Usp domain-containing protein

Overview
NameUsp domain-containing protein
Smed IDSMED30021549
Length (bp)778
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Usp domain-containing protein (SMED30021549) t-SNE clustered cells

Violin plots show distribution of expression levels for Usp domain-containing protein (SMED30021549) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Usp domain-containing protein (SMED30021549) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Usp domain-containing protein (SMED30021549) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021549

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30021549SMESG000079952.1 dd_Smed_v4_1092_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30021549SMESG000079952.1 dd_Smed_v4_1092_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021549SMESG000079952.1 dd_Smed_v4_1092_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021549SMESG000079952.1 dd_Smed_v4_1092_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30021549SMESG000079952.1 dd_Smed_v4_1092_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021549SMESG000079952.1 dd_Smed_v4_1092_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30021549SMESG000079952.1 dd_Smed_v4_1092_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30021549SMESG000079952.1 dd_Smed_v4_1092_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021549SMESG000079952.1 Contig37232uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021549SMESG000079952.1 Contig37232newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 4 cellSMED30021549SMESG000079952.1 dd_Smed_v4_1092_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021549SMESG000079952.1 dd_Smed_v4_1092_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Usp domain-containing protein vs. UniProt/SwissProt
Match: sp|Q57951|Y531_METJA (Universal stress protein MJ0531 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ0531 PE=3 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 2.141e-9
Identity = 45/163 (27.61%), Postives = 79/163 (48.47%), Query Frame = 3
Query:   93 VFVALIFQTYFTDLVLI----MSRRILIPVDGSDFSIKAFEWYSENVMKDNDTVVF-IHVIDPPVLNSLSLSVGMNIPVDDWATAIQAGILKAEKINEELRVRCQLMKLKSEFHSISHNNPGEGIVQFTLDKNIDMVVIGNRGLGKLKRCFLGSVSDYVLHNS 566
            VF+ L  + Y  + ++     + ++I+IP DGSD S++A + ++ N+ K+ D  V+ I+V+D      L       +  +      Q  + K +K+ EE  V+     L           P   IV+F   K  D++V+G  G   L+R  LGSV++ V+ N+
Sbjct:    4 VFILLALKYYILNSIIRNGENLYKKIVIPTDGSDVSLEAAK-HAINIAKEFDAEVYAIYVVDVSPFVGLPAEGSWELISELLKEEGQEALKKVKKMAEEWGVKIHTEML--------EGVPANEIVEFAEKKKADLIVMGTTGKTGLERILLGSVAERVIKNA 157          
BLAST of Usp domain-containing protein vs. UniProt/SwissProt
Match: sp|P42297|YXIE_BACSU (Universal stress protein YxiE OS=Bacillus subtilis (strain 168) OX=224308 GN=yxiE PE=3 SV=1)

HSP 1 Score: 49.2914 bits (116), Expect = 3.062e-6
Identity = 36/140 (25.71%), Postives = 68/140 (48.57%), Query Frame = 3
Query:  144 MSRRILIPVDGSDFSIKAFEWYSENVMKDNDTVVFIHVIDPPVLNSLSLSVGMNIP---VDDWATAIQAGILKAEKINEELRVRCQLMKLKSEFHSISHNNPGEGIVQFTLDKNIDMVVIGNRGLGKLKRCFLGSVSDYV 554
            M  ++L+ +DGSD S KA +       +    +  +HV    V+ + SL+  + +P   +D+    ++   LK   I E  + +     +++E    ++  P   I+    +K + ++V+G+RG+  LK   LGSVS  V
Sbjct:    1 MFNKMLVAIDGSDMSAKALDAAVHLAKEQQAELSILHVGREAVVTTSSLTGIVYVPEHFIDEIRNEVKKEGLK---ILENAKEKAAEKGVQAET-IYANGEPAHEILNHAKEKGVSLIVVGSRGISGLKEMMLGSVSHKV 136          
BLAST of Usp domain-containing protein vs. UniProt/SwissProt
Match: sp|P72745|Y1101_SYNY3 (Universal stress protein Slr1101 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr1101 PE=3 SV=1)

