Protein kinase C

Overview
NameProtein kinase C
Smed IDSMED30021547
Length (bp)2479
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase C (SMED30021547) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase C (SMED30021547) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase C (SMED30021547) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase C (SMED30021547) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021547

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30021547SMESG000071570.1 dd_Smed_v4_4464_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021547SMESG000071570.1 dd_Smed_v4_4464_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30021547SMESG000071570.1 dd_Smed_v4_4464_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021547SMESG000071570.1 dd_Smed_v4_4464_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30021547SMESG000071570.1 dd_Smed_v4_4464_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase C vs. Ensembl Human
Match: PRKCA (protein kinase C alpha [Source:HGNC Symbol;Acc:HGNC:9393])

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 275/387 (71.06%), Postives = 320/387 (82.69%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTS--VTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            L   D  RRLSVE+WDWDRTTRNDFMGSLSFGVSEL+  P + W+KLL+QEEGE+Y + + E      M+LR +FE+A       K  S S     P +  D  + +DFNFL+VLGKGSFGKVML +RKGT+ELYAIKILKKDV+IQDDD+ECTM+EKRVLAL  KPP L QLHSCFQT+DRLYFVMEYVNGGDLMY IQQ GKFKEP AVFY+AEI++GL FLH  GIIYRDLKLDNV+LDSEGHIKIADFGMCKE+++   TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GVLLYEMLAGQPPFDGEDE++LF SI  HNVS+P+S+S+EAV++C+GLMTK   KRLGCG  G R ++EH FFRRI+W+K+E REIQPP+KPK
Sbjct:  231 LKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPK 617          

HSP 2 Score: 56.9954 bits (136), Expect = 1.237e-7
Identity = 26/52 (50.00%), Postives = 35/52 (67.31%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            P   K   +   NFDK FT+ Q  +TP D+L I N+DQ++F GFS+VNP+FV
Sbjct:  613 PFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFV 664          
BLAST of Protein kinase C vs. Ensembl Human
Match: PRKCB (protein kinase C beta [Source:HGNC Symbol;Acc:HGNC:9395])

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 282/394 (71.57%), Postives = 322/394 (81.73%), Query Frame = 1
Query:  913 RHDLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSK------QDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            R  L + D  RRLSVE+WDWD T+RNDFMGSLSFG+SEL    V+ WFKLLSQEEGE++ + V  E S A  +LR +FERA      +  +  + T  VSK      +D  + +DFNFL+VLGKGSFGKVML+ERKGTDELYA+KILKKDV+IQDDD+ECTM+EKRVLAL GKPP L QLHSCFQTMDRLYFVMEYVNGGDLMY IQQ G+FKEP AVFY+AEIA+GL FL + GIIYRDLKLDNV+LDSEGHIKIADFGMCKENI    TTKTFCGTPDYIAPEII YQPYGKSVDWWAFGVLLYEMLAGQ PF+GEDE++LF SI  HNV++P+SMS+EAV IC+GLMTK   KRLGCG  G R I+EH FFR I+W+K+E +EIQPPYKPK
Sbjct:  228 RFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKT-TNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPK 620          

HSP 2 Score: 78.5666 bits (192), Expect = 2.361e-14
Identity = 35/50 (70.00%), Postives = 43/50 (86.00%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVEV 2225
            ++KRD SNFDK FT++  ++TPTDKLFIMNLDQ EFAGFS+ NPEFV+ V
Sbjct:  622 RDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV 671          
BLAST of Protein kinase C vs. Ensembl Human
Match: PRKCB (protein kinase C beta [Source:HGNC Symbol;Acc:HGNC:9395])

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 282/394 (71.57%), Postives = 322/394 (81.73%), Query Frame = 1
Query:  913 RHDLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSK------QDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            R  L + D  RRLSVE+WDWD T+RNDFMGSLSFG+SEL    V+ WFKLLSQEEGE++ + V  E S A  +LR +FERA      +  +  + T  VSK      +D  + +DFNFL+VLGKGSFGKVML+ERKGTDELYA+KILKKDV+IQDDD+ECTM+EKRVLAL GKPP L QLHSCFQTMDRLYFVMEYVNGGDLMY IQQ G+FKEP AVFY+AEIA+GL FL + GIIYRDLKLDNV+LDSEGHIKIADFGMCKENI    TTKTFCGTPDYIAPEII YQPYGKSVDWWAFGVLLYEMLAGQ PF+GEDE++LF SI  HNV++P+SMS+EAV IC+GLMTK   KRLGCG  G R I+EH FFR I+W+K+E +EIQPPYKPK
Sbjct:  228 RFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKT-TNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPK 620          

HSP 2 Score: 53.1434 bits (126), Expect = 2.257e-6
Identity = 25/52 (48.08%), Postives = 33/52 (63.46%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            P   K   R+  NFD+ FT+    +TP D+  I N+DQ+EF GFSFVN EF+
Sbjct:  616 PYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFSFVNSEFL 667          
BLAST of Protein kinase C vs. Ensembl Human
Match: PRKCG (protein kinase C gamma [Source:HGNC Symbol;Acc:HGNC:9402])

HSP 1 Score: 492.656 bits (1267), Expect = 2.144e-163
Identity = 255/405 (62.96%), Postives = 308/405 (76.05%), Query Frame = 1
Query:  919 DLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIM---DLRNRFXXXXXXXXXXXXXXTSVTMPVSKQDIPRC-----------SDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPP-----MLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            +L   D+ RRLSVEVWDWDRT+RNDFMG++SFGVSEL+  PV+ W+KLL+QEEGE+Y + V +  + +++   +  N         R   S S   +   S  D  RC           SDF+FL+VLGKGSFGKVML ER+G+DELYAIKILKKDVI+QDDD++CT++EKRVLAL G+ P      L QLHS FQT DRLYFVMEYV GGDLMY IQQ GKFKEP A FY+AEIA+GL FLHN GIIYRDLKLDNV+LD+EGHIKI DFGMCKEN+   +TT+TFCGTPDYIAPEII YQPYGKSVDWW+FGVLLYEMLAGQPPFDGEDEE+LF +I    V++P+S+SREAV IC+G +TK   KRLG G +G   I+ H FFR I+W+++E  EI PP++P+
Sbjct:  230 NLKPGDVERRLSVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQKFEACNYPLELYERVRMGPSSSPIPSPSPSPTDPKRCFFGASPGRLHISDFSFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGSGPDGEPTIRAHGFFRWIDWERLERLEIPPPFRPR 634          

HSP 2 Score: 52.7582 bits (125), Expect = 2.496e-6
Identity = 22/52 (42.31%), Postives = 33/52 (63.46%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            P   +   R   NFDK FT+    +TP D+L + ++DQ +F GF++VNP+FV
Sbjct:  630 PFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFV 681          
BLAST of Protein kinase C vs. Ensembl Human
Match: PRKCE (protein kinase C epsilon [Source:HGNC Symbol;Acc:HGNC:9401])

HSP 1 Score: 386.726 bits (992), Expect = 3.364e-122
Identity = 177/282 (62.77%), Postives = 226/282 (80.14%), Query Frame = 1
Query: 1237 DFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGC--GLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            +FNF+ VLGKGSFGKVML E KG DE+YA+K+LKKDVI+QDDD++CTM EKR+LAL  K P L QL+ CFQT DRL+FVMEYVNGGDLM++IQ+  KF EP + FY+AE+   L+FLH HG+IYRDLKLDN+LLD+EGH K+ADFGMCKE I+   TT TFCGTPDYIAPEI++   YG SVDWWA GVL+YEM+AGQPPF+ ++E+DLF SI + +V +P  +S+EAV+I +  MTK  +KRLGC    NG   I++H FF+ I+W  +E ++I+PP+KP+
Sbjct:  407 EFNFIKVLGKGSFGKVMLAELKGKDEVYAVKVLKKDVILQDDDVDCTMTEKRILALARKHPYLTQLYCCFQTKDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHQHGVIYRDLKLDNILLDAEGHCKLADFGMCKEGILNGVTTTTFCGTPDYIAPEILQELEYGPSVDWWALGVLMYEMMAGQPPFEADNEDDLFESILHDDVLYPVWLSKEAVSILKAFMTKNPHKRLGCVASQNGEDAIKQHPFFKEIDWVLLEQKKIKPPFKPR 688          
BLAST of Protein kinase C vs. Ensembl Celegans
Match: pkc-2 (Protein kinase C-like 2 [Source:UniProtKB/Swiss-Prot;Acc:P90980])

HSP 1 Score: 549.666 bits (1415), Expect = 0.000e+0
Identity = 263/392 (67.09%), Postives = 316/392 (80.61%), Query Frame = 1
Query:  934 DLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXX------XXXXXXXXXXXTSVTMPV--SKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCG---LNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            D  RRLS+EVWDWDRT+RNDFMGSLSFG+SEL+ +  + W+KLLS EEGEFY I +T E    +  +R +          S+   +  +   + T+P+  S  ++ + SDFNFL VLGKGSFGKV+L E+K T EL+AIK+LKKDVIIQDDD+ECTM EKRVLAL  KP  LV LHSCFQTMDRLYFVME+VNGGDLMY+IQQ GKFKEPVAVFY+AEIAVGL FLH+ GIIYRDLKLDNV+L+ +GHIKI DFGMCKENI G++TTKTFCGTPDYIAPEII YQPYGKSVDWWA+GVLL+EMLAGQPPFDGEDE++LF +IT HNVS+P+S+S+EAV++C+ L+ K  +KRLGC     +  R I+EH FFRRI+W KIE R+IQPP+KPK
Sbjct:  378 DKDRRLSIEVWDWDRTSRNDFMGSLSFGISELMKEAASGWYKLLSAEEGEFYNINITPEYDEDMEKVRKKMNENFITRDNSSSKPKDPAAPRASTLPLGSSNHNVIKASDFNFLTVLGKGSFGKVLLGEQKTTKELFAIKVLKKDVIIQDDDVECTMTEKRVLALPEKPSFLVALHSCFQTMDRLYFVMEFVNGGDLMYQIQQVGKFKEPVAVFYAAEIAVGLFFLHSKGIIYRDLKLDNVMLERDGHIKITDFGMCKENIFGDATTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLFEMLAGQPPFDGEDEDELFTAITEHNVSYPKSLSKEAVSLCKALLIKNPSKRLGCTGDDESASRDIKEHPFFRRIDWFKIETRQIQPPFKPK 769          

HSP 2 Score: 68.5514 bits (166), Expect = 1.466e-11
Identity = 32/50 (64.00%), Postives = 38/50 (76.00%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVEV 2225
            K+  D SNFD  FT E  ++TP D+LF+MNLDQTEF GFSFVNPE+V E 
Sbjct:  887 KSADDTSNFDSEFTHEVPKLTPIDRLFLMNLDQTEFEGFSFVNPEYVQEC 936          
BLAST of Protein kinase C vs. Ensembl Celegans
Match: pkc-2 (Protein kinase C-like 2 [Source:UniProtKB/Swiss-Prot;Acc:P90980])

HSP 1 Score: 548.125 bits (1411), Expect = 0.000e+0
Identity = 263/392 (67.09%), Postives = 316/392 (80.61%), Query Frame = 1
Query:  934 DLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXX------XXXXXXXXXXXTSVTMPV--SKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGC---GLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            D  RRLS+EVWDWDRT+RNDFMGSLSFG+SEL+ +  + W+KLLS EEGEFY I +T E    +  +R +          S+   +  +   + T+P+  S  ++ + SDFNFL VLGKGSFGKV+L E+K T EL+AIK+LKKDVIIQDDD+ECTM EKRVLAL  KP  LV LHSCFQTMDRLYFVME+VNGGDLMY+IQQ GKFKEPVAVFY+AEIAVGL FLH+ GIIYRDLKLDNV+L+ +GHIKI DFGMCKENI G++TTKTFCGTPDYIAPEII YQPYGKSVDWWA+GVLL+EMLAGQPPFDGEDE++LF +IT HNVS+P+S+S+EAV++C+ L+ K  +KRLGC     +  R I+EH FFRRI+W KIE R+IQPP+KPK
Sbjct:  283 DKDRRLSIEVWDWDRTSRNDFMGSLSFGISELMKEAASGWYKLLSAEEGEFYNINITPEYDEDMEKVRKKMNENFITRDNSSSKPKDPAAPRASTLPLGSSNHNVIKASDFNFLTVLGKGSFGKVLLGEQKTTKELFAIKVLKKDVIIQDDDVECTMTEKRVLALPEKPSFLVALHSCFQTMDRLYFVMEFVNGGDLMYQIQQVGKFKEPVAVFYAAEIAVGLFFLHSKGIIYRDLKLDNVMLERDGHIKITDFGMCKENIFGDATTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLFEMLAGQPPFDGEDEDELFTAITEHNVSYPKSLSKEAVSLCKALLIKNPSKRLGCTGDDESASRDIKEHPFFRRIDWFKIETRQIQPPFKPK 674          

HSP 2 Score: 68.5514 bits (166), Expect = 1.286e-11
Identity = 32/50 (64.00%), Postives = 38/50 (76.00%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVEV 2225
            K+  D SNFD  FT E  ++TP D+LF+MNLDQTEF GFSFVNPE+V E 
Sbjct:  676 KSADDTSNFDSEFTHEVPKLTPIDRLFLMNLDQTEFEGFSFVNPEYVQEC 725          
BLAST of Protein kinase C vs. Ensembl Celegans
Match: pkc-2 (Protein kinase C-like 2 [Source:UniProtKB/Swiss-Prot;Acc:P90980])

HSP 1 Score: 547.354 bits (1409), Expect = 0.000e+0
Identity = 263/392 (67.09%), Postives = 316/392 (80.61%), Query Frame = 1
Query:  934 DLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXX------XXXXXXXXXXXTSVTMPV--SKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGC---GLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            D  RRLS+EVWDWDRT+RNDFMGSLSFG+SEL+ +  + W+KLLS EEGEFY I +T E    +  +R +          S+   +  +   + T+P+  S  ++ + SDFNFL VLGKGSFGKV+L E+K T EL+AIK+LKKDVIIQDDD+ECTM EKRVLAL  KP  LV LHSCFQTMDRLYFVME+VNGGDLMY+IQQ GKFKEPVAVFY+AEIAVGL FLH+ GIIYRDLKLDNV+L+ +GHIKI DFGMCKENI G++TTKTFCGTPDYIAPEII YQPYGKSVDWWA+GVLL+EMLAGQPPFDGEDE++LF +IT HNVS+P+S+S+EAV++C+ L+ K  +KRLGC     +  R I+EH FFRRI+W KIE R+IQPP+KPK
Sbjct:  238 DKDRRLSIEVWDWDRTSRNDFMGSLSFGISELMKEAASGWYKLLSAEEGEFYNINITPEYDEDMEKVRKKMNENFITRDNSSSKPKDPAAPRASTLPLGSSNHNVIKASDFNFLTVLGKGSFGKVLLGEQKTTKELFAIKVLKKDVIIQDDDVECTMTEKRVLALPEKPSFLVALHSCFQTMDRLYFVMEFVNGGDLMYQIQQVGKFKEPVAVFYAAEIAVGLFFLHSKGIIYRDLKLDNVMLERDGHIKITDFGMCKENIFGDATTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLFEMLAGQPPFDGEDEDELFTAITEHNVSYPKSLSKEAVSLCKALLIKNPSKRLGCTGDDESASRDIKEHPFFRRIDWFKIETRQIQPPFKPK 629          
BLAST of Protein kinase C vs. Ensembl Celegans
Match: pkc-2 (Protein kinase C-like 2 [Source:UniProtKB/Swiss-Prot;Acc:P90980])

HSP 1 Score: 547.354 bits (1409), Expect = 0.000e+0
Identity = 263/392 (67.09%), Postives = 316/392 (80.61%), Query Frame = 1
Query:  934 DLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXX------XXXXXXXXXXXTSVTMPV--SKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGC---GLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            D  RRLS+EVWDWDRT+RNDFMGSLSFG+SEL+ +  + W+KLLS EEGEFY I +T E    +  +R +          S+   +  +   + T+P+  S  ++ + SDFNFL VLGKGSFGKV+L E+K T EL+AIK+LKKDVIIQDDD+ECTM EKRVLAL  KP  LV LHSCFQTMDRLYFVME+VNGGDLMY+IQQ GKFKEPVAVFY+AEIAVGL FLH+ GIIYRDLKLDNV+L+ +GHIKI DFGMCKENI G++TTKTFCGTPDYIAPEII YQPYGKSVDWWA+GVLL+EMLAGQPPFDGEDE++LF +IT HNVS+P+S+S+EAV++C+ L+ K  +KRLGC     +  R I+EH FFRRI+W KIE R+IQPP+KPK
Sbjct:  238 DKDRRLSIEVWDWDRTSRNDFMGSLSFGISELMKEAASGWYKLLSAEEGEFYNINITPEYDEDMEKVRKKMNENFITRDNSSSKPKDPAAPRASTLPLGSSNHNVIKASDFNFLTVLGKGSFGKVLLGEQKTTKELFAIKVLKKDVIIQDDDVECTMTEKRVLALPEKPSFLVALHSCFQTMDRLYFVMEFVNGGDLMYQIQQVGKFKEPVAVFYAAEIAVGLFFLHSKGIIYRDLKLDNVMLERDGHIKITDFGMCKENIFGDATTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLFEMLAGQPPFDGEDEDELFTAITEHNVSYPKSLSKEAVSLCKALLIKNPSKRLGCTGDDESASRDIKEHPFFRRIDWFKIETRQIQPPFKPK 629          

