranea OX=79327 GN=gcr02... [more]
A0A4S2M3D36.565e-9039.31G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A1S8WK071.436e-8738.817 transmembrane receptor (Fragment) OS=Opisthorchi... [more]
A0A074ZZH11.932e-8738.81G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drd2a1.505e-3626.29D(2)-like dopamine receptor [Source:NCBI gene;Acc:... [more]
drd2b3.388e-3625.48D(2) dopamine receptor A [Source:NCBI gene;Acc:103... [more]
drd2b5.586e-3625.69D(2) dopamine receptor A [Source:NCBI gene;Acc:103... [more]
drd2b1.341e-3526.57D(2) dopamine receptor A [Source:NCBI gene;Acc:103... [more]
drd31.363e-3526.80dopamine receptor D3 [Source:NCBI gene;Acc:1030247... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004593.15.447e-3037.20pep scaffold:Pmarinus_7.0:GL476854:168999:207459:1... [more]
HTR1F4.646e-2924.835-hydroxytryptamine receptor 1F [Source:HGNC Symbo... [more]
ENSPMAT00000006953.16.735e-2633.00pep scaffold:Pmarinus_7.0:GL477632:7596:14007:1 ge... [more]
ENSPMAT00000009127.12.711e-2232.16pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 ... [more]
CHRM31.164e-2022.47cholinergic receptor muscarinic 3 [Source:HGNC Sym... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO473591.473e-1825.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352131.683e-1534.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO329396.097e-1528.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493674.544e-1423.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286031.671e-1325.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 2C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
drd34.192e-3828.57dopamine receptor D3 [Source:NCBI gene;Acc:1011632... [more]
ENSORLT00000042787.12.256e-3527.08alpha-2B adrenergic receptor-like [Source:NCBI gen... [more]
adra2a8.667e-3526.95adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750... [more]
htr2b1.929e-3435.295-hydroxytryptamine receptor 2B [Source:NCBI gene;... [more]
ADRA2C2.438e-3227.97adrenoceptor alpha 2C [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of 5-hydroxytryptamine receptor 2C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032679.10.000e+099.58SMESG000032679.1[more]
SMESG000032682.10.000e+099.57SMESG000032682.1[more]
SMESG000065390.15.458e-12344.06SMESG000065390.1[more]
SMESG000000740.11.050e-11037.85SMESG000000740.1[more]
SMESG000000740.12.025e-11037.85SMESG000000740.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021550 ID=SMED30021550|Name=5-hydroxytryptamine receptor 2C|organism=Schmidtea mediterranea sexual|type=transcript|length=1978bp
TGTGTGTGTCTTTTTATATAGAATAATAGTTGTTGTCCCATTCGCAGGTG
GGTGGCGAGATGAGCCAATCAGAATTCAGTTGAATTCAGCCTCTGACAAA
CAACTCGCATAATATTTCCACTAGTATTTTTCCTAGTATTTTCATGGCTT
CATCTAGCGCCGATCTCAATAACAGAAGCAGCAGCGGCAGCGGCGGTGGC
GTTGGCGGCGGCAGTAGCGCATTTGATAGATACCAATGGCCGTTTTTAGG
GCTGTTAATAATTCCCCTCTGCACGATCTGGGGTAACGCATTGGTCTGCG
TTTCTGTGTTCATTGAGAAAAGGTTGCAAAACCGGTTCAACTTTTTCTTG
GTGTCCTTGGCCATCAGTGACTTGCTGTGCGCCCTGCTGGTGATGCCGGT
CTCGGCTTGGAACATGGTTAGAAATAACAATTTCACCAGCGTTCCGAGAG
GAATATGCCTTGCTTGGTACAGTCTTGACGTTTTCTTTACGTCCACAACA
ATCATCCATCTCTGTTCAATCTCATTGGATAGGTATTTCGTGCTGAACAA
CCCTTTGAAGTACCACAACACGCGCATCAGATCTTCATTGCCCCTGAAAA
TCAGCATTGCATGGTTGATTCCATTCTGCATTGCTTGTCCACTATTCATA
TTTGCCCTCCGACTCGATCATATGGCGGGCAACAATCGCAATTCAGTGCC
GGAATCTGGCTGGTTATCAAATGAAACAATTTCCCAGCAGCTGGACTCTT
ACAAAGGCTGCGGCCCACACAATGTCTATTTTATCATCATTTCCACTGTG
ATCACCTTTGTCCTACCCCTCTGCATAATGATCGTTACGTACATTCTGAC
AGTCTGGTCAATTATCCGCCAGACTAACCAGGCCCGACAAAACCTTTATC
CAAACAAATCCTCCACAAAATCCCGGCCCCTAACGCAAATAAAAATAACT
GACGACAGTCAATCCATCAACGAGACGACAAACAGTGCGGACAATGATGT
CTCATACTCAATGATAGGAGTCGATGACAAATATTGCAGTCATTCCTCTC
TCAGCTTAAATTCCTTTGATTCCCCAGTCAAGAGGGGCTCATTCAAGATT
TCCCATAAGAATGAATTCACGATCCATCTCAATGTTCCAACGACCGATAT
GCGAAGAAGCTATGACTTTTCTCCTAAACAGAACTTAGCAATAAAGAAGC
AGTCTTCTCTTATCGACAAAAGTTTCCAAAGTTTCAACAATTCCTTCAAA
ATGAGTCCAACCCGCTACGGGAACCAGTTGTCAATCAGGAAGAATCTTTC
CAATTCGTTCCGAATTCACAAGCAGTCAAGGAATAGCGCCAAGCGGACGC
TCGCTGCAATGAATTCCGGCAAAAAGGCTGTGCAAGTTCTCGGAATTCTT
TTCGGTTTATTTCTTTTGTGTTATTTACCGTTTTTCGTTATTTACCTTCT
TGACTTTTTCTGTATCAAATGCCAGACCATGACCGGACCGTTGGTTTCGA
AAACCGAATGGATAGGATATTCGGCTTCGATGTTGAATCCAATTGTTTAT
CACATCTTTAACCCTACCTTCCGGAACACCTTCAACCGCTTGATGAGGTG
CAAGTGCTACAAGGTCCGTAAGGCGTTCTCTGCCAACACTAAATCTTATG
TGTAATGAGTTATGTGATTTTTGTTTTTGATGAATAGATTATTTTTCTCT
TTTTCTTTAAACAATTGCCCATCATTACGGTGAATGTCAATGATCGCGAG
GGATTTTCATGTTCGCTCATCTCATTGTCGAGTGAGCGATTCCTTGCAAG
ACGAGAAGAATATGAAGAATTCACCAGCAAAATTAAATAATTAATTTTAA
CCAAGAGTTGAATTCTGTCACGAAATTACCTCATCGAAAATTCAACCCAG
CCACAAATTTTCTAGTCGACCTCGTGCCGTTTTCAGTGAACGATTCAGAA
GGAGCTTTACTCGTAGCCAGGGGAAAGG
back to top