HSP 1 Score: 47.7506 bits (112), Expect = 4.748e-6
Identity = 33/106 (31.13%), Postives = 50/106 (47.17%), Query Frame = 3
Query:  258 IDPPVLNSLSLSVGMNIPVDDWATAIQAGILKAEKINEE---LRVRCQLMKLKSEFHSISHNNPGEGIVQFTLDKNIDMVVIGNRGLGKLKRCFLGSVSDYVLHNS 566
            I P V N L++ V        W T  Q G+   EK  ++   L + CQ  ++          +PG+ I Q     N D++V+G+RG   L    LGSV +YV H++
Sbjct:    4 IYPAVGNELTMEVWQQ----QWQTFEQEGLDTLEKRRQQALALDIECQAEQILG--------SPGKIICQRAKQDNSDIIVVGHRGRWGLSEILLGSVGNYVFHHA 97          
BLAST of Usp domain-containing protein vs. TrEMBL
Match: A0A183K5Q7 (Usp domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS10332 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.000e-36
Identity = 63/139 (45.32%), Postives = 92/139 (66.19%), Query Frame = 3
Query:  150 RRILIPVDGSDFSIKAFEWYSENVMKDNDTVVFIHVIDPPVLNSLSLSVGMNIPVDDWATAIQAGILKAEKINEELRVRCQLMKLKSEFHSISHNNPGEGIVQFTLDKNIDMVVIGNRGLGKLKRCFLGSVSDYVLHNS 566
            RRI +PVDGSD S +A EW+ + V +  D V+F+H ++ P L ++SLS G+ +P+DDW  A+Q  I +  K+N E    C+  K+  +F   +   PG GIVQ   D ++D++V+GNRGL +LKR  LGSVS YV+HN+
Sbjct:    8 RRICLPVDGSDHSKRAIEWFVKEVYRPGDEVLFVHCLELPYLPTISLSSGLKVPIDDWTKALQENIAQTTKLNNEYGYICECSKIPYDFIIKNGIAPGVGIVQTVEDHHVDLIVMGNRGLSRLKRTLLGSVSSYVVHNA 146          
BLAST of Usp domain-containing protein vs. TrEMBL
Match: A0A267FNF3 (Usp domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig016470g1 PE=4 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.157e-36
Identity = 63/140 (45.00%), Postives = 88/140 (62.86%), Query Frame = 3
Query:  147 SRRILIPVDGSDFSIKAFEWYSENVMKDNDTVVFIHVIDPPVLNSLSLSVGMNIPVDDWATAIQAGILKAEKINEELRVRCQLMKLKSEFHSISHNNPGEGIVQFTLDKNIDMVVIGNRGLGKLKRCFLGSVSDYVLHNS 566
             R+ILIP+DGS  +  A++WY +N+ +D D++V  H+++PP L S SL  G N+P ++W   I     KA+ + E++ VR     LK EF +     PGE +V        +MVV+G RGLG +KR FLGSVSDYVLHNS
Sbjct:    3 GRKILIPLDGSQHAEAAYQWYLDNIRRDGDSLVIAHILEPPSLPSFSLKSGFNVPTEEWRNIILESGKKAKALEEDVSVRAMQTHLKMEFVAEPSKRPGEALVDIAWRTGCNMVVMGTRGLGDVKRAFLGSVSDYVLHNS 142          
BLAST of Usp domain-containing protein vs. TrEMBL
Match: A0A430Q6R7 (Usp domain-containing protein OS=Schistosoma bovis OX=6184 GN=DC041_0008060 PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.848e-36
Identity = 62/140 (44.29%), Postives = 92/140 (65.71%), Query Frame = 3
Query:  147 SRRILIPVDGSDFSIKAFEWYSENVMKDNDTVVFIHVIDPPVLNSLSLSVGMNIPVDDWATAIQAGILKAEKINEELRVRCQLMKLKSEFHSISHNNPGEGIVQFTLDKNIDMVVIGNRGLGKLKRCFLGSVSDYVLHNS 566
             RRI +PVDGSD S +A EW+ + V +  D V+F+H ++ P L ++SL+ G+ +P+DDW  A+Q  I +  K+N E    C+  K+  +F   +   PG GIVQ   D ++D++V+GNRGL +LKR  LGSVS YV+HN+
Sbjct:    7 KRRICLPVDGSDHSKRAIEWFIKEVYRPGDEVLFVHCLELPYLPTISLTSGLKVPIDDWTKALQENIAQTTKLNNEYGYICECSKIPYDFIIKNGIAPGVGIVQTVEDHHVDLIVMGNRGLSRLKRTLLGSVSSYVVHNA 146          
BLAST of Usp domain-containing protein vs. TrEMBL
Match: A0A267DRP7 (Usp domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007404g1 PE=4 SV=1)