HSP 2 Score: 68.5514 bits (166), Expect = 1.276e-11
Identity = 32/50 (64.00%), Postives = 38/50 (76.00%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVEV 2225
            K+  D SNFD  FT E  ++TP D+LF+MNLDQTEF GFSFVNPE+V E 
Sbjct:  631 KSADDTSNFDSEFTHEVPKLTPIDRLFLMNLDQTEFEGFSFVNPEYVQEC 680          
BLAST of Protein kinase C vs. Ensembl Celegans
Match: pkc-1 (Protein kinase C-like 1B [Source:UniProtKB/Swiss-Prot;Acc:P34885])

HSP 1 Score: 390.193 bits (1001), Expect = 2.091e-125
Identity = 180/282 (63.83%), Postives = 223/282 (79.08%), Query Frame = 1
Query: 1237 DFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLN--GVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            DF F+ VLGKGSFGKVML ERKGTDE+YAIKILKKDVI+QDDD+ECTM EKR+L+L  K P L  LHS FQT DRL+FVMEYVNGGDLM++IQ+  KF E  A FY+AE+   L FLH + +IYRDLKLDN+LLD+EGH ++ADFGMCKE I  ++ T TFCGTPDYIAPEI++   YG SVDWWA GVL+YEM+AGQPPF+ ++E+DLF +I N +V +P  +S+EAVNI +  MTK   KRLGC ++  G   I+ H FFR I+WD +E R+++PP+KPK
Sbjct:  290 DFTFMKVLGKGSFGKVMLAERKGTDEVYAIKILKKDVIVQDDDVECTMCEKRILSLAAKHPFLTALHSSFQTSDRLFFVMEYVNGGDLMFQIQRARKFDESRARFYAAEVTCALQFLHRNDVIYRDLKLDNILLDAEGHCRLADFGMCKEGINKDNLTSTFCGTPDYIAPEILQEMEYGVSVDWWALGVLMYEMMAGQPPFEADNEDDLFEAILNDDVLYPVWLSKEAVNILKAFMTKNAGKRLGCVVSQGGEDAIRAHPFFREIDWDALESRQVKPPFKPK 571          

HSP 2 Score: 54.6842 bits (130), Expect = 2.644e-7
Identity = 24/46 (52.17%), Postives = 33/46 (71.74%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEF 2213
            K+KRD +NFD  FTKE+  +TP+D   +  ++Q EF GFSF+NP F
Sbjct:  573 KSKRDANNFDSDFTKEEPVLTPSDPAVVRAINQDEFRGFSFINPHF 618          
BLAST of Protein kinase C vs. Ensembl Fly
Match: Pkc53E (gene:FBgn0003091 transcript:FBtr0305069)

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 266/387 (68.73%), Postives = 324/387 (83.72%), Query Frame = 1
Query:  916 HDLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            +DL  ED  RR+ +EVWDWDRT+RNDFMG+LSFG+SE++  P N WFKLL+Q+EGE+Y +   ++    +     + ++  ++ +    +S + T   SK+D+ R +DFNF+ VLGKGSFGKV+L ERKG++ELYAIKILKKDVIIQDDD+ECTMIEKRVLAL  KPP LVQLHSCFQTMDRL+FVMEYVNGGDLM++IQQ GKFKEPVAVFY+AEIA GL FLH  GI+YRDLKLDNVLLD++GH+KIADFGMCKENIVG+ TTKTFCGTPDYIAPEII YQPYGKSVDWWA+GVLLYEML GQPPFDGEDEE+LF +IT+HNVS+P+S+S+EA   C+G +TK+ NKRLGCG +G   ++ H FFRRI+W+KIE RE+QPP+KPK
Sbjct:   93 YDLKPEDKDRRILIEVWDWDRTSRNDFMGALSFGISEIIKNPTNGWFKLLTQDEGEYYNVPCADDEQDLL-----KLKQKPSQKKPMVMRSDTNTHTSSKKDMIRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLALGEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKPK 474          

HSP 2 Score: 72.7886 bits (177), Expect = 6.386e-13
Identity = 31/47 (65.96%), Postives = 42/47 (89.36%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            K+++DVSNFDK FT E+  +TPTDK+F+MNLDQ+EF GFS++NPE+V
Sbjct:  476 KHRKDVSNFDKQFTSEKTDLTPTDKVFMMNLDQSEFVGFSYMNPEYV 522          
BLAST of Protein kinase C vs. Ensembl Fly
Match: Pkc53E (gene:FBgn0003091 transcript:FBtr0112819)

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 266/387 (68.73%), Postives = 324/387 (83.72%), Query Frame = 1
Query:  916 HDLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            +DL  ED  RR+ +EVWDWDRT+RNDFMG+LSFG+SE++  P N WFKLL+Q+EGE+Y +   ++    +     + ++  ++ +    +S + T   SK+D+ R +DFNF+ VLGKGSFGKV+L ERKG++ELYAIKILKKDVIIQDDD+ECTMIEKRVLAL  KPP LVQLHSCFQTMDRL+FVMEYVNGGDLM++IQQ GKFKEPVAVFY+AEIA GL FLH  GI+YRDLKLDNVLLD++GH+KIADFGMCKENIVG+ TTKTFCGTPDYIAPEII YQPYGKSVDWWA+GVLLYEML GQPPFDGEDEE+LF +IT+HNVS+P+S+S+EA   C+G +TK+ NKRLGCG +G   ++ H FFRRI+W+KIE RE+QPP+KPK
Sbjct:  246 YDLKPEDKDRRILIEVWDWDRTSRNDFMGALSFGISEIIKNPTNGWFKLLTQDEGEYYNVPCADDEQDLL-----KLKQKPSQKKPMVMRSDTNTHTSSKKDMIRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLALGEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKPK 627          

HSP 2 Score: 72.7886 bits (177), Expect = 7.571e-13
Identity = 31/47 (65.96%), Postives = 42/47 (89.36%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            K+++DVSNFDK FT E+  +TPTDK+F+MNLDQ+EF GFS++NPE+V
Sbjct:  629 KHRKDVSNFDKQFTSEKTDLTPTDKVFMMNLDQSEFVGFSYMNPEYV 675          
BLAST of Protein kinase C vs. Ensembl Fly
Match: Pkc53E (gene:FBgn0003091 transcript:FBtr0305070)

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 266/387 (68.73%), Postives = 324/387 (83.72%), Query Frame = 1
Query:  916 HDLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            +DL  ED  RR+ +EVWDWDRT+RNDFMG+LSFG+SE++  P N WFKLL+Q+EGE+Y +   ++    +     + ++  ++ +    +S + T   SK+D+ R +DFNF+ VLGKGSFGKV+L ERKG++ELYAIKILKKDVIIQDDD+ECTMIEKRVLAL  KPP LVQLHSCFQTMDRL+FVMEYVNGGDLM++IQQ GKFKEPVAVFY+AEIA GL FLH  GI+YRDLKLDNVLLD++GH+KIADFGMCKENIVG+ TTKTFCGTPDYIAPEII YQPYGKSVDWWA+GVLLYEML GQPPFDGEDEE+LF +IT+HNVS+P+S+S+EA   C+G +TK+ NKRLGCG +G   ++ H FFRRI+W+KIE RE+QPP+KPK
Sbjct:  246 YDLKPEDKDRRILIEVWDWDRTSRNDFMGALSFGISEIIKNPTNGWFKLLTQDEGEYYNVPCADDEQDLL-----KLKQKPSQKKPMVMRSDTNTHTSSKKDMIRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLALGEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKPK 627          

HSP 2 Score: 72.7886 bits (177), Expect = 7.571e-13
Identity = 31/47 (65.96%), Postives = 42/47 (89.36%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            K+++DVSNFDK FT E+  +TPTDK+F+MNLDQ+EF GFS++NPE+V
Sbjct:  629 KHRKDVSNFDKQFTSEKTDLTPTDKVFMMNLDQSEFVGFSYMNPEYV 675          
BLAST of Protein kinase C vs. Ensembl Fly
Match: Pkc53E (gene:FBgn0003091 transcript:FBtr0087048)

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 266/387 (68.73%), Postives = 324/387 (83.72%), Query Frame = 1
Query:  916 HDLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            +DL  ED  RR+ +EVWDWDRT+RNDFMG+LSFG+SE++  P N WFKLL+Q+EGE+Y +   ++    +     + ++  ++ +    +S + T   SK+D+ R +DFNF+ VLGKGSFGKV+L ERKG++ELYAIKILKKDVIIQDDD+ECTMIEKRVLAL  KPP LVQLHSCFQTMDRL+FVMEYVNGGDLM++IQQ GKFKEPVAVFY+AEIA GL FLH  GI+YRDLKLDNVLLD++GH+KIADFGMCKENIVG+ TTKTFCGTPDYIAPEII YQPYGKSVDWWA+GVLLYEML GQPPFDGEDEE+LF +IT+HNVS+P+S+S+EA   C+G +TK+ NKRLGCG +G   ++ H FFRRI+W+KIE RE+QPP+KPK
Sbjct:  247 YDLKPEDKDRRILIEVWDWDRTSRNDFMGALSFGISEIIKNPTNGWFKLLTQDEGEYYNVPCADDEQDLL-----KLKQKPSQKKPMVMRSDTNTHTSSKKDMIRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLALGEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKPK 628          

HSP 2 Score: 72.7886 bits (177), Expect = 7.646e-13
Identity = 31/47 (65.96%), Postives = 42/47 (89.36%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            K+++DVSNFDK FT E+  +TPTDK+F+MNLDQ+EF GFS++NPE+V
Sbjct:  630 KHRKDVSNFDKQFTSEKTDLTPTDKVFMMNLDQSEFVGFSYMNPEYV 676          
BLAST of Protein kinase C vs. Ensembl Fly
Match: Pkc53E (gene:FBgn0003091 transcript:FBtr0331960)

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 266/387 (68.73%), Postives = 324/387 (83.72%), Query Frame = 1
Query:  916 HDLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            +DL  ED  RR+ +EVWDWDRT+RNDFMG+LSFG+SE++  P N WFKLL+Q+EGE+Y +   ++    +     + ++  ++ +    +S + T   SK+D+ R +DFNF+ VLGKGSFGKV+L ERKG++ELYAIKILKKDVIIQDDD+ECTMIEKRVLAL  KPP LVQLHSCFQTMDRL+FVMEYVNGGDLM++IQQ GKFKEPVAVFY+AEIA GL FLH  GI+YRDLKLDNVLLD++GH+KIADFGMCKENIVG+ TTKTFCGTPDYIAPEII YQPYGKSVDWWA+GVLLYEML GQPPFDGEDEE+LF +IT+HNVS+P+S+S+EA   C+G +TK+ NKRLGCG +G   ++ H FFRRI+W+KIE RE+QPP+KPK
Sbjct:  238 YDLKPEDKDRRILIEVWDWDRTSRNDFMGALSFGISEIIKNPTNGWFKLLTQDEGEYYNVPCADDEQDLL-----KLKQKPSQKKPMVMRSDTNTHTSSKKDMIRATDFNFIKVLGKGSFGKVLLAERKGSEELYAIKILKKDVIIQDDDVECTMIEKRVLALGEKPPFLVQLHSCFQTMDRLFFVMEYVNGGDLMFQIQQFGKFKEPVAVFYAAEIAAGLFFLHTKGILYRDLKLDNVLLDADGHVKIADFGMCKENIVGDKTTKTFCGTPDYIAPEIILYQPYGKSVDWWAYGVLLYEMLVGQPPFDGEDEEELFAAITDHNVSYPKSLSKEAKEACKGFLTKQPNKRLGCGSSGEEDVRLHPFFRRIDWEKIENREVQPPFKPK 619          

HSP 2 Score: 72.7886 bits (177), Expect = 8.036e-13
Identity = 31/47 (65.96%), Postives = 42/47 (89.36%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            K+++DVSNFDK FT E+  +TPTDK+F+MNLDQ+EF GFS++NPE+V
Sbjct:  621 KHRKDVSNFDKQFTSEKTDLTPTDKVFMMNLDQSEFVGFSYMNPEYV 667          
BLAST of Protein kinase C vs. Ensembl Zebrafish
Match: prkcbb (protein kinase C, beta b [Source:NCBI gene;Acc:393953])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 274/389 (70.44%), Postives = 319/389 (82.01%), Query Frame = 1
Query:  919 DLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPV---SKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            +L + D  RRLSVE+WDWD T+RNDFMGSLSFG+SEL  + V+ WFKLLSQEEGE++ + V  E      +LR +FERA     +    S++          +D  + SDFNFL+VLGKGSFGKVML ERKG DEL+AIKILKKDV+IQDDD+ECTM+EKRVLAL GKPP L QLHSCFQTMDRLYFVMEY+NGGDLMY IQQ GKFKEP AVFY+AEIA+GL FLH+ G+IYRDLKLDNV+LD+EGHIKIADFGMCKEN++   TTKTFCGTPDYIAPEII YQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDE++LF SI  H+VS+P+SMS+EAV IC+GLMTK   KRLGCG  G R I+EH FFR ++W+K+E RE+QPP+KPK
Sbjct:  229 NLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKQGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEELRQKFERAKIGPSKTDGSSSNAISKFDSNGNRDRMKLSDFNFLMVLGKGSFGKVMLAERKGADELFAIKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYINGGDLMYHIQQVGKFKEPHAVFYAAEIAIGLFFLHSKGVIYRDLKLDNVMLDAEGHIKIADFGMCKENMLDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIREHGFFRYMDWEKLEHREVQPPFKPK 617          

HSP 2 Score: 68.9366 bits (167), Expect = 1.631e-11
Identity = 31/48 (64.58%), Postives = 37/48 (77.08%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVV 2219
            +N RD  NFD+ FTK   ++TPTDKLFIMNLDQ EF GFS+ NPE+ V
Sbjct:  619 RNSRDTCNFDREFTKMAVELTPTDKLFIMNLDQDEFLGFSYTNPEYEV 666          
BLAST of Protein kinase C vs. Ensembl Zebrafish
Match: prkcbb (protein kinase C, beta b [Source:NCBI gene;Acc:393953])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 274/389 (70.44%), Postives = 319/389 (82.01%), Query Frame = 1
Query:  919 DLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPV---SKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            +L + D  RRLSVE+WDWD T+RNDFMGSLSFG+SEL  + V+ WFKLLSQEEGE++ + V  E      +LR +FERA     +    S++          +D  + SDFNFL+VLGKGSFGKVML ERKG DEL+AIKILKKDV+IQDDD+ECTM+EKRVLAL GKPP L QLHSCFQTMDRLYFVMEY+NGGDLMY IQQ GKFKEP AVFY+AEIA+GL FLH+ G+IYRDLKLDNV+LD+EGHIKIADFGMCKEN++   TTKTFCGTPDYIAPEII YQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDE++LF SI  H+VS+P+SMS+EAV IC+GLMTK   KRLGCG  G R I+EH FFR ++W+K+E RE+QPP+KPK
Sbjct:  229 NLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKQGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEELRQKFERAKIGPSKTDGSSSNAISKFDSNGNRDRMKLSDFNFLMVLGKGSFGKVMLAERKGADELFAIKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYINGGDLMYHIQQVGKFKEPHAVFYAAEIAIGLFFLHSKGVIYRDLKLDNVMLDAEGHIKIADFGMCKENMLDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIREHGFFRYMDWEKLEHREVQPPFKPK 617          

HSP 2 Score: 59.3066 bits (142), Expect = 1.528e-8
Identity = 28/51 (54.90%), Postives = 33/51 (64.71%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEF 2213
            P   K   RD  NFD+ FT+    +TP D+  IMNLDQ EF GFSF+NPEF
Sbjct:  613 PFKPKACGRDAENFDRFFTRHPPVLTPPDQEVIMNLDQDEFEGFSFINPEF 663          
BLAST of Protein kinase C vs. Ensembl Zebrafish
Match: prkcab (protein kinase C, alpha, b [Source:ZFIN;Acc:ZDB-GENE-131121-412])

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 271/388 (69.85%), Postives = 318/388 (81.96%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTS---VTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            L   D  RRLSVEVWDWDRTTRNDFMGS+SFGVSEL+  PV+ W+K+L+QEEGE+Y + + EE     ++LR +FE+A     ++    T     ++P    D  R +DF+FL +LGKGSFGKVML E K T+ELYAIKILKKDV+IQDDD+ECTM+EKRVLA + KPP L QLHSCFQT+DRLYFVMEY+NGGDLMY IQQ GKFKEP AVFY+AEIAVGL FLH  GIIYRDLKLDNV+LDSEGHIKIADFGMCKEN+    TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GVLLYEMLAGQPPFDGEDE++LF SI  HNVS+P+S+++EAV+IC+GLMTK  +KRLGCG  G R I+E  FFRRI+WD++  REIQPP+KPK
Sbjct:  183 LKASDKERRLSVEVWDWDRTTRNDFMGSMSFGVSELIKAPVSGWYKMLNQEEGEYYNVPIPEENDIN-LELRQKFEKAKLGPGKKVITPTDHRRFSLPSGNMDKVRLNDFHFLALLGKGSFGKVMLAEMKSTEELYAIKILKKDVVIQDDDVECTMVEKRVLAQREKPPFLTQLHSCFQTVDRLYFVMEYINGGDLMYHIQQVGKFKEPQAVFYAAEIAVGLFFLHRKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENMYEGMTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLTKEAVSICKGLMTKHPSKRLGCGAEGERDIKEQAFFRRIDWDRLANREIQPPFKPK 569          

HSP 2 Score: 61.6178 bits (148), Expect = 2.703e-9
Identity = 28/52 (53.85%), Postives = 36/52 (69.23%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            P   K   +   NFDK FT+ Q  +TP D+L I N+DQ+EFAGFSF+NPEF+
Sbjct:  565 PFKPKVCGKAAENFDKFFTRTQPMLTPPDQLVIANIDQSEFAGFSFINPEFI 616          
BLAST of Protein kinase C vs. Ensembl Zebrafish
Match: prkcaa (protein kinase C, alpha, a [Source:ZFIN;Acc:ZDB-GENE-050208-100])