protein sequence of SMED30021550-orf-1

>SMED30021550-orf-1 ID=SMED30021550-orf-1|Name=SMED30021550-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=504bp
MASSSADLNNRSSSGSGGGVGGGSSAFDRYQWPFLGLLIIPLCTIWGNAL
VCVSVFIEKRLQNRFNFFLVSLAISDLLCALLVMPVSAWNMVRNNNFTSV
PRGICLAWYSLDVFFTSTTIIHLCSISLDRYFVLNNPLKYHNTRIRSSLP
LKISIAWLIPFCIACPLFIFALRLDHMAGNNRNSVPESGWLSNETISQQL
DSYKGCGPHNVYFIIISTVITFVLPLCIMIVTYILTVWSIIRQTNQARQN
LYPNKSSTKSRPLTQIKITDDSQSINETTNSADNDVSYSMIGVDDKYCSH
SSLSLNSFDSPVKRGSFKISHKNEFTIHLNVPTTDMRRSYDFSPKQNLAI
KKQSSLIDKSFQSFNNSFKMSPTRYGNQLSIRKNLSNSFRIHKQSRNSAK
RTLAAMNSGKKAVQVLGILFGLFLLCYLPFFVIYLLDFFCIKCQTMTGPL
VSKTEWIGYSASMLNPIVYHIFNPTFRNTFNRLMRCKCYKVRKAFSANTK
SYV*
back to top

protein sequence of SMED30021550-orf-2

>SMED30021550-orf-2 ID=SMED30021550-orf-2|Name=SMED30021550-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=188bp
MNSGQAMQNGINHAMLIFRGNEDLMRVLWYFKGLFSTKYLSNEIEQRWMI
VVDVKKTSRLYQARHIPLGTLVKLLFLTMFQAETGITSRAHSKSLMAKDT
KKKLNRFCNLFSMNTETQTNALPQIVQRGIINSPKNGHWYLSNALLPPPT
PPPLPLLLLLLRSALDEAMKILGKILVEILCELFVRG*
back to top
Aliases
The feature '5-hydroxytryptamine receptor 2C' has the following synonyms
Synonym
5ht-r1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004993G-protein coupled serotonin receptor activity
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007626locomotory behavior
GO:0007631feeding behavior
GO:0098664G-protein coupled serotonin receptor signaling pathway
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 214..237
score: 26.93
coord: 451..477
score: 30.29
coord: 32..56
score: 23.01
coord: 65..86
score: 37.69
coord: 148..169
score: 17.97
coord: 412..436
score: 29.51
coord: 112..134
score: 27.96
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 47..469
e-value: 1.1E-53
score: 182.3
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 118..134
NoneNo IPR availablePANTHERPTHR24247:SF2285-HYDROXYTRYPTAMINE (SEROTONIN) RECEPTOR 2A, ISOFORM Bcoord: 21..493
NoneNo IPR availablePANTHERPTHR242475-HYDROXYTRYPTAMINE RECEPTORcoord: 21..493
NoneNo IPR availableCDDcd153287tmA_5-HT5coord: 426..480
e-value: 5.22604E-5
score: 42.6306
NoneNo IPR availableCDDcd150527tmA_5-HT2coord: 32..237
e-value: 5.57599E-58
score: 190.987
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 30..493
NoneNo IPR availableTMHMMTMhelixcoord: 106..128
NoneNo IPR availableTMHMMTMhelixcoord: 454..476
NoneNo IPR availableTMHMMTMhelixcoord: 64..86
NoneNo IPR availableTMHMMTMhelixcoord: 35..57
NoneNo IPR availableTMHMMTMhelixcoord: 412..434
NoneNo IPR availableTMHMMTMhelixcoord: 213..235
NoneNo IPR availableTMHMMTMhelixcoord: 149..171
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 47..469
score: 35.357