HSP 1 Score: 134.035 bits (336), Expect = 1.754e-35
Identity = 62/137 (45.26%), Postives = 87/137 (63.50%), Query Frame = 3
Query:  156 ILIPVDGSDFSIKAFEWYSENVMKDNDTVVFIHVIDPPVLNSLSLSVGMNIPVDDWATAIQAGILKAEKINEELRVRCQLMKLKSEFHSISHNNPGEGIVQFTLDKNIDMVVIGNRGLGKLKRCFLGSVSDYVLHNS 566
            ILIP+DGS  +  A++WY +N+ +D D++V  H+++PP L S SL  G N+P ++W   I     KA+ + E++ VR     LK EF + +   PGE +V        +MVV+G RGLG +KR FLGSVSDYVLHNS
Sbjct:    1 ILIPLDGSQHAEAAYQWYLDNIRRDGDSLVIAHILEPPSLPSFSLKSGFNVPTEEWRNIILESGKKAKALEEDVSVRAMQTHLKMEFIAETSKRPGETLVDIAWRTGCNMVVMGTRGLGDVKRAFLGSVSDYVLHNS 137          
BLAST of Usp domain-containing protein vs. TrEMBL
Match: A0A183MF88 (Usp domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS14713 PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 6.628e-35
Identity = 61/139 (43.88%), Postives = 91/139 (65.47%), Query Frame = 3
Query:  150 RRILIPVDGSDFSIKAFEWYSENVMKDNDTVVFIHVIDPPVLNSLSLSVGMNIPVDDWATAIQAGILKAEKINEELRVRCQLMKLKSEFHSISHNNPGEGIVQFTLDKNIDMVVIGNRGLGKLKRCFLGSVSDYVLHNS 566
            R I +PVDGSD S +A EW+ + V +  D V+F+H ++ P L ++SL+ G+ +P+DDW  A+Q  I +  K+N E    C+  K+  +F   +   PG GIVQ   + ++D++V+GNRGL KLKR  LGSVS YV+HN+
Sbjct:    8 RIICLPVDGSDHSKRAIEWFIKEVYRPGDEVLFVHCLELPYLPTISLTSGLKVPIDDWTKALQENIAQTTKLNNEYGYMCECSKIPYDFVIKNGIAPGVGIVQTVEEHHVDLIVMGNRGLSKLKRTLLGSVSSYVVHNA 146          
BLAST of Usp domain-containing protein vs. Ensembl Nematostella
Match: EDO44746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUS8])

HSP 1 Score: 108.227 bits (269), Expect = 2.107e-29
Identity = 53/139 (38.13%), Postives = 79/139 (56.83%), Query Frame = 3
Query:  150 RRILIPVDGSDFSIKAFEWYSENVMKDNDTVVFIHVIDPPVLNSLSLSVGMNIPVDDWATAIQAGILKAEKINEELRVRCQLMKLKSEFHSISHNNPGEGIVQFTLDKNIDMVVIGNRGLGKLKRCFLGSVSDYVLHNS 566
            RR++IPVDGS  S +AF WY ++V +  D V+ IH  + P + S   + G  +  D+W  A+   I+ A+K+ EE   +C+   +       S   PGE I Q   D +   VV+G+RG G ++R  LGSVSDY +H+S
Sbjct:    7 RRVVIPVDGSQHSERAFNWYRQHVHEPGDEVLIIHTQEQPTIPSSPYAYGGTVLPDEWNKAVDECIVNAKKLIEEYNKKCKEQGMTCRLFKGS-GQPGETICQLAKDLSAKHVVMGSRGCGTIRRTLLGSVSDYCVHHS 144          
BLAST of Usp domain-containing protein vs. Ensembl Nematostella
Match: EDO42428 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1B4])