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 271/390 (69.49%), Postives = 316/390 (81.03%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXX---XXXXXXXXXTSVTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPKKI 2082
            L   D  RRL+VEVWDWDRTTRNDFMGS+SFGVSEL+  PV  W+K+L+QEEGE+Y + + +E      +LR +FE A     +        +  ++  S  D  R SDFNFL VLGKGSFGKVML E K +DEL+AIKILKKDV+IQDDD+ECTM+EKRVLA Q KPP L QLHSCFQT+DRLYFVMEYVNGGDLMY IQQ GKFKEP AVFY+AEIAVGL FLH  GIIYRDLKLDNV+LD+EGHIKIADFGMCKENIV   TT+TFCGTPDYIAPEII YQPYG+SVDWWA+GVLLYEMLAGQPPFDGEDE++LF SI  HNVS+ +++S+EAV+IC+GLMTK  +KRLGCG  G R I+EH FFRRI+WD++  RE+QPP+KPK +
Sbjct:  229 LKPADKDRRLAVEVWDWDRTTRNDFMGSMSFGVSELMKSPVCGWYKMLNQEEGEYYNVPIPDEDDPDT-ELRQKFEIAKLGPPKKNITALDDSGSSITSSNVDNVRLSDFNFLAVLGKGSFGKVMLAEMKSSDELFAIKILKKDVVIQDDDVECTMVEKRVLAQQDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEIAVGLFFLHKKGIIYRDLKLDNVMLDAEGHIKIADFGMCKENIVEGVTTRTFCGTPDYIAPEIIAYQPYGRSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYSKTLSKEAVSICKGLMTKHPSKRLGCGQEGERDIREHAFFRRIDWDRLANREVQPPFKPKVV 617          
BLAST of Protein kinase C vs. Ensembl Zebrafish
Match: prkcaa (protein kinase C, alpha, a [Source:ZFIN;Acc:ZDB-GENE-050208-100])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 271/388 (69.85%), Postives = 315/388 (81.19%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXX---XXXXXXXXXTSVTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            L   D  RRL+VEVWDWDRTTRNDFMGS+SFGVSEL+  PV  W+K+L+QEEGE+Y + + +E      +LR +FE A     +        +  ++  S  D  R SDFNFL VLGKGSFGKVML E K +DEL+AIKILKKDV+IQDDD+ECTM+EKRVLA Q KPP L QLHSCFQT+DRLYFVMEYVNGGDLMY IQQ GKFKEP AVFY+AEIAVGL FLH  GIIYRDLKLDNV+LD+EGHIKIADFGMCKENIV   TT+TFCGTPDYIAPEII YQPYG+SVDWWA+GVLLYEMLAGQPPFDGEDE++LF SI  HNVS+ +++S+EAV+IC+GLMTK  +KRLGCG  G R I+EH FFRRI+WD++  RE+QPP+KPK
Sbjct:  229 LKPADKDRRLAVEVWDWDRTTRNDFMGSMSFGVSELMKSPVCGWYKMLNQEEGEYYNVPIPDEDDPDT-ELRQKFEIAKLGPPKKNITALDDSGSSITSSNVDNVRLSDFNFLAVLGKGSFGKVMLAEMKSSDELFAIKILKKDVVIQDDDVECTMVEKRVLAQQDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEIAVGLFFLHKKGIIYRDLKLDNVMLDAEGHIKIADFGMCKENIVEGVTTRTFCGTPDYIAPEIIAYQPYGRSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYSKTLSKEAVSICKGLMTKHPSKRLGCGQEGERDIREHAFFRRIDWDRLANREVQPPFKPK 615          

HSP 2 Score: 58.5362 bits (140), Expect = 2.982e-8
Identity = 27/52 (51.92%), Postives = 35/52 (67.31%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            P   K   +   NFDK FT+ Q Q+TP D+L I N+DQ +F GF+FVNP+FV
Sbjct:  611 PFKPKVCGKGAENFDKFFTRTQPQLTPPDELVIANIDQADFDGFTFVNPQFV 662          
BLAST of Protein kinase C vs. Ensembl Xenopus
Match: prkcb (protein kinase C beta [Source:NCBI gene;Acc:100038043])

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 275/391 (70.33%), Postives = 318/391 (81.33%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSK------QDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            L + D  RRLSVE+WDWD T+RNDFMGSLSFG+SEL+   V+ WFKLLSQEEGE++ + V  E      +LR +FERA      +  +   V  P+ K      +D  + SDFNFL VLGKGSFGKV+L ERKGTDELYAIKILKKDV+IQDDD+ECTM+EKRVLAL GKPP L QLHSCFQTMDRLYFVMEYVNGGDLMY+IQQ G+FKEP AVFY+AEIA+GL+FLH+ GI+YRDLKLDNV+LDSEGHIKIADFGMCKEN+    TTKTFCGTPDYIAPEII YQPY KSVDWWAFG+LLYEMLAGQ PF+GEDE++LF SI  HNV++P+SMS+EAV IC+GLMTK   KRLGCG  G R I++H FFR I+W+K+E  EIQPPYKPK
Sbjct:  224 LKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELLKAGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEELRQKFERAKIGPGTKAVEE-KVVNPMPKVDNNGTRDRMKVSDFNFLKVLGKGSFGKVILAERKGTDELYAIKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYQIQQVGRFKEPHAVFYAAEIAIGLLFLHSKGIVYRDLKLDNVMLDSEGHIKIADFGMCKENMWDGVTTKTFCGTPDYIAPEIIAYQPYAKSVDWWAFGILLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKDHAFFRYIDWEKLERNEIQPPYKPK 613          

HSP 2 Score: 51.6026 bits (122), Expect = 4.753e-6
Identity = 25/54 (46.30%), Postives = 32/54 (59.26%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVE 2222
            P   K   R+  NFDK FT+    +TP D   I N+DQ+EF GFS+VN +F  E
Sbjct:  609 PYKPKACGRNAENFDKFFTRHPPVLTPPDHEVIRNIDQSEFEGFSYVNSDFAKE 662          
BLAST of Protein kinase C vs. Ensembl Xenopus
Match: prkcb (protein kinase C beta [Source:NCBI gene;Acc:100038043])

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 275/391 (70.33%), Postives = 318/391 (81.33%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSK------QDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            L + D  RRLSVE+WDWD T+RNDFMGSLSFG+SEL+   V+ WFKLLSQEEGE++ + V  E      +LR +FERA      +  +   V  P+ K      +D  + SDFNFL VLGKGSFGKV+L ERKGTDELYAIKILKKDV+IQDDD+ECTM+EKRVLAL GKPP L QLHSCFQTMDRLYFVMEYVNGGDLMY+IQQ G+FKEP AVFY+AEIA+GL+FLH+ GI+YRDLKLDNV+LDSEGHIKIADFGMCKEN+    TTKTFCGTPDYIAPEII YQPY KSVDWWAFG+LLYEMLAGQ PF+GEDE++LF SI  HNV++P+SMS+EAV IC+GLMTK   KRLGCG  G R I++H FFR I+W+K+E  EIQPPYKPK
Sbjct:  229 LKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELLKAGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEELRQKFERAKIGPGTKAVEE-KVVNPMPKVDNNGTRDRMKVSDFNFLKVLGKGSFGKVILAERKGTDELYAIKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYQIQQVGRFKEPHAVFYAAEIAIGLLFLHSKGIVYRDLKLDNVMLDSEGHIKIADFGMCKENMWDGVTTKTFCGTPDYIAPEIIAYQPYAKSVDWWAFGILLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKDHAFFRYIDWEKLERNEIQPPYKPK 618          

HSP 2 Score: 51.9878 bits (123), Expect = 4.688e-6
Identity = 25/54 (46.30%), Postives = 32/54 (59.26%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVE 2222
            P   K   R+  NFDK FT+    +TP D   I N+DQ+EF GFS+VN +F  E
Sbjct:  614 PYKPKACGRNAENFDKFFTRHPPVLTPPDHEVIRNIDQSEFEGFSYVNSDFAKE 667          
BLAST of Protein kinase C vs. Ensembl Xenopus
Match: prkcb (protein kinase C beta [Source:NCBI gene;Acc:100038043])

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 275/391 (70.33%), Postives = 318/391 (81.33%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSK------QDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            L + D  RRLSVE+WDWD T+RNDFMGSLSFG+SEL+   V+ WFKLLSQEEGE++ + V  E      +LR +FERA      +  +   V  P+ K      +D  + SDFNFL VLGKGSFGKV+L ERKGTDELYAIKILKKDV+IQDDD+ECTM+EKRVLAL GKPP L QLHSCFQTMDRLYFVMEYVNGGDLMY+IQQ G+FKEP AVFY+AEIA+GL+FLH+ GI+YRDLKLDNV+LDSEGHIKIADFGMCKEN+    TTKTFCGTPDYIAPEII YQPY KSVDWWAFG+LLYEMLAGQ PF+GEDE++LF SI  HNV++P+SMS+EAV IC+GLMTK   KRLGCG  G R I++H FFR I+W+K+E  EIQPPYKPK
Sbjct:  225 LKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELLKAGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEELRQKFERAKIGPGTKAVEE-KVVNPMPKVDNNGTRDRMKVSDFNFLKVLGKGSFGKVILAERKGTDELYAIKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYQIQQVGRFKEPHAVFYAAEIAIGLLFLHSKGIVYRDLKLDNVMLDSEGHIKIADFGMCKENMWDGVTTKTFCGTPDYIAPEIIAYQPYAKSVDWWAFGILLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKDHAFFRYIDWEKLERNEIQPPYKPK 614          

HSP 2 Score: 51.9878 bits (123), Expect = 4.480e-6
Identity = 25/54 (46.30%), Postives = 32/54 (59.26%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVE 2222
            P   K   R+  NFDK FT+    +TP D   I N+DQ+EF GFS+VN +F  E
Sbjct:  610 PYKPKACGRNAENFDKFFTRHPPVLTPPDHEVIRNIDQSEFEGFSYVNSDFAKE 663          
BLAST of Protein kinase C vs. Ensembl Xenopus
Match: prkcb (protein kinase C beta [Source:NCBI gene;Acc:100038043])

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 275/391 (70.33%), Postives = 318/391 (81.33%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSK------QDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            L + D  RRLSVE+WDWD T+RNDFMGSLSFG+SEL+   V+ WFKLLSQEEGE++ + V  E      +LR +FERA      +  +   V  P+ K      +D  + SDFNFL VLGKGSFGKV+L ERKGTDELYAIKILKKDV+IQDDD+ECTM+EKRVLAL GKPP L QLHSCFQTMDRLYFVMEYVNGGDLMY+IQQ G+FKEP AVFY+AEIA+GL+FLH+ GI+YRDLKLDNV+LDSEGHIKIADFGMCKEN+    TTKTFCGTPDYIAPEII YQPY KSVDWWAFG+LLYEMLAGQ PF+GEDE++LF SI  HNV++P+SMS+EAV IC+GLMTK   KRLGCG  G R I++H FFR I+W+K+E  EIQPPYKPK
Sbjct:  225 LKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELLKAGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEELRQKFERAKIGPGTKAVEE-KVVNPMPKVDNNGTRDRMKVSDFNFLKVLGKGSFGKVILAERKGTDELYAIKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYQIQQVGRFKEPHAVFYAAEIAIGLLFLHSKGIVYRDLKLDNVMLDSEGHIKIADFGMCKENMWDGVTTKTFCGTPDYIAPEIIAYQPYAKSVDWWAFGILLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKDHAFFRYIDWEKLERNEIQPPYKPK 614          

HSP 2 Score: 51.9878 bits (123), Expect = 4.636e-6
Identity = 25/54 (46.30%), Postives = 32/54 (59.26%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVE 2222
            P   K   R+  NFDK FT+    +TP D   I N+DQ+EF GFS+VN +F  E
Sbjct:  610 PYKPKACGRNAENFDKFFTRHPPVLTPPDHEVIRNIDQSEFEGFSYVNSDFAKE 663          
BLAST of Protein kinase C vs. Ensembl Xenopus
Match: prkcb (protein kinase C beta [Source:NCBI gene;Acc:100038043])

HSP 1 Score: 565.459 bits (1456), Expect = 0.000e+0
Identity = 275/391 (70.33%), Postives = 318/391 (81.33%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSK------QDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            L + D  RRLSVE+WDWD T+RNDFMGSLSFG+SEL+   V+ WFKLLSQEEGE++ + V  E      +LR +FERA      +  +   V  P+ K      +D  + SDFNFL VLGKGSFGKV+L ERKGTDELYAIKILKKDV+IQDDD+ECTM+EKRVLAL GKPP L QLHSCFQTMDRLYFVMEYVNGGDLMY+IQQ G+FKEP AVFY+AEIA+GL+FLH+ GI+YRDLKLDNV+LDSEGHIKIADFGMCKEN+    TTKTFCGTPDYIAPEII YQPY KSVDWWAFG+LLYEMLAGQ PF+GEDE++LF SI  HNV++P+SMS+EAV IC+GLMTK   KRLGCG  G R I++H FFR I+W+K+E  EIQPPYKPK
Sbjct:  228 LKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELLKAGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEELRQKFERAKIGPGTKAVEE-KVVNPMPKVDNNGTRDRMKVSDFNFLKVLGKGSFGKVILAERKGTDELYAIKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYQIQQVGRFKEPHAVFYAAEIAIGLLFLHSKGIVYRDLKLDNVMLDSEGHIKIADFGMCKENMWDGVTTKTFCGTPDYIAPEIIAYQPYAKSVDWWAFGILLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKDHAFFRYIDWEKLERNEIQPPYKPK 617          

HSP 2 Score: 51.9878 bits (123), Expect = 4.412e-6
Identity = 25/54 (46.30%), Postives = 32/54 (59.26%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVE 2222
            P   K   R+  NFDK FT+    +TP D   I N+DQ+EF GFS+VN +F  E
Sbjct:  613 PYKPKACGRNAENFDKFFTRHPPVLTPPDHEVIRNIDQSEFEGFSYVNSDFAKE 666          
BLAST of Protein kinase C vs. Ensembl Mouse
Match: Prkca (protein kinase C, alpha [Source:MGI Symbol;Acc:MGI:97595])

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 276/387 (71.32%), Postives = 320/387 (82.69%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTS--VTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            L   D  RRLSVE+WDWDRTTRNDFMGSLSFGVSEL+  P + W+KLL+QEEGE+Y + + E      M+LR +FE+A       K  S S     P +  D  + +DFNFL+VLGKGSFGKVML +RKGT+ELYAIKILKKDV+IQDDD+ECTM+EKRVLAL  KPP L QLHSCFQT+DRLYFVMEYVNGGDLMY IQQ GKFKEP AVFY+AEI++GL FLH  GIIYRDLKLDNV+LDSEGHIKIADFGMCKE+++   TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GVLLYEMLAGQPPFDGEDE++LF SI  HNVS+P+S+S+EAV+IC+GLMTK   KRLGCG  G R ++EH FFRRI+W+K+E REIQPP+KPK
Sbjct:  231 LKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPK 617          

HSP 2 Score: 56.9954 bits (136), Expect = 8.711e-8
Identity = 26/52 (50.00%), Postives = 35/52 (67.31%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            P   K   +   NFDK FT+ Q  +TP D+L I N+DQ++F GFS+VNP+FV
Sbjct:  613 PFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFV 664          
BLAST of Protein kinase C vs. Ensembl Mouse
Match: Prkcb (protein kinase C, beta [Source:MGI Symbol;Acc:MGI:97596])

HSP 1 Score: 573.933 bits (1478), Expect = 0.000e+0
Identity = 279/394 (70.81%), Postives = 320/394 (81.22%), Query Frame = 1
Query:  913 RHDLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSK------QDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            R  L + D  RRLSVE+WDWD T+RNDFMGSLSFG+SEL    V+ WFKLLSQEEGE++ + V  E S    +LR +FERA      +  +  +    +SK      +D  + +DFNFL+VLGKGSFGKVML+ERKGTDELYA+KILKKDV+IQDDD+ECTM+EKRVLAL GKPP L QLHSCFQTMDRLYFVMEYVNGGDLMY IQQ G+FKEP AVFY+AEIA+GL FL + GIIYRDLKLDNV+LDSEGHIKIADFGMCKENI    TTKTFCGTPDYIAPEII YQPYGKSVDWWAFGVLLYEMLAGQ PF+GEDE++LF SI  HNV++P+SMS+EAV IC+GLMTK   KRLGCG  G R I+EH FFR I+W+K+E +EIQPPYKPK
Sbjct:  228 RFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEELRQKFERAKIGQGTKAPEEKTANT-ISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPK 620          

HSP 2 Score: 78.5666 bits (192), Expect = 1.649e-14
Identity = 35/50 (70.00%), Postives = 43/50 (86.00%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVEV 2225
            ++KRD SNFDK FT++  ++TPTDKLFIMNLDQ EFAGFS+ NPEFV+ V
Sbjct:  622 RDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV 671          
BLAST of Protein kinase C vs. Ensembl Mouse
Match: Prkcb (protein kinase C, beta [Source:MGI Symbol;Acc:MGI:97596])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 279/394 (70.81%), Postives = 320/394 (81.22%), Query Frame = 1
Query:  913 RHDLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSK------QDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            R  L + D  RRLSVE+WDWD T+RNDFMGSLSFG+SEL    V+ WFKLLSQEEGE++ + V  E S    +LR +FERA      +  +  +    +SK      +D  + +DFNFL+VLGKGSFGKVML+ERKGTDELYA+KILKKDV+IQDDD+ECTM+EKRVLAL GKPP L QLHSCFQTMDRLYFVMEYVNGGDLMY IQQ G+FKEP AVFY+AEIA+GL FL + GIIYRDLKLDNV+LDSEGHIKIADFGMCKENI    TTKTFCGTPDYIAPEII YQPYGKSVDWWAFGVLLYEMLAGQ PF+GEDE++LF SI  HNV++P+SMS+EAV IC+GLMTK   KRLGCG  G R I+EH FFR I+W+K+E +EIQPPYKPK
Sbjct:  228 RFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEELRQKFERAKIGQGTKAPEEKTANT-ISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPK 620          