HSP 1 Score: 105.145 bits (261), Expect = 2.528e-28
Identity = 51/143 (35.66%), Postives = 81/143 (56.64%), Query Frame = 3
Query:  144 MSRRILIPVDGSDFSIKAFEWYSENVMKDNDTVVFIHVIDPPVLNSLSLSVGMNIPVDDWATAIQAGILKAEKINEELRVRCQLMKLKSEFHSI--SHNNPGEGIVQFTLDKNIDMVVIGNRGLGKLKRCFLGSVSDYVLHNS 566
            MSR++L+ VDGS+ S  A +WY +   +D+D +    V   P L + S   G+ +P ++W   ++    +A K  E   +     K+K EF  +    N PGE I +   +K +D++++G RGL  L+R  LGSVSDYVLH++
Sbjct:    1 MSRKVLVAVDGSEHSHAALDWYLKKCKRDDDMLYGCIVKQQPSLPTFSFKAGITVPHEEWEEILKKTNERANKEEEYFEMTVVPTKMKHEFEPLLDPDNKPGERICEHARNKKVDLIIMGTRGLNTLRRTLLGSVSDYVLHHA 143          
BLAST of Usp domain-containing protein vs. Ensembl Nematostella
Match: EDO45800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRQ2])

HSP 1 Score: 103.605 bits (257), Expect = 1.084e-27
Identity = 50/140 (35.71%), Postives = 86/140 (61.43%), Query Frame = 3
Query:  150 RRILIPVDGSDFSIKAFEWYSENVMKDNDTVVFIHVIDPPVLNSLSLSVGMNIPVDD-WATAIQAGILKAEKINEELRVRCQLMKLKSEFHSISHNNPGEGIVQFTLDKNIDMVVIGNRGLGKLKRCFLGSVSDYVLHNS 566
            RRIL+P+D S  S  AFEWY  N+  + D ++ +HV+D   + +   S G+   VDD +   +  G+ + + + E+ + + +   LK++   +    PGE I Q + D++ D++++G+RGLG ++R  LGSVSDYVLH++
Sbjct:   10 RRILLPIDSSKHSEDAFEWYVNNMHHEEDELILVHVLDSAAIQTRVSSHGL---VDDEFKNEMNKGLKEVKALEEKYKTKAETASLKAKI-EVRGGKPGETICQCSKDEHCDLILMGSRGLGSIRRTILGSVSDYVLHHA 145          
BLAST of Usp domain-containing protein vs. Ensembl Nematostella
Match: EDO38238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDJ5])

HSP 1 Score: 96.6709 bits (239), Expect = 4.705e-25
Identity = 50/141 (35.46%), Postives = 82/141 (58.16%), Query Frame = 3
Query:  147 SRRILIPVDGSDFSIKAFEWYSENVMKDNDTVVFIHVIDPPVLNSLSLSVGMNIPVDDWATAIQAGILKAEKINEELRVRCQLMKLKSEFHSI-SHNNPGEGIVQFTLDKNIDMVVIGNRGLGKLKRCFLGSVSDYVLHNS 566
            +  IL PVDGSD S +AF++Y + V + +D V+  H+++P  + + +L+ G+     +W T ++     A +I  +    C+   +   F SI    N GEGI +   ++  D ++IGNRGLG +KR  LGSV+DYV+ +S
Sbjct:    4 TESILFPVDGSDHSSRAFDYYLDKVKRADDQVLLAHIVEPTGIPTPTLAHGVTRSRAEWDTIMRRMEETAREITADYEKICEAENIP--FQSIWGAGNAGEGICELAKNEGADFILIGNRGLGSIKRTLLGSVTDYVVQHS 142          
BLAST of Usp domain-containing protein vs. Ensembl Nematostella
Match: EDO44805 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUT2])

HSP 1 Score: 96.2857 bits (238), Expect = 8.276e-25
Identity = 48/140 (34.29%), Postives = 78/140 (55.71%), Query Frame = 3
Query:  147 SRRILIPVDGSDFSIKAFEWYSENVMKDNDTVVFIHVIDPPVLNSLSLSVGMNIPVDDWATAIQAGILKAEKINEELRVRCQLMKLKSEFHSISHNNPGEGIVQFTLDKNIDMVVIGNRGLGKLKRCFLGSVSDYVLHNS 566
             R+I+IPVDGS  S +AF+WY   + + ND V  +H  DP          G   P +DW   ++  +  A+ + E    +C+  K+K    +    +PGE I +   DKN D +++G+RGLG ++R  +GSVS++ LH++
Sbjct:    9 GRKIVIPVDGSKHSERAFDWYKGALHRGNDEVFVVHAFDPYAAPPTPYPYGFAFP-EDWEQHMKKTVDDAKSVMEYYEKKCKDSKMKCTMLTKP-GDPGETICEIAKDKNADQIIMGSRGLGTVRRTIVGSVSEFCLHHT 146          
BLAST of Usp domain-containing protein vs. Planmine SMEST
Match: SMESG000079952.1 (SMESG000079952.1)

HSP 1 Score: 292.352 bits (747), Expect = 1.622e-101
Identity = 141/142 (99.30%), Postives = 141/142 (99.30%), Query Frame = 3
Query:  144 MSRRILIPVDGSDFSIKAFEWYSENVMKDNDTVVFIHVIDPPVLNSLSLSVGMNIPVDDWATAIQAGILKAEKINEELRVRCQLMKLKSEFHSISHNNPGEGIVQFTLDKNIDMVVIGNRGLGKLKRCFLGSVSDYVLHNSC 569
            MSRRILIPVDGSDFSIKAFEWYSENVMKDNDTVVFIHVIDPPVLNSLSLSVGMNIPVDDWATAIQAGILKAEKINEELRVRCQLMKLKSEFHSISHNNPGEGIVQFTLDKNIDMVVIGNRGLGKLKRC LGSVSDYVLHNSC
Sbjct:    1 MSRRILIPVDGSDFSIKAFEWYSENVMKDNDTVVFIHVIDPPVLNSLSLSVGMNIPVDDWATAIQAGILKAEKINEELRVRCQLMKLKSEFHSISHNNPGEGIVQFTLDKNIDMVVIGNRGLGKLKRCLLGSVSDYVLHNSC 142          
BLAST of Usp domain-containing protein vs. Planmine SMEST
Match: SMESG000051705.1 (SMESG000051705.1)

HSP 1 Score: 155.606 bits (392), Expect = 1.246e-47
Identity = 70/143 (48.95%), Postives = 101/143 (70.63%), Query Frame = 3
Query:  138 LIMSRRILIPVDGSDFSIKAFEWYSENVMKDNDTVVFIHVIDPPVLNSLSLSVGMNIPVDDWATAIQAGILKAEKINEELRVRCQLMKLKSEFHSISHNNPGEGIVQFTLDKNIDMVVIGNRGLGKLKRCFLGSVSDYVLHNS 566
            +   +RIL+P+DGS +S KAF W  +N+ K +D ++F+HV++PPVL S +L  G+NIPVD+ +  IQ  I K+EK++      C     K E+++I+H +PGEGI Q ++D N D++VIGNRGLGK KR  LGSVSDYV++ S
Sbjct:    1 MTRPKRILLPIDGSYYSQKAFHWAVKNLYKPDDVLIFVHVVNPPVLKSFTLKSGINIPVDELSKKIQKRIEKSEKLHSSYSNECLNYNAKHEYYTITHKSPGEGICQSSVDNNADIIVIGNRGLGKFKRTLLGSVSDYVINRS 143          
BLAST of Usp domain-containing protein vs. Planmine SMEST
Match: SMESG000016283.1 (SMESG000016283.1)