HSP 2 Score: 52.7582 bits (125), Expect = 1.590e-6
Identity = 25/52 (48.08%), Postives = 33/52 (63.46%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            P   K   R+  NFD+ FT+    +TP D+  I N+DQ+EF GFSFVN EF+
Sbjct:  616 PYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFSFVNSEFL 667          
BLAST of Protein kinase C vs. Ensembl Mouse
Match: Prkcb (protein kinase C, beta [Source:MGI Symbol;Acc:MGI:97596])

HSP 1 Score: 573.548 bits (1477), Expect = 0.000e+0
Identity = 279/394 (70.81%), Postives = 320/394 (81.22%), Query Frame = 1
Query:  913 RHDLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSK------QDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            R  L + D  RRLSVE+WDWD T+RNDFMGSLSFG+SEL    V+ WFKLLSQEEGE++ + V  E S    +LR +FERA      +  +  +    +SK      +D  + +DFNFL+VLGKGSFGKVML+ERKGTDELYA+KILKKDV+IQDDD+ECTM+EKRVLAL GKPP L QLHSCFQTMDRLYFVMEYVNGGDLMY IQQ G+FKEP AVFY+AEIA+GL FL + GIIYRDLKLDNV+LDSEGHIKIADFGMCKENI    TTKTFCGTPDYIAPEII YQPYGKSVDWWAFGVLLYEMLAGQ PF+GEDE++LF SI  HNV++P+SMS+EAV IC+GLMTK   KRLGCG  G R I+EH FFR I+W+K+E +EIQPPYKPK
Sbjct:  228 RFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEELRQKFERAKIGQGTKAPEEKTANT-ISKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPK 620          

HSP 2 Score: 52.7582 bits (125), Expect = 1.590e-6
Identity = 25/52 (48.08%), Postives = 33/52 (63.46%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            P   K   R+  NFD+ FT+    +TP D+  I N+DQ+EF GFSFVN EF+
Sbjct:  616 PYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFSFVNSEFL 667          
BLAST of Protein kinase C vs. Ensembl Mouse
Match: Prkcg (Protein kinase C gamma type [Source:UniProtKB/Swiss-Prot;Acc:P63318])

HSP 1 Score: 494.197 bits (1271), Expect = 3.268e-164
Identity = 256/405 (63.21%), Postives = 308/405 (76.05%), Query Frame = 1
Query:  919 DLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIM---DLRNRFXXXXXXXXXXXXXXTSVTMPVSKQDIPRC-----------SDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPP-----MLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            +L   D+ RRLSVEVWDWDRT+RNDFMG++SFGVSEL+  PV+ W+KLL+QEEGE+Y + V +  + +++   +  N         R   S S   +   S  D  RC           SDF+FL+VLGKGSFGKVML ER+G+DELYAIKILKKDVI+QDDD++CT++EKRVLAL G+ P      L QLHS FQT DRLYFVMEYV GGDLMY IQQ GKFKEP A FY+AEIA+GL FLHN GIIYRDLKLDNV+LD+EGHIKI DFGMCKEN+   STT+TFCGTPDYIAPEII YQPYGKSVDWW+FGVLLYEMLAGQPPFDGEDEE+LF +I    V++P+S+SREAV IC+G +TK   KRLG G +G   I+ H FFR I+W+++E  EI PP++P+
Sbjct:  230 NLKPGDVERRLSVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQKFEACNYPLELYERVRMGPSSSPIPSPSPSPTDSKRCFFGASPGRLHISDFSFLMVLGKGSFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQLHSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRDLKLDNVMLDAEGHIKITDFGMCKENVFPGSTTRTFCGTPDYIAPEIIAYQPYGKSVDWWSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPGKRLGSGPDGEPTIRAHGFFRWIDWERLERLEIAPPFRPR 634          

HSP 2 Score: 53.1434 bits (126), Expect = 1.281e-6
Identity = 22/54 (40.74%), Postives = 34/54 (62.96%), Query Frame = 3
Query: 2055 SAPI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            + P   +   R   NFDK FT+    +TP D+L + ++DQ +F GF++VNP+FV
Sbjct:  628 APPFRPRPCGRSGENFDKFFTRAAPALTPPDRLVLASIDQADFQGFTYVNPDFV 681          
BLAST of Protein kinase C vs. UniProt/SwissProt
Match: sp|Q16974|KPC1_APLCA (Calcium-dependent protein kinase C OS=Aplysia californica OX=6500 GN=PRKC1 PE=1 SV=2)

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 286/386 (74.09%), Postives = 338/386 (87.56%), Query Frame = 1
Query:  919 DLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            D+  ED S+RLS+EVWDWDRT+RNDFMGSLSFG+SEL+  PV  WFKLL+QEEGEFY + VT++ + +I +++++  R+S  S +R  +   V   +SKQDI R SDFNFL VLGKGSFGKV+L ERKGTDELYAIKILKKDVIIQDDD+ECTMIEKRVLAL  KPP LVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVA FY+AEIA+GL +LH  GI+YRDLKLDNV+LD+EGHIKIADFGMCKENI+G+ TT+TFCGTPDYIAPEI+ YQPYG+SVDWWA+GVLLYEMLAGQPPFDGEDEE+LF SIT+HNVS+P+++SREAV++C+GL+TK   KRLGCG NG R I++  FFR I+W++IELRE+QPPYKP+
Sbjct:  214 DIGPEDNSKRLSLEVWDWDRTSRNDFMGSLSFGISELIKSPVEGWFKLLNQEEGEFYGVPVTDDITESIQEIKSKMHRSSISSEKRYPEPDKVQN-MSKQDIVRASDFNFLTVLGKGSFGKVVLAERKGTDELYAIKILKKDVIIQDDDVECTMIEKRVLALPDKPPFLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAAFYAAEIAIGLFYLHTQGIVYRDLKLDNVMLDAEGHIKIADFGMCKENIMGDKTTRTFCGTPDYIAPEIVLYQPYGRSVDWWAYGVLLYEMLAGQPPFDGEDEEELFTSITDHNVSYPKALSREAVSLCKGLLTKTPAKRLGCGPNGERDIKDRAFFRPIQWERIELREVQPPYKPR 598          

HSP 2 Score: 78.9518 bits (193), Expect = 8.698e-14
Identity = 36/50 (72.00%), Postives = 43/50 (86.00%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVEV 2225
            K+++DVSNFD+ FT E   +TPTDKLFIMNLDQ EF+GFS+VNPEFVV V
Sbjct:  600 KSRKDVSNFDREFTSEAPNVTPTDKLFIMNLDQCEFSGFSYVNPEFVVTV 649          
BLAST of Protein kinase C vs. UniProt/SwissProt
Match: sp|P17252|KPCA_HUMAN (Protein kinase C alpha type OS=Homo sapiens OX=9606 GN=PRKCA PE=1 SV=4)

HSP 1 Score: 577.785 bits (1488), Expect = 0.000e+0
Identity = 275/387 (71.06%), Postives = 320/387 (82.69%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTS--VTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            L   D  RRLSVE+WDWDRTTRNDFMGSLSFGVSEL+  P + W+KLL+QEEGE+Y + + E      M+LR +FE+A       K  S S     P +  D  + +DFNFL+VLGKGSFGKVML +RKGT+ELYAIKILKKDV+IQDDD+ECTM+EKRVLAL  KPP L QLHSCFQT+DRLYFVMEYVNGGDLMY IQQ GKFKEP AVFY+AEI++GL FLH  GIIYRDLKLDNV+LDSEGHIKIADFGMCKE+++   TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GVLLYEMLAGQPPFDGEDE++LF SI  HNVS+P+S+S+EAV++C+GLMTK   KRLGCG  G R ++EH FFRRI+W+K+E REIQPP+KPK
Sbjct:  231 LKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNMELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSVCKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPK 617          

HSP 2 Score: 56.9954 bits (136), Expect = 5.938e-7
Identity = 26/52 (50.00%), Postives = 35/52 (67.31%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            P   K   +   NFDK FT+ Q  +TP D+L I N+DQ++F GFS+VNP+FV
Sbjct:  613 PFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFV 664          
BLAST of Protein kinase C vs. UniProt/SwissProt
Match: sp|P05771|KPCB_HUMAN (Protein kinase C beta type OS=Homo sapiens OX=9606 GN=PRKCB PE=1 SV=4)

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 282/394 (71.57%), Postives = 322/394 (81.73%), Query Frame = 1
Query:  913 RHDLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSK------QDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            R  L + D  RRLSVE+WDWD T+RNDFMGSLSFG+SEL    V+ WFKLLSQEEGE++ + V  E S A  +LR +FERA      +  +  + T  VSK      +D  + +DFNFL+VLGKGSFGKVML+ERKGTDELYA+KILKKDV+IQDDD+ECTM+EKRVLAL GKPP L QLHSCFQTMDRLYFVMEYVNGGDLMY IQQ G+FKEP AVFY+AEIA+GL FL + GIIYRDLKLDNV+LDSEGHIKIADFGMCKENI    TTKTFCGTPDYIAPEII YQPYGKSVDWWAFGVLLYEMLAGQ PF+GEDE++LF SI  HNV++P+SMS+EAV IC+GLMTK   KRLGCG  G R I+EH FFR I+W+K+E +EIQPPYKPK
Sbjct:  228 RFQLKESDKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEELRQKFERAKISQGTKVPEEKT-TNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHIKIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAPFEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYIDWEKLERKEIQPPYKPK 620          

HSP 2 Score: 78.5666 bits (192), Expect = 1.134e-13
Identity = 35/50 (70.00%), Postives = 43/50 (86.00%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVEV 2225
            ++KRD SNFDK FT++  ++TPTDKLFIMNLDQ EFAGFS+ NPEFV+ V
Sbjct:  622 RDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVINV 671          
BLAST of Protein kinase C vs. UniProt/SwissProt
Match: sp|P05696|KPCA_RAT (Protein kinase C alpha type OS=Rattus norvegicus OX=10116 GN=Prkca PE=1 SV=3)

HSP 1 Score: 576.63 bits (1485), Expect = 0.000e+0
Identity = 275/387 (71.06%), Postives = 320/387 (82.69%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTS--VTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            L   D  RRLSVE+WDWDRTTRNDFMGSLSFGVSEL+  P + W+KLL+QEEGE+Y + + E      ++LR +FE+A       K  S S     P +  D  + +DFNFL+VLGKGSFGKVML +RKGT+ELYAIKILKKDV+IQDDD+ECTM+EKRVLAL  KPP L QLHSCFQT+DRLYFVMEYVNGGDLMY IQQ GKFKEP AVFY+AEI++GL FLH  GIIYRDLKLDNV+LDSEGHIKIADFGMCKE+++   TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GVLLYEMLAGQPPFDGEDE++LF SI  HNVS+P+S+S+EAV+IC+GLMTK   KRLGCG  G R ++EH FFRRI+W+K+E REIQPP+KPK
Sbjct:  231 LKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPK 617          

HSP 2 Score: 56.9954 bits (136), Expect = 6.198e-7
Identity = 26/52 (50.00%), Postives = 35/52 (67.31%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            P   K   +   NFDK FT+ Q  +TP D+L I N+DQ++F GFS+VNP+FV
Sbjct:  613 PFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVNPQFV 664          
BLAST of Protein kinase C vs. UniProt/SwissProt
Match: sp|P10102|KPCA_RABIT (Protein kinase C alpha type OS=Oryctolagus cuniculus OX=9986 GN=PRKCA PE=2 SV=3)

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 275/387 (71.06%), Postives = 320/387 (82.69%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTS--VTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            L   D  RRLSVE+WDWDRTTRNDFMGSLSFGVSEL+  P + W+KLL+QEEGE+Y + + E      ++LR +FE+A       K  S S     P +  D  + +DFNFL+VLGKGSFGKVML +RKGT+ELYAIKILKKDV+IQDDD+ECTM+EKRVLAL  KPP L QLHSCFQT+DRLYFVMEYVNGGDLMY IQQ GKFKEP AVFY+AEI++GL FLH  GIIYRDLKLDNV+LDSEGHIKIADFGMCKE+++   TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GVLLYEMLAGQPPFDGEDE++LF SI  HNVS+P+S+S+EAV+IC+GLMTK   KRLGCG  G R ++EH FFRRI+W+K+E REIQPP+KPK
Sbjct:  231 LKPSDKDRRLSVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEDGNVELRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALMDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPK 617          

HSP 2 Score: 56.6102 bits (135), Expect = 9.272e-7
Identity = 26/52 (50.00%), Postives = 35/52 (67.31%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            P   K   +   NFDK FT+ Q  +TP D+L I N+DQ++F GFS+VNP+FV
Sbjct:  613 PFKPKVCGKGAENFDKFFTRGQPVVTPPDQLVIANIDQSDFEGFSYVNPQFV 664          
BLAST of Protein kinase C vs. TrEMBL
Match: A0A0L8GWM2 (Non-specific serine/threonine protein kinase OS=Octopus bimaculoides OX=37653 GN=OCBIM_22026627mg PE=3 SV=1)

HSP 1 Score: 617.461 bits (1591), Expect = 0.000e+0
Identity = 289/386 (74.87%), Postives = 334/386 (86.53%), Query Frame = 1
Query:  919 DLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            +++ ED+S+RLS EVWDWDRTTRNDFMGSLSFG+SEL+  PV+ WFKLL+QEEGE+Y I V +E S +I +++N+FE+     R   S      M  SKQD+ R SDFNF+ VLGKGSFGKV+L ERK TDELYAIKILKKDVIIQDDD+ECTMIEKRVLAL  KPP LVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFY+AEIA+GL +LHN GI+YRDLKLDNV+LD EGHIKIADFGMCKE I+ + TT+TFCGTPDYIAPEI+ YQPYGKSVDWWA+GVLLYEMLAGQPPFDGEDEE+LF SIT+HNVS+P+SMSREAV+IC+GL+TK  +KRLGC  NG R I++H FFRRI+W K+E R++QPPYKPK
Sbjct:   45 EIAPEDMSKRLSFEVWDWDRTTRNDFMGSLSFGISELIKNPVDGWFKLLNQEEGEYYGIPVPDELSPSIQEMKNKFEKQQIAERNLPSSLNDQNM--SKQDLVRASDFNFMTVLGKGSFGKVVLAERKSTDELYAIKILKKDVIIQDDDVECTMIEKRVLALANKPPFLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYAAEIAIGLFYLHNEGIVYRDLKLDNVMLDCEGHIKIADFGMCKEGIILDKTTRTFCGTPDYIAPEIVLYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEEELFTSITDHNVSYPKSMSREAVSICKGLLTKNPSKRLGCTNNGERDIKDHAFFRRIDWAKVESRDVQPPYKPK 428          
BLAST of Protein kinase C vs. TrEMBL
Match: A0A3S0ZSD3 (Uncharacterized protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_018152 PE=3 SV=1)

HSP 1 Score: 613.994 bits (1582), Expect = 0.000e+0
Identity = 292/410 (71.22%), Postives = 342/410 (83.41%), Query Frame = 1
Query:  919 DLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPKKISVTLAISISYLQRNSTK*LQPT 2148
            +L  +D ++RLS+EVWDWDRT+RNDFMGSLSFG+SEL+  P   WFKLLSQEEGEFY + V+++ +  I +L+++  R+S   R+        +  +SKQDI R SDFNFL VLGKGSFGKV+L ERKGTDELYAIKILKKDVIIQDDD+ECTMIEKRVLAL  KPP LVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQE KFKEPVA FY+AEIA+GL +LH+ GI+YRDLKLDNV+LD+EGHIKIADFGMCKENIVG+ TT+TFCGTPDYIAPEI+ YQPYGKSVDWWA+GVLLYEMLAGQPPFDGEDEE+LF SIT+HNVS+P+++SREAV++C+GL+TK   KRLGCG  G R I++H FFRRI W+KIELRE+QPPYKPK  +   A +       ST  L PT
Sbjct:  136 ELGPDDHAKRLSLEVWDWDRTSRNDFMGSLSFGISELIKAPSEGWFKLLSQEEGEFYGVPVSDDITEDIRELKSKMHRSSISERKIPDHDKLTS--ISKQDIVRASDFNFLTVLGKGSFGKVVLAERKGTDELYAIKILKKDVIIQDDDVECTMIEKRVLALPDKPPFLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQESKFKEPVAAFYAAEIAIGLFYLHSQGIVYRDLKLDNVMLDAEGHIKIADFGMCKENIVGDKTTRTFCGTPDYIAPEIVLYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEEELFTSITDHNVSYPKALSREAVSLCKGLLTKTPAKRLGCGPTGERDIKDHAFFRRIVWEKIELREVQPPYKPKITNRRKAENFDRAFTKSTMKLTPT 543          
BLAST of Protein kinase C vs. TrEMBL
Match: A0A267G679 (Protein kinase C OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019218g1 PE=3 SV=1)