HSP 1 Score: 101.679 bits (252), Expect = 1.132e-26
Identity = 52/146 (35.62%), Postives = 87/146 (59.59%), Query Frame = 3
Query:  141 IMSRRILIPVDGSDFSIKAFEWYSENVMKDNDTVVFIHVIDPPVLNSLSLSVGMNIP----VDDWATAIQAGILKAEKINEELRVRCQLMKLKSEFHSISHNNPGEGIVQFTLDKNIDMVVIGNRGLGKLKRCFLGSVSDYVLHNS 566
            +  R I+IP+D S+ S +AF WY +N+ + ND V+FIHV++P      + +VGM  P    +DD +  ++  I + +K+ +E     +   L+ +        PG  +V+   D   D+++IGNRG+G L+R FLGSVSD++LH++
Sbjct:    1 MAKRSIMIPIDSSEHSKRAFRWYIKNMKQPNDLVLFIHVVEP---VYATPAVGMMEPPPIVLDDMSRMMEDAINEGKKLGQEFMHEAKDTGLEPKAFIHVDTKPGAALVKSAKDHQADVIIIGNRGVGTLRRTFLGSVSDHILHHA 143          
BLAST of Usp domain-containing protein vs. Planmine SMEST
Match: SMESG000020952.1 (SMESG000020952.1)

HSP 1 Score: 100.138 bits (248), Expect = 5.957e-26
Identity = 50/144 (34.72%), Postives = 89/144 (61.81%), Query Frame = 3
Query:  144 MSRRILIPVDGSDFSIKAFEWYSENVMKDNDTVVFIHVIDPPVLNSLSLSVGMNI---PVDDWATAIQAGILKAEKINEELRVRCQLMKLKSEFHSISHNNPGEGIVQFTLDKNIDMVVIGNRGLGKLKRCFLGSVSDYVLHNS 566
            + R IL+PVD S+ + +A +WY EN+MK ND V  IH+++P +  S ++ +GM +   PV+D  + I+  + K + + ++     Q    +++ + I  +  GE I++      +D++++ NRG G ++R FLGSVSDYVLH++
Sbjct:    9 VERVILMPVDRSEHTERAIDWYVENLMKPNDLVQMIHIVEP-MYTSTAVGIGMEVAFLPVEDLESKIKKQLDKGKSLVKKFTHELQEKGGRAKGYVIVDSKVGEAIIKVCHTHKVDLIIVANRGEGLIRRTFLGSVSDYVLHHA 151          
BLAST of Usp domain-containing protein vs. Planmine SMEST
Match: SMESG000020882.1 (SMESG000020882.1)