HSP 1 Score: 612.453 bits (1578), Expect = 0.000e+0
Identity = 301/440 (68.41%), Postives = 352/440 (80.00%), Query Frame = 1
Query:  835 PAVKRMVLQDDAKG**NTAVMDGLLAR-------HDLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVS-KQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPKKISVTLAISISYLQRNST 2130
            P VK  +L DD+     T V+   L          DL KED  +RLS+EVWDWDRT+RNDFMG++SFG+SELV  PV  WFKLL+QEEGEFY I   +E +A + +LR +FE+A A+ +E K+K  +     + KQDIPR +DFNFL++LGKGSFGKV+L ERKGT E+YAIKILKKDVIIQDDDIECTMIEKRVLAL  KPP LVQLHSCFQTMDRLYFVME+VNGGDLMYRIQQEG+FKEPVA FY+AEIA+GL FLH  GIIYRDLKLDNVLLDSEGHIKIADFGMCKENI    TTKTFCGTPDYIAPEII YQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEE+LF +IT+HNVS+P+ MS+EAV IC+G +TK+  KRLGC   G R+I++HVFFRRI+WD++  R++QPP+KP+   +  A  +S   R  T
Sbjct:  188 PYVKLKLLPDDSNSKKKTRVIKATLNPVWNEKLVFDLRKEDFGKRLSIEVWDWDRTSRNDFMGAMSFGISELVKAPVTGWFKLLNQEEGEFYNIPCPDEITANVQELRTKFEKARADEKEEKAKLAAAQGGQAVKQDIPRSTDFNFLMLLGKGSFGKVLLAERKGTTEIYAIKILKKDVIIQDDDIECTMIEKRVLALAEKPPFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGRFKEPVAAFYAAEIAIGLFFLHTKGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIFDGDTTKTFCGTPDYIAPEIILYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEELFTAITDHNVSYPKVMSKEAVTICKGFLTKDTKKRLGCSPAGEREIRDHVFFRRIDWDRVASRDVQPPFKPR---IKSARDVSNFDRQFT 624          

HSP 2 Score: 81.6481 bits (200), Expect = 3.629e-12
Identity = 37/50 (74.00%), Postives = 44/50 (88.00%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVEV 2225
            K+ RDVSNFD+ FT E  ++TPTDKLFIMNLDQTEF GFS+VNPEF+V+V
Sbjct:  611 KSARDVSNFDRQFTDEAAKLTPTDKLFIMNLDQTEFTGFSYVNPEFIVDV 660          
BLAST of Protein kinase C vs. TrEMBL
Match: A0A2C9JQJ2 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106063800 PE=4 SV=1)

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 283/386 (73.32%), Postives = 336/386 (87.05%), Query Frame = 1
Query:  919 DLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            D+  +D ++RLS+EVWDWDRT+RNDFMGSLSFG+SEL+  P++ WFKLL+QEEGEFY + V+++ +  I +++++  R+S   R+        +  +SKQDI R SDFNFL VLGKGSFGKV+L ERKGTDELYAIKILKKDVIIQDDD+ECTMIEKRVLAL  KPP LVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVA FY+AEIA+GL +LH+ GI+YRDLKLDNV+LD+EGHIKIADFGMCKENI+G+ TT+TFCGTPDYIAPEI+ YQPYGKSVDWWA+GVLLYEMLAGQPPFDGEDEE+LF SIT+HNVS+P+++SREAV++C+GL+TK   KRLGCG  G R I++H FFRRI W+KIE RE+QPPYKPK
Sbjct:   45 DVGPDDHAKRLSLEVWDWDRTSRNDFMGSLSFGISELIKAPIDGWFKLLNQEEGEFYGVPVSDDITEDIQEIKSKMHRSSISERKYPEPDKLQS--ISKQDIVRASDFNFLTVLGKGSFGKVVLAERKGTDELYAIKILKKDVIIQDDDVECTMIEKRVLALPVKPPFLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAAFYAAEIAIGLFYLHSQGIVYRDLKLDNVMLDAEGHIKIADFGMCKENILGDKTTRTFCGTPDYIAPEIVLYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEEELFTSITDHNVSYPKALSREAVSLCKGLLTKTPTKRLGCGPTGERDIKDHAFFRRIVWEKIEQREVQPPYKPK 428          
BLAST of Protein kinase C vs. TrEMBL
Match: A0A2C9JQI3 (Non-specific serine/threonine protein kinase OS=Biomphalaria glabrata OX=6526 GN=106063800 PE=3 SV=1)

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 283/386 (73.32%), Postives = 335/386 (86.79%), Query Frame = 1
Query:  919 DLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            D+  +D ++RLS+EVWDWDRT+RNDFMGSLSFG+SEL+  P++ WFKLL+QEEGEFY + V+++ +  I +++++  R+S   R+           +SKQDI R SDFNFL VLGKGSFGKV+L ERKGTDELYAIKILKKDVIIQDDD+ECTMIEKRVLAL  KPP LVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVA FY+AEIA+GL +LH+ GI+YRDLKLDNV+LD+EGHIKIADFGMCKENI+G+ TT+TFCGTPDYIAPEI+ YQPYGKSVDWWA+GVLLYEMLAGQPPFDGEDEE+LF SIT+HNVS+P+++SREAV++C+GL+TK   KRLGCG  G R I++H FFRRI W+KIE RE+QPPYKPK
Sbjct:   45 DVGPDDHAKRLSLEVWDWDRTSRNDFMGSLSFGISELIKAPIDGWFKLLNQEEGEFYGVPVSDDITEDIQEIKSKMHRSSISERKYPEPDK--LQSISKQDIVRASDFNFLTVLGKGSFGKVVLAERKGTDELYAIKILKKDVIIQDDDVECTMIEKRVLALPVKPPFLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAAFYAAEIAIGLFYLHSQGIVYRDLKLDNVMLDAEGHIKIADFGMCKENILGDKTTRTFCGTPDYIAPEIVLYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEEELFTSITDHNVSYPKALSREAVSLCKGLLTKTPTKRLGCGPTGERDIKDHAFFRRIVWEKIEQREVQPPYKPK 428          

HSP 2 Score: 80.1073 bits (196), Expect = 7.368e-12
Identity = 36/50 (72.00%), Postives = 44/50 (88.00%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVEV 2225
            K+++DVSNFD+ FT E  ++TPTDKLFIMNLDQ EF+GFS+VNPEFVV V
Sbjct:  430 KSRKDVSNFDREFTSEAPKLTPTDKLFIMNLDQCEFSGFSYVNPEFVVTV 479          
BLAST of Protein kinase C vs. Ensembl Cavefish
Match: prkcba (protein kinase C beta [Source:NCBI gene;Acc:103036012])

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 275/391 (70.33%), Postives = 325/391 (83.12%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSK------QDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            L + D +RRLSVEVWDWD T+RNDFMGSLSFG+SEL  K V+ W+KLL QEEGE++ + V  +      +LR +FERA      + + S+S +  +SK      QD  + SDFNF++VLGKGSFGKVML ERKGTDELYA+KILKKDV+IQDDD+ECTM+EKRVLAL GKPP L QLHSCFQTMDRLYFVMEY+NGGDLMY+IQQ GKFKEP AVFY+AEIA+GL FLH+ GIIYRDLKLDNV+LD+EGHIKIADFGMCKEN++   TTKTFCGTPDYIAPEII YQPYGKSVDWWA+GVLLYEMLAGQPPFDGEDE++LF SI  H+VS+P+SMS+EAV IC+GLMTK   KRLGCG  G R I+EH FFR ++W+K++ +E+QPP+KPK
Sbjct:  230 LRETDNNRRLSVEVWDWDLTSRNDFMGSLSFGISELQKKGVSGWYKLLGQEEGEYFNVPVQPDGEEGNDELRQKFERARIGPGNKNTDSSS-SNDISKYDANGNQDRVKLSDFNFVMVLGKGSFGKVMLAERKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTMDRLYFVMEYINGGDLMYQIQQVGKFKEPHAVFYAAEIAIGLFFLHSKGIIYRDLKLDNVMLDAEGHIKIADFGMCKENMLDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFFRYMDWEKLQNKEVQPPFKPK 619          

HSP 2 Score: 58.5362 bits (140), Expect = 2.341e-8
Identity = 26/54 (48.15%), Postives = 34/54 (62.96%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVE 2222
            P   K   RD  NFD+ FT+    +TP D+  I+NLDQ EF GFS+VNPE+  +
Sbjct:  615 PFKPKACGRDAENFDRFFTRHPPVLTPPDQEVILNLDQEEFQGFSYVNPEYAAQ 668          
BLAST of Protein kinase C vs. Ensembl Cavefish
Match: prkcbb (protein kinase C beta type [Source:NCBI gene;Acc:103025973])

HSP 1 Score: 571.237 bits (1471), Expect = 0.000e+0
Identity = 276/390 (70.77%), Postives = 321/390 (82.31%), Query Frame = 1
Query:  919 DLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPV----SKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            +L   D  RRLSVE+WDWD T+RNDFMGSLSFG+SEL  + V+ WFKLLSQEEGE++ + V  E      +LR +FERA   +  + + S+S  +        +D  + SDFNFL+VLGKGSFGKVML ERKGTDEL+AIK+LKKDV+IQDDD+ECTM+EKRVLAL GKPP L QLHSCFQTMDRLYFVMEY+NGGDLMY+IQQ GKFKEP AVFYSAEIA+GL FLH  GIIYRDLKLDNV+LD+EGHIKIADFGMCKEN+    TTKTFCGTPDYIAPEII YQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDE++LF SI  H+VS+P+SMS+EAV IC+GLMTK   KRLGCG  G R I+EH FFR ++W+K+E +E+QPP+KPK
Sbjct:  228 NLKDADKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKQGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEELRQKFERAKIGAGTKNTDSSSNAISKFDSNGNRDRMKLSDFNFLMVLGKGSFGKVMLAERKGTDELFAIKVLKKDVVIQDDDVECTMVEKRVLALAGKPPFLTQLHSCFQTMDRLYFVMEYINGGDLMYQIQQVGKFKEPHAVFYSAEIAIGLFFLHTKGIIYRDLKLDNVMLDAEGHIKIADFGMCKENMSEGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIREHGFFRYMDWEKLENKEVQPPFKPK 617          

HSP 2 Score: 58.5362 bits (140), Expect = 2.365e-8
Identity = 27/51 (52.94%), Postives = 33/51 (64.71%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEF 2213
            P   K   RD  NFD+ FT+    +TP D+  IMNLDQ EF GFSF+NPE+
Sbjct:  613 PFKPKACGRDAENFDRFFTRHPPVLTPPDQEVIMNLDQDEFEGFSFINPEY 663          
BLAST of Protein kinase C vs. Ensembl Cavefish
Match: prkcaa (protein kinase C, alpha, a [Source:ZFIN;Acc:ZDB-GENE-050208-100])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 268/389 (68.89%), Postives = 318/389 (81.75%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXT----SVTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            L  +D  RRLSVE+WDWDRTTRNDFMG++SFGVSEL+  P + W+K+L+QEEGE+Y + ++EE      +LR +FE+A     ++    T      ++P S  D  +  DFNFL VLGKGSFGKVML E K ++ELYAIKILKKDV+IQDDD+ECTM+EKRVLA Q KPP L QLHSCFQT+DRLYFVMEYVNGGDLMY IQQ GKFKEP AVFY+AEIAVGL FLH  G+IYRDLKLDNV+LD+EGHIKIADFGMCKENI    TT+TFCGTPDYIAPEII YQPYG+SVDWWA+GVLLYEMLAGQPPFDGEDE++LF SI  HNVS+P+++S+EAV+IC+GLMTK   KRLGC   G R I+EH FFRRI+W+++E RE+QPP+KPK
Sbjct:  204 LRAQDKDRRLSVEIWDWDRTTRNDFMGAMSFGVSELIKAPASGWYKMLNQEEGEYYNVPISEEDDGND-ELRQKFEKAKLGPGKKIITPTVDDDRSSLPSSSLDQVKLCDFNFLAVLGKGSFGKVMLAEMKSSEELYAIKILKKDVVIQDDDVECTMVEKRVLAQQDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEIAVGLFFLHQKGVIYRDLKLDNVMLDAEGHIKIADFGMCKENIFEGVTTRTFCGTPDYIAPEIIAYQPYGRSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKALSKEAVSICKGLMTKHPTKRLGCSQEGERDIREHAFFRRIDWERLENREVQPPFKPK 591          

HSP 2 Score: 62.003 bits (149), Expect = 2.128e-9
Identity = 27/52 (51.92%), Postives = 37/52 (71.15%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            P   K   ++  NFDK FT+ Q Q+TP+D+L I N+DQ +FAGFSF+NP+F 
Sbjct:  587 PFKPKVCGKNAENFDKFFTRTQPQLTPSDELVIANIDQADFAGFSFINPQFA 638          
BLAST of Protein kinase C vs. Ensembl Cavefish
Match: prkcaa (protein kinase C, alpha, a [Source:ZFIN;Acc:ZDB-GENE-050208-100])

HSP 1 Score: 563.148 bits (1450), Expect = 0.000e+0
Identity = 266/398 (66.83%), Postives = 314/398 (78.89%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXX-------------XXXXXXXXXXTSVTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            L  +D  RRLSVE+WDWDRTTRNDFMG++SFGVSEL+  P + W+K+L+QEEGE+Y + ++EE      +LR +FE                 +           ++P S  D  +  DFNFL VLGKGSFGKVML E K ++ELYAIKILKKDV+IQDDD+ECTM+EKRVLA Q KPP L QLHSCFQT+DRLYFVMEYVNGGDLMY IQQ GKFKEP AVFY+AEIAVGL FLH  G+IYRDLKLDNV+LD+EGHIKIADFGMCKENI    TT+TFCGTPDYIAPEII YQPYG+SVDWWA+GVLLYEMLAGQPPFDGEDE++LF SI  HNVS+P+++S+EAV+IC+GLMTK   KRLGC   G R I+EH FFRRI+W+++E RE+QPP+KPK
Sbjct:  187 LRAQDKDRRLSVEIWDWDRTTRNDFMGAMSFGVSELIKAPASGWYKMLNQEEGEYYNVPISEEDDGND-ELRQKFEDKKVKDRKKKAKLGPGKKIITPTVDDDRSSLPSSSLDQVKLCDFNFLAVLGKGSFGKVMLAEMKSSEELYAIKILKKDVVIQDDDVECTMVEKRVLAQQDKPPFLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEIAVGLFFLHQKGVIYRDLKLDNVMLDAEGHIKIADFGMCKENIFEGVTTRTFCGTPDYIAPEIIAYQPYGRSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKALSKEAVSICKGLMTKHPTKRLGCSQEGERDIREHAFFRRIDWERLENREVQPPFKPK 583          

HSP 2 Score: 61.6178 bits (148), Expect = 2.242e-9
Identity = 27/52 (51.92%), Postives = 37/52 (71.15%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            P   K   ++  NFDK FT+ Q Q+TP+D+L I N+DQ +FAGFSF+NP+F 
Sbjct:  579 PFKPKVCGKNAENFDKFFTRTQPQLTPSDELVIANIDQADFAGFSFINPQFA 630          
BLAST of Protein kinase C vs. Ensembl Cavefish
Match: prkcbb (protein kinase C beta type [Source:NCBI gene;Acc:103025973])

HSP 1 Score: 523.087 bits (1346), Expect = 2.849e-176
Identity = 259/390 (66.41%), Postives = 303/390 (77.69%), Query Frame = 1
Query:  919 DLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPV----SKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            +L   D  RRLSVE+WDWD T+RNDFMGSLSFG+SEL  + V+ WFKLLSQEEGE++ + V  E      +LR +FERA   +  + + S+S  +        +D  + SDFNFL+VLGKGSFGKVML ERKGTDEL+AIK+LKKDV+IQDDD+ECTM+EKRVLAL GKPP L QLHSCFQTMDRLYFVMEY+NGGDLMY+IQQ GKFKEP AV                     DLKLDNV+LD+EGHIKIADFGMCKEN+    TTKTFCGTPDYIAPEII YQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDE++LF SI  H+VS+P+SMS+EAV IC+GLMTK   KRLGCG  G R I+EH FFR ++W+K+E +E+QPP+KPK
Sbjct:  228 NLKDADKDRRLSVEIWDWDLTSRNDFMGSLSFGISELQKQGVDGWFKLLSQEEGEYFNVPVPPEGEEGNEELRQKFERAKIGAGTKNTDSSSNAISKFDSNGNRDRMKLSDFNFLMVLGKGSFGKVMLAERKGTDELFAIKVLKKDVVIQDDDVECTMVEKRVLALAGKPPFLTQLHSCFQTMDRLYFVMEYINGGDLMYQIQQVGKFKEPHAV---------------------DLKLDNVMLDAEGHIKIADFGMCKENMSEGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIREHGFFRYMDWEKLENKEVQPPFKPK 596          

HSP 2 Score: 71.633 bits (174), Expect = 1.801e-12
Identity = 32/48 (66.67%), Postives = 38/48 (79.17%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVV 2219
            KN RD SNFD+ FTK   ++TPTDKLFIMNLDQ EF GFS+ NPE++ 
Sbjct:  598 KNSRDTSNFDREFTKMPTELTPTDKLFIMNLDQDEFLGFSYTNPEYIA 645          
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 324.709 bits (831), Expect = 5.989e-102
Identity = 156/281 (55.52%), Postives = 197/281 (70.11%), Query Frame = 1
Query: 1240 FNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAV--FYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            F+ L VLGKGSFGKVML E K   + +AIK LKK+V++  DD+ECTM+EKRVL +  + P L  L   FQT + L+FVME++ GGDLM+ IQ +GKF  P     FY+AE+  GL FLH+H IIYRDLKLDNVLLD EGH+KIADFGMCKE++   +   TFCGTPDYIAPEI+  + YG SVDWW+ GVL+YEML GQ PF G DE++LF +I  H   +PR +S  + NI   L  ++  KRLG     V  I+ H FF+ I+W  +E R+I PP+KPK
Sbjct:  252 FHLLKVLGKGSFGKVMLAELKEQGKFFAIKALKKEVVLMGDDVECTMVEKRVLLMACEHPFLTHLCGTFQTKEHLFFVMEFLTGGDLMFHIQDKGKFDLPTGTNRFYAAEVICGLQFLHSHNIIYRDLKLDNVLLDREGHVKIADFGMCKEHVGAGNLATTFCGTPDYIAPEILLGRAYGTSVDWWSMGVLIYEMLIGQSPFYGSDEDELFEAIKGHTPHYPRWLSDSSRNILSCLFERDHTKRLG----AVGDIRLHPFFKNIDWPSLEARKITPPFKPK 528          
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Match: PRKCD (protein kinase C delta [Source:HGNC Symbol;Acc:HGNC:9399])

HSP 1 Score: 312.383 bits (799), Expect = 6.104e-101
Identity = 152/270 (56.30%), Postives = 196/270 (72.59%), Query Frame = 1
Query: 1279 KVMLTERKGTDE-LYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPKKIS 2085
            +V L E K      +AIK LKKDV+I  DD+ECT++EKR+L+L    P L  L+S FQT + L FVMEY+NGGDLM+ IQ +G+F+   A FY+AEI  GL FLH+ GIIYRDLKLDN+LLD +GH+KIADFGMCKENIVG+    TFCGTPDYIAPEI+  Q Y  SVDWW+FGVLLYEML GQ PF G+DEE+LF SI      +PR +++++ +I   L+ +E  KRLG       +I++H FFR I W+ +E RE++PP+KP+ +S
Sbjct:    1 QVFLAELKSRPRNFFAIKALKKDVVIMSDDVECTLVEKRILSLAWGHPYLAHLYSTFQTKEHLMFVMEYLNGGDLMFHIQVKGRFEIDRATFYAAEIVSGLQFLHDQGIIYRDLKLDNILLDKDGHVKIADFGMCKENIVGDVRAGTFCGTPDYIAPEIVIGQKYNCSVDWWSFGVLLYEMLIGQSPFRGDDEEELFESIRTSVPYYPRWITKDSRDILPLLLEREPMKRLGV----TGEIRQHPFFRTINWEALEKRELEPPFKPRVVS 266          
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008480.1 (pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1 gene:ENSPMAG00000007654.1 transcript:ENSPMAT00000008480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 289.656 bits (740), Expect = 2.790e-89
Identity = 141/302 (46.69%), Postives = 201/302 (66.56%), Query Frame = 1
Query: 1189 TSVTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNH-GIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPKKISVT 2091
            T ++ P SK  +   ++F++L +LGKG+FGKV+L   K T + YA+KILKK+VI+  D++  T+ E RVL    K P L  L   FQT DRL FVMEYVNGG+L + + +E  F E    FY AEI   L +LH    ++YRDLKL+N++LD +GHIKIADFG+CKE I   +T KTFCGTP+Y+APE+++   YG++VDWW  GV++YEM+ G+ PF  +D E LF  I   ++ FPR++S +A  +  GL+ K+  +RLG G++  ++I  H FF  I W  +  R++ PP+KP+  S T
Sbjct:  136 TILSKPKSKVTM---NNFDYLKLLGKGTFGKVILVREKATGQYYAMKILKKEVIVAKDEVAHTLTENRVLQTT-KHPFLTLLKYSFQTHDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHTEKNVVYRDLKLENLMLDKDGHIKIADFGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIRFPRTLSNDARALLSGLLKKDPKQRLGGGVDDAKEIMRHSFFAGIIWQDVYDRKMTPPFKPQVASET 433          
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006766.1 (pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 gene:ENSPMAG00000006086.1 transcript:ENSPMAT00000006766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 282.337 bits (721), Expect = 3.286e-87
Identity = 129/280 (46.07%), Postives = 190/280 (67.86%), Query Frame = 1
Query: 1234 SDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKP 2073
            SDF+FL VLGKGSFGKV+L + K     YA+K++KK +I+Q  + +  M E+ VL    + P LV LH  FQ+ D+LYFVM+YVNGG+L + +Q++G F E  A FY+AEI   + +LH+  I+YRDLK +N+LLD +GHI + DFG+CKE I  +STT TFCGTP+Y+APE++K  PY ++VDWW  G +LYEML G PPF  ++ + ++ SI +  +      +  A+++  GL+ K+ ++RLG   + + +I+ HVFF  I W+ ++ + I  PY P
Sbjct:   90 SDFDFLTVLGKGSFGKVLLAKHKSDGIFYAVKVMKKSIILQKKEEKHIMAERNVLVKNVRHPFLVGLHYSFQSADKLYFVMDYVNGGELFFHLQRQGSFPESRAQFYAAEIGSAIGYLHSLNIVYRDLKPENILLDYQGHIVLTDFGLCKEGIDPHSTTCTFCGTPEYLAPEVLKKHPYDRTVDWWCLGCVLYEMLYGLPPFYSKNLKQMYESILHQPLQLRPCTTNAAISVLEGLLHKDPHQRLG-ATSDILEIKNHVFFSTINWNDLDAKRIPSPYNP 368          
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003714.1 (pep scaffold:Pmarinus_7.0:GL480823:68:8916:1 gene:ENSPMAG00000003396.1 transcript:ENSPMAT00000003714.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 213.386 bits (542), Expect = 3.089e-65
Identity = 96/144 (66.67%), Postives = 120/144 (83.33%), Query Frame = 1
Query: 1234 SDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIA 1665
            +DF+F+ VLGKGSFGKVML E +G++E++A+K+LKKD I+QDDD+ECTM EKRVLAL    P L QL  CFQT DRL+FVMEYVNGGDLM++IQ+  KF EP + FY+AE+   L+FLH HG+IYRDLKLDN+LLD+EGH K+A
Sbjct:    4 ADFSFMKVLGKGSFGKVMLAELRGSEEVFAVKVLKKDSIVQDDDVECTMTEKRVLALAKNHPYLTQLFCCFQTRDRLFFVMEYVNGGDLMFQIQRSRKFDEPRSRFYAAEVTSALMFLHRHGVIYRDLKLDNILLDAEGHCKLA 147          
BLAST of Protein kinase C vs. Ensembl Yeast
Match: PKC1 (Protein serine/threonine kinase; essential for cell wall remodeling during growth; localized to sites of polarized growth and the mother-daughter bud neck; homolog of the alpha, beta, and gamma isoforms of mammalian protein kinase C (PKC) [Source:SGD;Acc:S000000201])

HSP 1 Score: 294.664 bits (753), Expect = 7.918e-86
Identity = 143/282 (50.71%), Postives = 197/282 (69.86%), Query Frame = 1
Query: 1237 DFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRV--LALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            +F  L VLGKG+FGKV+L++ K TD L AIK+LKKD IIQ+ DIE    EK+V  LA + K P L  L+  FQT +R+YF ME++ GGDLM+ +Q + +     A FY+AE+ + L + H++G+IYRDLKL+N+LL  EGHIKIAD+G+CK+ +   + T TFCGTP+++APEI+K Q Y K+VDWWAFGVLLY+ML  Q PF G+DE+++FN+I      +P  M+ E V I +GL+TK+  KRLG G     ++ E  FFR I +D I    ++PPY P+
Sbjct:  823 NFVLLKVLGKGNFGKVILSKSKNTDRLCAIKVLKKDNIIQNHDIESARAEKKVFLLATKTKHPFLTNLYCSFQTENRIYFAMEFIGGGDLMWHVQNQ-RLSVRRAKFYAAEVLLALKYFHDNGVIYRDLKLENILLTPEGHIKIADYGLCKDEMWYGNRTSTFCGTPEFMAPEILKEQEYTKAVDWWAFGVLLYQMLLCQSPFSGDDEDEVFNAILTDEPLYPIDMAGEIVQIFQGLLTKDPEKRLGAGPRDADEVMEEPFFRNINFDDILNLRVKPPYIPE 1103          
BLAST of Protein kinase C vs. Ensembl Yeast
Match: YPK1 (S/T protein kinase; phosphorylates, downregulates flippase activator Fpk1p; inactivates Orm1p and Orm2p by phosphorylation in response to compromised sphingolipid synthesis; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); mutations affect receptor-mediated endocytosis and sphingolipid-mediated and cell integrity signaling pathways; human homolog SGK1 can complement a null mutant; human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000001609])

HSP 1 Score: 258.455 bits (659), Expect = 7.734e-76
Identity = 121/279 (43.37%), Postives = 182/279 (65.23%), Query Frame = 1
Query: 1237 DFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKP 2073
            DF+ L V+GKGSFGKVM   +K T ++YA+K ++K  I+   ++  T+ E+ VLA +   P +V L   FQ+ ++LYFV+ ++NGG+L Y +Q+EG+F    A FY+AE+   L  LH   ++YRDLK +N+LLD +GHI + DFG+CK N+  +  T TFCGTP+Y+APE++    Y K+VDWW  GVLLYEML G PP+  ED   ++  I    + FP    R+A ++  GL++++  +RL  G NG  +I+ H FF ++ W ++ ++   PPYKP
Sbjct:  346 DFDLLKVIGKGSFGKVMQVRKKDTQKVYALKAIRKSYIVSKSEVTHTLAERTVLA-RVDCPFIVPLKFSFQSPEKLYFVLAFINGGELFYHLQKEGRFDLSRARFYTAELLCALDNLHKLDVVYRDLKPENILLDYQGHIALCDFGLCKLNMKDDDKTDTFCGTPEYLAPELLLGLGYTKAVDWWTLGVLLYEMLTGLPPYYDEDVPKMYKKILQEPLVFPDGFDRDAKDLLIGLLSRDPTRRL--GYNGADEIRNHPFFSQLSWKRLLMKGYIPPYKP 621          
BLAST of Protein kinase C vs. Ensembl Yeast
Match: YPK2 (Protein kinase similar to S/T protein kinase Ypk1p; functionally redundant with YPK1 at the genetic level; participates in a signaling pathway required for optimal cell wall integrity; involved in the TORC-dependent phosphorylation of ribosomal proteins Rps6a/b (S6); human homolog SGK2 can complement a ypk1 ypk2 double mutant [Source:SGD;Acc:S000004710])

HSP 1 Score: 254.988 bits (650), Expect = 1.442e-74
Identity = 123/279 (44.09%), Postives = 180/279 (64.52%), Query Frame = 1
Query: 1237 DFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKP 2073
            DF+ L V+GKGSFGKVM   +K T ++YA+K L+K  I+   ++  T+ E+ VLA +   P +V L   FQ+ ++LY V+ ++NGG+L Y +Q EG+F    + FY AE+   L  LH   +IYRDLK +N+LLD +GHI + DFG+CK N+  N  T TFCGTP+Y+APEI+  Q Y K+VDWW  G+LLYEM+ G PP+  E+   ++  I    + FP      A ++  GL++++ ++RL  G+NG  +I+ H FF+ I W K+ L+   PPYKP
Sbjct:  343 DFDLLKVIGKGSFGKVMQVRKKDTQKIYALKALRKAYIVSKCEVTHTLAERTVLA-RVDCPFIVPLKFSFQSPEKLYLVLAFINGGELFYHLQHEGRFSLARSRFYIAELLCALDSLHKLDVIYRDLKPENILLDYQGHIALCDFGLCKLNMKDNDKTDTFCGTPEYLAPEILLGQGYTKTVDWWTLGILLYEMMTGLPPYYDENVPVMYKKILQQPLLFPDGFDPAAKDLLIGLLSRDPSRRL--GVNGTDEIRNHPFFKDISWKKLLLKGYIPPYKP 618          
BLAST of Protein kinase C vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 243.047 bits (619), Expect = 3.804e-73
Identity = 117/280 (41.79%), Postives = 174/280 (62.14%), Query Frame = 1
Query: 1234 SDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKP 2073
            SDF  L  LG GSFG+V L         YA+K LKK  I++   +E T  E+R+L++   P  ++++   FQ   +++ VM+Y+ GG+L   +++  +F  PVA FY+AE+ + L +LH+  IIYRDLK +N+LLD  GHIKI DFG  K        T T CGTPDYIAPE++  +PY KSVDWW+FGVL+YEMLAG  PF   +    + +I N  + FP     +A ++ + L+T+++++RLG   NG   ++ H +F  + W+K+  R I+ PY+P
Sbjct:   86 SDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHP-FIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAK---YVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFPPFFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWFNEVIWEKLLARYIETPYEP 361          
BLAST of Protein kinase C vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 238.424 bits (607), Expect = 1.392e-71
Identity = 117/285 (41.05%), Postives = 171/285 (60.00%), Query Frame = 1
Query: 1231 CSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPKKIS 2085
              DF  +  LG GSFG+V L         YAIK+LKK  +++   +E T  E+R+L L  + P L+++   FQ    ++ VM+Y+ GG+L   +++  +F  PVA FY+AE+ + L +LH H IIYRDLK +N+LLD  GHIKI DFG  KE     + T T CGTPDYIAPE+I  +PY KSVDWW+ GVL+YEMLAG  PF        +  I    V +P     + V++   L+T ++ +R+G   +G R I+ H +F  + W+++  ++I+ PY+P   S
Sbjct:   67 LHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKLV-EHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEV---QTVTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYPPYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWFSEVVWERLLAKDIETPYEPPITS 347          
BLAST of Protein kinase C vs. Ensembl Nematostella
Match: EDO44925 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUL8])

HSP 1 Score: 422.165 bits (1084), Expect = 8.457e-141
Identity = 203/303 (67.00%), Postives = 237/303 (78.22%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQ 1830
            +  +D  RRLS+EVWDWDRTTRNDFMGSLSFGVSEL    V  WFKLLSQEEGE+Y I + +         R + E              S++ P +K+  P   DF+FL VLGKGSFGKVML ERKGTD++YAIK+LKKDVI+QDDD+ECTM EKRVLA+ GKPP L QL  CF ++DRLYFVME+VNGGDLM+ IQQ G+FKEP AVFY+AEI +GL+FLH  GI+YRDLKLDNV+LDS+GHIKIADFGMCKE++  N TT+TFCGTPDYIAPEI+ YQPYG SVDWWA GVL+YEMLAGQ
Sbjct:  125 IQNKDKDRRLSIEVWDWDRTTRNDFMGSLSFGVSELQKNGVEGWFKLLSQEEGEYYNIPIDDAREEEERKCRQKLE-------------QSLSDPNAKKFRP--EDFHFLKVLGKGSFGKVMLAERKGTDQVYAIKVLKKDVIVQDDDVECTMTEKRVLAVPGKPPFLTQLFCCFHSVDRLYFVMEFVNGGDLMFHIQQAGRFKEPQAVFYAAEIVIGLVFLHKRGIVYRDLKLDNVMLDSDGHIKIADFGMCKESMFNNQTTRTFCGTPDYIAPEIVAYQPYGFSVDWWALGVLIYEMLAGQ 412          
BLAST of Protein kinase C vs. Ensembl Nematostella
Match: EDO35585 (Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7SL27])

HSP 1 Score: 395.586 bits (1015), Expect = 1.369e-126
Identity = 186/286 (65.03%), Postives = 228/286 (79.72%), Query Frame = 1
Query: 1237 DFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVR-QIQEHVFFRRIEWDKIELREIQPPYKPKKISVT 2091
            DF F+ VLGKGSFGKV+L ERKGTDE+YAIKILKK+ ++QDDD+ECTMIE+RVLAL    P L  LHS FQT++RL+FVMEYVNGGDLM++IQ+  KF E  + FY+AE+ + L FLH +G+IYRDLKLDNVLLD++GHIK+ADFGMCKEN+    TT TFCGTPDYIAPEI++ QPYG SVDWWA GVL+YEM+AGQPPF+ E+EEDLF SI + +V +P  +SREAV+I +G MTK   KRLGC        I+EH FFR I ++K+E R+I PP+KPK  S T
Sbjct:  382 DFTFIKVLGKGSFGKVLLAERKGTDEVYAIKILKKESVLQDDDVECTMIERRVLALSAGHPFLTSLHSSFQTVERLFFVMEYVNGGDLMFQIQKSRKFDENRSRFYAAEVVLALQFLHQNGVIYRDLKLDNVLLDADGHIKLADFGMCKENMAPGKTTTTFCGTPDYIAPEILQEQPYGFSVDWWALGVLMYEMMAGQPPFEAENEEDLFESILHDDVLYPVWLSREAVSILKGFMTKNYLKRLGCTPTSTESSIREHAFFRLINFEKLEARQINPPFKPKIRSRT 667          

HSP 2 Score: 62.3882 bits (150), Expect = 5.528e-10
Identity = 28/47 (59.57%), Postives = 37/47 (78.72%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            +++ DV NFD  FTKE+ ++TPTD+  I+N+DQ EF GFSFVNP FV
Sbjct:  664 RSRTDVGNFDTDFTKEEPKLTPTDRNVIVNIDQREFRGFSFVNPHFV 710          
BLAST of Protein kinase C vs. Ensembl Nematostella
Match: EDO44938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU22])

HSP 1 Score: 312.768 bits (800), Expect = 8.855e-97
Identity = 151/292 (51.71%), Postives = 199/292 (68.15%), Query Frame = 1
Query: 1234 SDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFD--------GEDEED-LFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCG-LNGVRQIQEHVFFRRIEWDKIELREIQPPYKPKK 2079
            +DFN + V+G+GS+ KVML E K T  +YA+K++KK+++  D+DI+    EK V       P LV LHSCFQT  RL+FV+EYV+GGDLMY +Q++ +  E  A FYSAEI   L FLH  G+IYRDLKLDNVLLDS+GHIK+ D+GMCKE I     T TFCGTP+YIAPEI++ + YG SVDWWA GVLLYEMLAG+ PFD         ++ ED LF  I    +  PRS+S +A +I +G + K   +RLGC    G   I  H FFR + W+++E R++ PP+KP++
Sbjct:  220 NDFNLIRVIGRGSYAKVMLVELKKTKRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTSSRLFFVIEYVSGGDLMYHMQRQRRLPEDHARFYSAEICCALNFLHEKGVIYRDLKLDNVLLDSDGHIKLTDYGMCKEGIRPGDVTSTFCGTPNYIAPEILRGEDYGFSVDWWALGVLLYEMLAGRSPFDIVGSADNPDQNTEDYLFQVILEKPIRIPRSLSVKAASILKGYLNKNPTERLGCHPQTGFADITSHAFFRTVSWEQLEARQVTPPFKPRQ 511          
BLAST of Protein kinase C vs. Ensembl Nematostella
Match: EDO37800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW2])