HSP 1 Score: 92.8189 bits (229), Expect = 4.407e-23
Identity = 52/143 (36.36%), Postives = 84/143 (58.74%), Query Frame = 3
Query:  147 SRRILIPVDGSDFSIKAFEWYSENVMKDNDTVVFIHVIDPPVLNSLSLSVGMN---IPVDDWATAIQAGILKAEKINEELRVRCQLMKLKSEFHSISHNNPGEGIVQFTLDKNIDMVVIGNRGLGKLKRCFLGSVSDYVLHNS 566
             R I+IP+D S+ S +A +WYS N+MK+ND V  IH+++ P+ N++++ +GM    +P+++    IQ  I K + +  E          K +      +  GE I+    D   D++++ NRG G L+R FLGSVSDYVLH++
Sbjct:   18 ERIIIIPIDKSEVSRRALDWYSNNMMKENDVVHLIHIVE-PIYNTIAVGIGMEAAWLPMEELDAKIQKQIDKGKALVREYISNLTDKGGKCKGFIRVDSRVGECIISVCHDHLADVILMANRGEGLLRRTFLGSVSDYVLHHA 159          
The following BLAST results are available for this feature:
BLAST of Usp domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Usp domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Usp domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Usp domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Usp domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Usp domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Usp domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q57951|Y531_METJA2.141e-927.61Universal stress protein MJ0531 OS=Methanocaldococ... [more]
sp|P42297|YXIE_BACSU3.062e-625.71Universal stress protein YxiE OS=Bacillus subtilis... [more]
sp|P72745|Y1101_SYNY34.748e-631.13Universal stress protein Slr1101 OS=Synechocystis ... [more]
back to top
BLAST of Usp domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183K5Q71.000e-3645.32Usp domain-containing protein OS=Schistosoma curas... [more]
A0A267FNF31.157e-3645.00Usp domain-containing protein OS=Macrostomum ligna... [more]
A0A430Q6R72.848e-3644.29Usp domain-containing protein OS=Schistosoma bovis... [more]
A0A267DRP71.754e-3545.26Usp domain-containing protein (Fragment) OS=Macros... [more]
A0A183MF886.628e-3543.88Usp domain-containing protein OS=Schistosoma margr... [more]
back to top
BLAST of Usp domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Usp domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Usp domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Usp domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO447462.107e-2938.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424282.528e-2835.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458001.084e-2735.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382384.705e-2535.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448058.276e-2534.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Usp domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Usp domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079952.11.622e-10199.30SMESG000079952.1[more]
SMESG000051705.11.246e-4748.95SMESG000051705.1[more]
SMESG000016283.11.132e-2635.62SMESG000016283.1[more]
SMESG000020952.15.957e-2634.72SMESG000020952.1[more]
SMESG000020882.14.407e-2336.36SMESG000020882.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021549 ID=SMED30021549|Name=Usp domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=778bp
AGTTAGTCAAAATTCTAAGCATACACACACAAACAAACAATTGAACGATT
CTCATTGGTTGTTCAAACCAACAAATCATTTATTTATTACTTGTTTTTGT
TGCTCTTATTTTTCAAACTTATTTTACTGATTTGGTTTTAATAATGTCGA
GAAGAATATTGATTCCTGTTGATGGTAGCGATTTCAGTATTAAAGCTTTT
GAATGGTATTCAGAAAATGTGATGAAAGACAATGATACGGTTGTTTTTAT
TCATGTCATTGATCCCCCAGTTTTGAATTCGTTATCATTGTCGGTCGGCA
TGAATATTCCAGTTGATGATTGGGCAACTGCCATCCAAGCGGGAATATTG
AAAGCCGAAAAAATCAACGAAGAACTGCGAGTGAGATGCCAGCTGATGAA
ATTGAAAAGTGAATTTCACTCAATTTCCCATAACAATCCCGGAGAGGGAA
TTGTACAATTCACTCTAGACAAAAACATTGATATGGTCGTTATTGGGAAT
CGCGGCCTTGGGAAATTGAAACGGTGCTTTCTGGGGTCCGTCAGTGATTA
CGTGTTGCACAATTCTTGCGTTCCTGTTACCGTAGTGCCACCTATTAAAG
ATTAAATAGTGATATAACTCATTCGCCACCTGCCGTCAGAGATGTGTCAC
CAATCTCATATAGTAACTGTGACCGTAGTAGCGAACGTGTTTTTGAACAA
AAACCAAAGAACTTCGTTATTTATAATTGTGATTATGGTTTAATTAATTT
AAAATATATGATTAATTTTTAAAAAAAA
back to top

protein sequence of SMED30021549-orf-1

>SMED30021549-orf-1 ID=SMED30021549-orf-1|Name=SMED30021549-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=154bp
MSRRILIPVDGSDFSIKAFEWYSENVMKDNDTVVFIHVIDPPVLNSLSLS
VGMNIPVDDWATAIQAGILKAEKINEELRVRCQLMKLKSEFHSISHNNPG
EGIVQFTLDKNIDMVVIGNRGLGKLKRCFLGSVSDYVLHNSCVPVTVVPP
IKD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR006015Universal_stress_UspA
IPR014729Rossmann-like_a/b/a_fold
IPR006016UspA
Vocabulary: biological process
TermDefinition
GO:0006950response to stress
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006015Universal stress protein A familyPRINTSPR01438UNVRSLSTRESScoord: 2..20
score: 33.89
coord: 127..149
score: 41.91
coord: 109..121
score: 34.46
IPR006016UspAPFAMPF00582Uspcoord: 1..149
e-value: 3.7E-26
score: 92.3
IPR014729Rossmann-like alpha/beta/alpha sandwich foldGENE3DG3DSA:3.40.50.620coord: 1..149
e-value: 2.1E-33
score: 117.8
NoneNo IPR availablePANTHERPTHR46989FAMILY NOT NAMEDcoord: 3..151
NoneNo IPR availableCDDcd00293USP_Likecoord: 4..148
e-value: 2.66939E-29
score: 102.063
NoneNo IPR availableSUPERFAMILYSSF52402Adenine nucleotide alpha hydrolases-likecoord: 3..149