HSP 1 Score: 286.96 bits (733), Expect = 5.533e-89
Identity = 137/282 (48.58%), Postives = 188/282 (66.67%), Query Frame = 1
Query: 1228 RCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKP 2073
            + SDF FL V+GKGSFGKV L++ K  D+ YAIK+L K  I + ++ +  M E+ VL      P LV LH  FQT D+LYFV++YVNGG+L + +Q+E  F E  A FY+AEIA  + +LH   IIYRDLK +N+LLDS+GHI + DFG+CKE I  + TT TFCGTP+Y+APE+++ Q Y KSVDWW  G +LYEM+ G PPF   D  +++++I +  +    ++S+ A +I  GL+ K+  KRLG G      I+ H FFR I W ++  R I+PPY P
Sbjct:   70 KPSDFLFLKVIGKGSFGKVFLSKNKQEDKFYAIKVLNKSAIRKRNEAKHIMAERNVLVQNVTHPFLVGLHYSFQTKDKLYFVLDYVNGGELFFHLQRERYFPESRARFYAAEIASAIGYLHGLQIIYRDLKPENILLDSKGHIVLTDFGLCKEGIDRSGTTSTFCGTPEYLAPEVLRKQDYDKSVDWWCLGAVLYEMMYGLPPFYSRDTAEMYDNILHKPLRLRTNISQSARHILEGLLQKDKTKRLGSGEGDFEDIRTHSFFRSINWQQLVARGIEPPYNP 351          
BLAST of Protein kinase C vs. Ensembl Nematostella
Match: EDO43312 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYZ0])

HSP 1 Score: 265.774 bits (678), Expect = 4.379e-76
Identity = 136/284 (47.89%), Postives = 197/284 (69.37%), Query Frame = 1
Query: 1234 SDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVL--ALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPE-IIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            S+F  + VLG+G FGKV+L E + T+EL+AIK LKK  II  +++E  + EKR+   A + + P LV L +CFQT + + FVMEY  GGDLM  I  +  F E   VFY+A + +GL +LH+H I+YRDLKLDN+LLDSEG++KIADFG+CKE++   + T TFCGTP+++APE ++    Y ++VDWW  GVL++EML G+ PF G+DEE++F+SI N  V +PR +S EA+ I R L+ +   +RLG       ++++  FFR + WD +  R+I+PP+ P+
Sbjct:  610 SNFRCISVLGRGHFGKVILAEYRNTNELFAIKALKKGDIIAREEVESLLAEKRIFLTANKTRHPFLVNLFACFQTQEHVCFVMEYAPGGDLMMHIHAD-VFAESRTVFYTACVVLGLQYLHDHEIVYRDLKLDNLLLDSEGYVKIADFGLCKEDMGYGARTGTFCGTPEFLAPEMLVTETSYTRAVDWWGLGVLIFEMLVGESPFPGDDEEEVFDSIVNDEVRYPRFLSTEAIAIMRRLLRRNPERRLGAAEKDAEEVKKQPFFRDMRWDDLLARKIRPPFVPQ 892          
BLAST of Protein kinase C vs. Ensembl Medaka
Match: prkcba (protein kinase C beta type [Source:NCBI gene;Acc:101161464])

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 273/391 (69.82%), Postives = 318/391 (81.33%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPV---SKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPKKIS 2085
            L + D  RRLSVEVWDWD T+RNDFMGSLSFG+SEL  + ++ WFKLLSQEEGE++ + V  +      +LR +FERA     +    S+S          QD  + SDF F++VLGKGSFGKVML ERKGTDELYAIK+LKKDV+IQDDD+ECTM+EKRVLAL GKPP L QLHSCFQT DRLYFVMEYVNGGDLMY+IQQ GKFKEP AVFY+AEI++GL FLH+ GI+YRDLKLDNV+LDSEGHIKIADFGMCKEN++   TTKTFCGTPDYIAPEII YQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDE++LF SI  H+VS+P+SMS+EAV IC+GLMTK   KRLGCG  G R I++H FFR I+W+K+E + +QPP+KPK  S
Sbjct:  228 LCENDKDRRLSVEVWDWDLTSRNDFMGSLSFGISELQKQGIDGWFKLLSQEEGEYFNVPVQPDGEDGNEELRQKFERAKVGPGKPTDSSSSSVHKYDSNGNQDRVKLSDFTFIMVLGKGSFGKVMLAERKGTDELYAIKVLKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTTDRLYFVMEYVNGGDLMYQIQQVGKFKEPHAVFYAAEISIGLFFLHSRGIVYRDLKLDNVMLDSEGHIKIADFGMCKENMLDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKDHAFFRYIDWEKLENKMVQPPFKPKAKS 618          

HSP 2 Score: 74.7146 bits (182), Expect = 2.217e-13
Identity = 34/50 (68.00%), Postives = 42/50 (84.00%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVEV 2225
            K+++DV NFDK FTK   ++TPTDKLFIMNLDQ EF GFS+ NPEFV++V
Sbjct:  617 KSRQDVGNFDKEFTKMPVELTPTDKLFIMNLDQNEFQGFSYTNPEFVIQV 666          
BLAST of Protein kinase C vs. Ensembl Medaka
Match: PRKCB (protein kinase C beta [Source:NCBI gene;Acc:105353642])

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 276/389 (70.95%), Postives = 316/389 (81.23%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPV----SKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            L + D  RRLSVEVWDWD T+RNDFMGSLSFG+SEL  + V+ WFKLLSQEEGE++ + V  E   A  +LR +FERA     +     +S           QD  R SDFNFL+VLGKGSFGKVML ERKGT+ELYAIKILKKDV+IQDDD+ECTM+EKRVLAL GKPP L QLHS FQTMDRLYFVMEY+NGGDLMY+IQQ GKFKEP AVFY+AEIA+GL FLH  GIIYRDLKLDNV+LD EGHIKIADFGMCKEN+    TTKTFCGTPDYIAPEII YQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDE++LF SI  H+VS+P+SMS+EAV IC+GLMTK   KRLGCG  G R I++H FFR ++W+K+E +E+QPP+KP+
Sbjct:  233 LKEYDKDRRLSVEVWDWDLTSRNDFMGSLSFGISELQKQGVDGWFKLLSQEEGEYFNVPVAPEGEEASEELRQKFERAKIAVGKSTEGKSSNAASRFDSNGNQDRIRLSDFNFLMVLGKGSFGKVMLAERKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSTFQTMDRLYFVMEYINGGDLMYQIQQVGKFKEPHAVFYAAEIAIGLFFLHLKGIIYRDLKLDNVMLDCEGHIKIADFGMCKENMNDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPAKRLGCGPEGERDIRDHSFFRYMDWEKLENKEVQPPFKPR 621          

HSP 2 Score: 66.6254 bits (161), Expect = 7.884e-11
Identity = 30/48 (62.50%), Postives = 35/48 (72.92%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVV 2219
            + +RD  NFDK FTK    +TPTDKL IMNLDQ EF GFS+ NPE+V 
Sbjct:  623 RTRRDTCNFDKEFTKMPTDLTPTDKLVIMNLDQDEFLGFSYTNPEYVA 670          
BLAST of Protein kinase C vs. Ensembl Medaka
Match: prkcba (protein kinase C beta type [Source:NCBI gene;Acc:101161464])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 272/388 (70.10%), Postives = 317/388 (81.70%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPV---SKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            L + D  RRLSVEVWDWD T+RNDFMGSLSFG+SEL  + ++ WFKLLSQEEGE++ + V  +      +LR +FERA     +    S+S          QD  + SDF F++VLGKGSFGKVML ERKGTDELYAIK+LKKDV+IQDDD+ECTM+EKRVLAL GKPP L QLHSCFQT DRLYFVMEYVNGGDLMY+IQQ GKFKEP AVFY+AEI++GL FLH+ GI+YRDLKLDNV+LDSEGHIKIADFGMCKEN++   TTKTFCGTPDYIAPEII YQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDE++LF SI  H+VS+P+SMS+EAV IC+GLMTK   KRLGCG  G R I++H FFR I+W+K+E + +QPP+KPK
Sbjct:  228 LCENDKDRRLSVEVWDWDLTSRNDFMGSLSFGISELQKQGIDGWFKLLSQEEGEYFNVPVQPDGEDGNEELRQKFERAKVGPGKPTDSSSSSVHKYDSNGNQDRVKLSDFTFIMVLGKGSFGKVMLAERKGTDELYAIKVLKKDVVIQDDDVECTMVEKRVLALSGKPPFLTQLHSCFQTTDRLYFVMEYVNGGDLMYQIQQVGKFKEPHAVFYAAEISIGLFFLHSRGIVYRDLKLDNVMLDSEGHIKIADFGMCKENMLDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKDHAFFRYIDWEKLENKMVQPPFKPK 615          

HSP 2 Score: 57.3806 bits (137), Expect = 5.233e-8
Identity = 27/51 (52.94%), Postives = 32/51 (62.75%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEF 2213
            P   K   RD  NFD+ FT+    +TP D+  I NLDQ EF GFSFVNPE+
Sbjct:  611 PFKPKACGRDAENFDRFFTRHLPTLTPPDQELIANLDQDEFQGFSFVNPEY 661          
BLAST of Protein kinase C vs. Ensembl Medaka
Match: PRKCB (protein kinase C beta [Source:NCBI gene;Acc:105353642])

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 276/389 (70.95%), Postives = 316/389 (81.23%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPV----SKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            L + D  RRLSVEVWDWD T+RNDFMGSLSFG+SEL  + V+ WFKLLSQEEGE++ + V  E   A  +LR +FERA     +     +S           QD  R SDFNFL+VLGKGSFGKVML ERKGT+ELYAIKILKKDV+IQDDD+ECTM+EKRVLAL GKPP L QLHS FQTMDRLYFVMEY+NGGDLMY+IQQ GKFKEP AVFY+AEIA+GL FLH  GIIYRDLKLDNV+LD EGHIKIADFGMCKEN+    TTKTFCGTPDYIAPEII YQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDE++LF SI  H+VS+P+SMS+EAV IC+GLMTK   KRLGCG  G R I++H FFR ++W+K+E +E+QPP+KP+
Sbjct:  233 LKEYDKDRRLSVEVWDWDLTSRNDFMGSLSFGISELQKQGVDGWFKLLSQEEGEYFNVPVAPEGEEASEELRQKFERAKIAVGKSTEGKSSNAASRFDSNGNQDRIRLSDFNFLMVLGKGSFGKVMLAERKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSTFQTMDRLYFVMEYINGGDLMYQIQQVGKFKEPHAVFYAAEIAIGLFFLHLKGIIYRDLKLDNVMLDCEGHIKIADFGMCKENMNDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEDELFQSIMEHHVSYPKSMSKEAVAICKGLMTKHPAKRLGCGPEGERDIRDHSFFRYMDWEKLENKEVQPPFKPR 621          

HSP 2 Score: 54.299 bits (129), Expect = 4.657e-7
Identity = 25/51 (49.02%), Postives = 32/51 (62.75%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEF 2213
            P   +   R+  NFD+ FT+    +TP D+  I NLDQ EF GFSF+NPEF
Sbjct:  617 PFKPRACGREAENFDRFFTRHPPVLTPPDEEVIQNLDQDEFQGFSFINPEF 667          
BLAST of Protein kinase C vs. Ensembl Medaka
Match: prkcab (protein kinase C alpha type [Source:NCBI gene;Acc:101159746])

HSP 1 Score: 563.533 bits (1451), Expect = 0.000e+0
Identity = 271/388 (69.85%), Postives = 315/388 (81.19%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTS---VTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            L   D  RRLS+EVWDWDRTTRNDFMGS+SFGVSEL+  P   WFKLL+QEEGE+Y + + E      ++LR +FE+A     ++    +     + P    D  R SDFNFL +LGKGSFGKVML E K T+ELYAIKILKKDV+IQDDD+ECTM+EKRVLAL+ KPP L QLHSCFQT+DRLYFVMEY+NGGDLMY IQ+ GKFKEP AVFY+AEIAVGL FLH  GIIYRDLKLDNV+LDSEGHIKIADFGMCKE++    TT+TFCGTPDYIAPEII YQPYGKSVDWWA+GVLLYEMLAGQPPFDGEDE++LF SI  HNVS+P+SMS+EAV+IC+GLMTK  +KRLGCG  G R I+E  FFRRI+W+++  REIQPP+KPK
Sbjct:  229 LKPSDKDRRLSIEVWDWDRTTRNDFMGSMSFGVSELIKAPHCGWFKLLNQEEGEYYNVPIPE-VDDVNLELRQKFEKAKLGHGKKVITPSDHRRFSFPSGNLDRVRLSDFNFLALLGKGSFGKVMLAEMKSTEELYAIKILKKDVVIQDDDVECTMVEKRVLALRDKPPFLTQLHSCFQTVDRLYFVMEYINGGDLMYHIQRMGKFKEPQAVFYAAEIAVGLFFLHRKGIIYRDLKLDNVMLDSEGHIKIADFGMCKESMYEGMTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPKSMSKEAVSICKGLMTKHPSKRLGCGPEGERDIREQAFFRRIDWERLANREIQPPFKPK 615          

HSP 2 Score: 59.3066 bits (142), Expect = 1.233e-8
Identity = 27/52 (51.92%), Postives = 36/52 (69.23%), Query Frame = 3
Query: 2061 PI*TKKNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFV 2216
            P   K   +   NFDK FT+ Q  +TP D+L I N+DQ+EFAGFSF+NP+F+
Sbjct:  611 PFKPKVCGKAAENFDKFFTRTQPVLTPPDQLVISNIDQSEFAGFSFINPQFI 662          
BLAST of Protein kinase C vs. Planmine SMEST
Match: SMESG000071570.1 (SMESG000071570.1)

HSP 1 Score: 770.77 bits (1989), Expect = 0.000e+0
Identity = 386/386 (100.00%), Postives = 386/386 (100.00%), Query Frame = 1
Query:  919 DLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFXXXXXXXXXXXXXXTSVTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            DLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFERASAESRERKSKSTSVTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK
Sbjct:  226 DLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFERASAESRERKSKSTSVTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 611          

HSP 2 Score: 104.76 bits (260), Expect = 7.506e-23
Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVEV 2225
            KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVEV
Sbjct:  613 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVEV 662          
BLAST of Protein kinase C vs. Planmine SMEST
Match: SMESG000039865.1 (SMESG000039865.1)

HSP 1 Score: 605.134 bits (1559), Expect = 0.000e+0
Identity = 282/387 (72.87%), Postives = 340/387 (87.86%), Query Frame = 1
Query:  922 LSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPVNNWFKLLSQEEGEFYAIQVTEEAS-AAIMDLRNRFXXXXXXXXXXXXXXTSVT-MPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPK 2076
            +SKED ++R+S+EVWDWDRT+RNDFMG+LSFG+SELV +PV++WFKLLS EEGEFY+I V ++ + A++ DL+ +FE++  E ++ +  +     +  +KQDIPR SDFNF+LVLGKGSFGKV+L ERKGTDELYA+KILKKDVIIQDDD+ECTMIEKRVLALQ KP  LVQLHSCFQTMDRLYFVME+VNGGDLMYRIQQEGKFKEPVAVFY+AEIA+GL FLH+ GIIYRDLKLDN++LD EGHIKIADFGMCKE I  + TT+TFCGTPDYIAPEIIKYQPYGKSVDWWA+GV+LYEMLAGQ PFDGEDEE+LFN+IT HNVS+P+SMS+E+V+IC+GL+TK+  KRLG    G R ++EH+FFRRI+W+KI  R++QPP KPK
Sbjct:   45 ISKEDFAKRMSIEVWDWDRTSRNDFMGALSFGISELVKQPVDSWFKLLSTEEGEFYSIPVADDLNVASVADLKAKFEKSILEEKKNQQITNENNYINQNKQDIPRASDFNFILVLGKGSFGKVILAERKGTDELYAVKILKKDVIIQDDDVECTMIEKRVLALQEKPSFLVQLHSCFQTMDRLYFVMEFVNGGDLMYRIQQEGKFKEPVAVFYTAEIAIGLFFLHSKGIIYRDLKLDNIMLDHEGHIKIADFGMCKEGIFDDKTTRTFCGTPDYIAPEIIKYQPYGKSVDWWAYGVILYEMLAGQAPFDGEDEEELFNAITEHNVSYPKSMSKESVSICKGLLTKDPKKRLGSNRYGDRDVREHLFFRRIDWEKINARQVQPPNKPK 431          

HSP 2 Score: 87.4261 bits (215), Expect = 1.139e-17
Identity = 41/50 (82.00%), Postives = 46/50 (92.00%), Query Frame = 3
Query: 2076 KNKRDVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEFVVEV 2225
            K+ RDVSNFD+ FTKE  Q+TPTDKLFIMNLDQTEF+GFSFVNPEF+VEV
Sbjct:  433 KDPRDVSNFDQEFTKETAQLTPTDKLFIMNLDQTEFSGFSFVNPEFIVEV 482          
BLAST of Protein kinase C vs. Planmine SMEST
Match: SMESG000042308.1 (SMESG000042308.1)

HSP 1 Score: 379.793 bits (974), Expect = 2.124e-120
Identity = 179/292 (61.30%), Postives = 224/292 (76.71%), Query Frame = 1
Query: 1222 IPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLN--GVRQIQEHVFFRRIEWDKIELREIQPPYKPKKISVT 2091
            +P  SDFNF+ VLGKGSFGKV+L E K T ++YAIKILKK+VI+QD+D+ECTM E+R+LAL  K P L  LHS FQT DRL+FVMEYVNGGDLM++IQ+  +F EP A FYS+E+ + L+FLH HGIIYRDLKLDN+LLD+EGH K+ADFGMCKE + G+  T TFCGTPDYIAPEI+  Q YG SVDWWA GVL+YEM+AG PPF+G+ E+DLFN+I+  +VSFP S+   +V+I    + K   KRLGC  +  G + I  H FFR I+W  +E R I+PP++PK  S T
Sbjct:  396 VPCLSDFNFVKVLGKGSFGKVILAEHKSTCDVYAIKILKKEVILQDEDVECTMTEQRILALAAKHPFLTALHSSFQTDDRLFFVMEYVNGGDLMFQIQRVRRFDEPRACFYSSEVTLALMFLHKHGIIYRDLKLDNILLDAEGHCKLADFGMCKEGMSGSKLTSTFCGTPDYIAPEILAEQDYGFSVDWWALGVLMYEMMAGAPPFEGDTEQDLFNAISYDSVSFPSSLQPASVDIVSKFLIKNPLKRLGCVAHEGGQQAIMRHPFFREIDWVLLEERRIRPPFRPKVRSRT 687          
BLAST of Protein kinase C vs. Planmine SMEST
Match: SMESG000042308.1 (SMESG000042308.1)

HSP 1 Score: 379.793 bits (974), Expect = 9.003e-120
Identity = 179/292 (61.30%), Postives = 224/292 (76.71%), Query Frame = 1
Query: 1222 IPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLN--GVRQIQEHVFFRRIEWDKIELREIQPPYKPKKISVT 2091
            +P  SDFNF+ VLGKGSFGKV+L E K T ++YAIKILKK+VI+QD+D+ECTM E+R+LAL  K P L  LHS FQT DRL+FVMEYVNGGDLM++IQ+  +F EP A FYS+E+ + L+FLH HGIIYRDLKLDN+LLD+EGH K+ADFGMCKE + G+  T TFCGTPDYIAPEI+  Q YG SVDWWA GVL+YEM+AG PPF+G+ E+DLFN+I+  +VSFP S+   +V+I    + K   KRLGC  +  G + I  H FFR I+W  +E R I+PP++PK  S T
Sbjct:  396 VPCLSDFNFVKVLGKGSFGKVILAEHKSTCDVYAIKILKKEVILQDEDVECTMTEQRILALAAKHPFLTALHSSFQTDDRLFFVMEYVNGGDLMFQIQRVRRFDEPRACFYSSEVTLALMFLHKHGIIYRDLKLDNILLDAEGHCKLADFGMCKEGMSGSKLTSTFCGTPDYIAPEILAEQDYGFSVDWWALGVLMYEMMAGAPPFEGDTEQDLFNAISYDSVSFPSSLQPASVDIVSKFLIKNPLKRLGCVAHEGGQQAIMRHPFFREIDWVLLEERRIRPPFRPKVRSRT 687          
BLAST of Protein kinase C vs. Planmine SMEST
Match: SMESG000066024.1 (SMESG000066024.1)

HSP 1 Score: 330.872 bits (847), Expect = 5.946e-101
Identity = 156/291 (53.61%), Postives = 199/291 (68.38%), Query Frame = 1
Query: 1234 SDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKDVIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGGDLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDSEGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWAFGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLMTKEINKRLGCGLN-----------GVRQIQEHVFFRRIEWDKIELREIQPPYKP 2073
            SDFN L VLGKGSFGKVML E K T E++A+K LKKDVI+QDDD++CT+ E+R+LAL  K P L  LHS FQT DRL+F+ME+VNGGDLM+ IQ+  +F EP A FYSAE+A+ L FLHN                  GH K+ADFGMCKE I G+ TT TFCGTPDYIAPEII  + Y  SVDWWA GVL+YEM+AG PPF+G  E++LF +I +  V FP ++S    ++    +TK   +RLGC +N           G + IQ+H F+R ++W K+E R++ PP+KP
Sbjct:  458 SDFNMLSVLGKGSFGKVMLVELKSTGEVFALKALKKDVILQDDDVDCTLTERRILALAAKHPFLTALHSSFQTPDRLFFIMEFVNGGDLMFHIQKARRFDEPRACFYSAEVALALHFLHN------------------GHCKLADFGMCKEGISGDKTTTTFCGTPDYIAPEIILEESYDFSVDWWAMGVLMYEMMAGAPPFEGSSEDELFKAILSDKVMFPSNLSLATADLISKFLTKRPQQRLGCAVNSNIPSSERYKKGFKDIQQHTFYRDLDWRKLEQRQLTPPFKP 730          

HSP 2 Score: 53.5286 bits (127), Expect = 6.696e-7
Identity = 23/42 (54.76%), Postives = 31/42 (73.81%), Query Frame = 3
Query: 2088 DVSNFDKLFTKEQHQMTPTDKLFIMNLDQTEFAGFSFVNPEF 2213
            D SNFD+ FT EQ ++TP D   + ++DQ EF GFSFVNP++
Sbjct:  737 DTSNFDRDFTNEQPKLTPVDSECVKHIDQREFRGFSFVNPDY 778          
The following BLAST results are available for this feature:
BLAST of Protein kinase C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKCA1.237e-771.06protein kinase C alpha [Source:HGNC Symbol;Acc:HGN... [more]
PRKCB2.361e-1471.57protein kinase C beta [Source:HGNC Symbol;Acc:HGNC... [more]
PRKCB2.257e-671.57protein kinase C beta [Source:HGNC Symbol;Acc:HGNC... [more]
PRKCG2.144e-16362.96protein kinase C gamma [Source:HGNC Symbol;Acc:HGN... [more]
PRKCE3.364e-12262.77protein kinase C epsilon [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pkc-21.466e-1167.09Protein kinase C-like 2 [Source:UniProtKB/Swiss-P... [more]
pkc-21.286e-1167.09Protein kinase C-like 2 [Source:UniProtKB/Swiss-P... [more]
pkc-20.000e+067.09Protein kinase C-like 2 [Source:UniProtKB/Swiss-P... [more]
pkc-21.276e-1167.09Protein kinase C-like 2 [Source:UniProtKB/Swiss-P... [more]
pkc-12.091e-12563.83Protein kinase C-like 1B [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pkc53E6.386e-1368.73gene:FBgn0003091 transcript:FBtr0305069[more]
Pkc53E7.571e-1368.73gene:FBgn0003091 transcript:FBtr0112819[more]
Pkc53E7.571e-1368.73gene:FBgn0003091 transcript:FBtr0305070[more]
Pkc53E7.646e-1368.73gene:FBgn0003091 transcript:FBtr0087048[more]
Pkc53E8.036e-1368.73gene:FBgn0003091 transcript:FBtr0331960[more]
back to top
BLAST of Protein kinase C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkcbb1.631e-1170.44protein kinase C, beta b [Source:NCBI gene;Acc:393... [more]
prkcbb1.528e-870.44protein kinase C, beta b [Source:NCBI gene;Acc:393... [more]
prkcab2.703e-969.85protein kinase C, alpha, b [Source:ZFIN;Acc:ZDB-GE... [more]
prkcaa0.000e+069.49protein kinase C, alpha, a [Source:ZFIN;Acc:ZDB-GE... [more]
prkcaa2.982e-869.85protein kinase C, alpha, a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkcb4.753e-670.33protein kinase C beta [Source:NCBI gene;Acc:100038... [more]
prkcb4.688e-670.33protein kinase C beta [Source:NCBI gene;Acc:100038... [more]
prkcb4.480e-670.33protein kinase C beta [Source:NCBI gene;Acc:100038... [more]
prkcb4.636e-670.33protein kinase C beta [Source:NCBI gene;Acc:100038... [more]
prkcb4.412e-670.33protein kinase C beta [Source:NCBI gene;Acc:100038... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkca8.711e-871.32protein kinase C, alpha [Source:MGI Symbol;Acc:MGI... [more]
Prkcb1.649e-1470.81protein kinase C, beta [Source:MGI Symbol;Acc:MGI:... [more]
Prkcb1.590e-670.81protein kinase C, beta [Source:MGI Symbol;Acc:MGI:... [more]
Prkcb1.590e-670.81protein kinase C, beta [Source:MGI Symbol;Acc:MGI:... [more]
Prkcg3.268e-16463.21Protein kinase C gamma type [Source:UniProtKB/Swi... [more]
back to top
BLAST of Protein kinase C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q16974|KPC1_APLCA8.698e-1474.09Calcium-dependent protein kinase C OS=Aplysia cali... [more]
sp|P17252|KPCA_HUMAN5.938e-771.06Protein kinase C alpha type OS=Homo sapiens OX=960... [more]
sp|P05771|KPCB_HUMAN1.134e-1371.57Protein kinase C beta type OS=Homo sapiens OX=9606... [more]
sp|P05696|KPCA_RAT6.198e-771.06Protein kinase C alpha type OS=Rattus norvegicus O... [more]
sp|P10102|KPCA_RABIT9.272e-771.06Protein kinase C alpha type OS=Oryctolagus cunicul... [more]
back to top
BLAST of Protein kinase C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0L8GWM20.000e+074.87Non-specific serine/threonine protein kinase OS=Oc... [more]
A0A3S0ZSD30.000e+071.22Uncharacterized protein (Fragment) OS=Elysia chlor... [more]
A0A267G6793.629e-1268.41Protein kinase C OS=Macrostomum lignano OX=282301 ... [more]
A0A2C9JQJ20.000e+073.32Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9JQI37.368e-1273.32Non-specific serine/threonine protein kinase OS=Bi... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkcba2.341e-870.33protein kinase C beta [Source:NCBI gene;Acc:103036... [more]
prkcbb2.365e-870.77protein kinase C beta type [Source:NCBI gene;Acc:1... [more]
prkcaa2.128e-968.89protein kinase C, alpha, a [Source:ZFIN;Acc:ZDB-GE... [more]
prkcaa2.242e-966.83protein kinase C, alpha, a [Source:ZFIN;Acc:ZDB-GE... [more]
prkcbb2.849e-17666.41protein kinase C beta type [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKCD5.989e-10255.52protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
PRKCD6.104e-10156.30protein kinase C delta [Source:HGNC Symbol;Acc:HGN... [more]
ENSPMAT00000008480.12.790e-8946.69pep scaffold:Pmarinus_7.0:GL482122:191709:206473:1... [more]
ENSPMAT00000006766.13.286e-8746.07pep scaffold:Pmarinus_7.0:GL478342:9725:27922:-1 g... [more]
ENSPMAT00000003714.13.089e-6566.67pep scaffold:Pmarinus_7.0:GL480823:68:8916:1 gene:... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PKC17.918e-8650.71Protein serine/threonine kinase; essential for cel... [more]
YPK17.734e-7643.37S/T protein kinase; phosphorylates, downregulates ... [more]
YPK21.442e-7444.09Protein kinase similar to S/T protein kinase Ypk1p... [more]
TPK33.804e-7341.79cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK21.392e-7141.05cAMP-dependent protein kinase catalytic subunit; p... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO449258.457e-14167.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355851.369e-12665.03Protein kinase C [Source:UniProtKB/TrEMBL;Acc:A7S... [more]
EDO449388.855e-9751.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378005.533e-8948.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433124.379e-7647.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkcba2.217e-1369.82protein kinase C beta type [Source:NCBI gene;Acc:1... [more]
PRKCB7.884e-1170.95protein kinase C beta [Source:NCBI gene;Acc:105353... [more]
prkcba5.233e-870.10protein kinase C beta type [Source:NCBI gene;Acc:1... [more]
PRKCB4.657e-770.95protein kinase C beta [Source:NCBI gene;Acc:105353... [more]
prkcab1.233e-869.85protein kinase C alpha type [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Protein kinase C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071570.17.506e-23100.00SMESG000071570.1[more]
SMESG000039865.11.139e-1772.87SMESG000039865.1[more]
SMESG000042308.12.124e-12061.30SMESG000042308.1[more]
SMESG000042308.19.003e-12061.30SMESG000042308.1[more]
SMESG000066024.15.946e-10153.61SMESG000066024.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021547 ID=SMED30021547|Name=Protein kinase C|organism=Schmidtea mediterranea sexual|type=transcript|length=2479bp
GTTTGGAATGAATCCTTTACTATGGATGTCACTAGGGGGTGTGTAGGGTG
CACCGGGTGGCATCATAATAAAAAAAATAGTGCAAATTTGTCAAAGCAGA
GAAAGTTCTGTCTAGTCGGGTTTTATAATCGTTTATTGTTAAATACATGA
GCAGTCACAGGGTGCCACCATGCAGAGCGTCTGGTGCTTAAATGAATATG
ACTCAGAGCTCAAAGCTGCTCGGAGCCTCGAAGTTTGAGTAGAATCGTGG
GTCATTTGCAAACACGCCAATTAATGACGTATGGAGTGACTGGGTTGCAG
AAAATTGTAGACGTTGTTTACAGAATATTCTACCATACCACCTGGAGGGT
ACAAATCAAAGATGCCTAGTGAATGCGAGCAGCGAAAAGCAAAGAAGAAA
AGATGTGAATCACTAAAATCGCTACCTGGATTCATGCTTCAGTATATCAA
GAGACCAAGTGATGGCCAAGGTTCAAAAGATGTTCTTCCTCAATCTACAA
TTGATATGGATTTCTCCCAGGTTGACAGCGTTCATTCTTCAAAAGAGCAA
CTAGAGCACGAGATTGATGCAGAAATACATAATGAAATAGCAGTGGATGA
AGTTGAAATAGAAATGCATGCTGAAAATGATTCTCGTCATGATACTGTAA
ATGTAATGAATCAATTGGGTGATAAAAATTGGAATATTTTATCTGATGCT
TCTTCCTGGAATGCGCAAGTTCCAGATCATTGTCGAGTTGAAATTATCAA
AAGAGGAAGTTATTATTTTCAGAACAAGGATGGGCCTTTCAATATTGTGA
CAAGGCAAGGTACAAAGACTAAAGGAGATGTGCGCCAGCTGTCAAAAGAA
TGGTTCTACAAGATGATGCCAAAGGGTGATAAAATACTGCGGTCATGGAT
GGTTTACTCGCTCGTCATGATTTATCAAAAGAAGATTTATCAAGACGGCT
TTCAGTGGAAGTTTGGGATTGGGATAGAACCACTCGCAATGATTTCATGG
GCTCATTGTCATTTGGTGTTAGTGAGCTTGTAAATAAGCCGGTTAATAAT
TGGTTCAAACTACTATCACAAGAAGAAGGAGAATTTTATGCAATTCAAGT
CACGGAAGAAGCAAGTGCAGCAATTATGGATCTCAGAAATCGATTTGAGC
GAGCATCGGCTGAAAGTCGTGAAAGGAAAAGTAAAAGCACTTCTGTGACA
ATGCCAGTTTCCAAACAAGATATTCCCCGATGTTCCGATTTCAACTTTCT
ATTGGTGCTCGGAAAAGGATCGTTTGGAAAGGTGATGCTTACGGAAAGGA
AAGGTACAGATGAACTTTATGCAATAAAAATCCTTAAAAAGGATGTGATA
ATCCAAGACGATGATATAGAATGTACAATGATTGAGAAGAGAGTTTTAGC
TCTTCAAGGGAAACCTCCAATGCTCGTTCAGTTGCATTCTTGTTTTCAAA
CAATGGATAGATTGTATTTTGTAATGGAATACGTAAATGGAGGGGATCTC
ATGTATCGAATACAGCAAGAAGGGAAATTTAAAGAGCCTGTCGCTGTATT
TTATTCTGCTGAAATAGCTGTTGGTCTCATATTTTTGCACAATCATGGAA
TCATTTATAGAGATCTAAAATTGGACAACGTACTGCTGGACTCCGAAGGC
CACATAAAAATTGCTGATTTTGGAATGTGTAAGGAAAATATAGTCGGAAA
TTCAACGACTAAAACTTTTTGTGGCACTCCAGATTATATTGCACCAGAAA
TTATCAAATATCAGCCCTATGGGAAATCCGTCGATTGGTGGGCATTTGGC
GTTCTGCTTTATGAGATGTTGGCTGGACAGCCACCATTTGATGGGGAAGA
TGAGGAAGATTTGTTCAATTCAATTACGAACCACAATGTATCTTTTCCTA
GGAGCATGTCAAGAGAAGCAGTTAATATATGCAGAGGACTAATGACAAAA
GAGATAAATAAACGCTTGGGATGTGGTTTAAATGGAGTTCGTCAAATACA
AGAACATGTATTTTTTAGGAGAATTGAGTGGGACAAAATTGAATTGCGGG
AAATTCAGCCCCCATATAAACCAAAAAAAATAAGCGTGACGTTAGCAATT
TCGATAAGTTATTTACAAAGGAACAGCACCAAATGACTCCAACCGACAAG
CTTTTCATAATGAATTTAGATCAGACGGAATTTGCAGGATTCTCATTTGT
CAATCCTGAATTCGTTGTGGAGGTCTGATTGGTCGAAATCTGGAAATTTG
AAAACGATAAAACTGAAATTATTGTCAATTTAGTCCTTTTTAATTATTGA
CCATGATTGCAACTGTTTTATCAATTTTTTCTGATTAAGTGGTTGAGTTT
TACTGATTTTTTTTTATTATATTTATTCTTTGTTTTATTTAATTTTATTC
TAATTAAATAAATGAAATTATCCCCAATTATTTGTACTACTCTAATTTTA
TCAAATTAATATTTTTATCTCAAAAAAAA
back to top

protein sequence of SMED30021547-orf-1

>SMED30021547-orf-1 ID=SMED30021547-orf-1|Name=SMED30021547-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=414bp
MDGLLARHDLSKEDLSRRLSVEVWDWDRTTRNDFMGSLSFGVSELVNKPV
NNWFKLLSQEEGEFYAIQVTEEASAAIMDLRNRFERASAESRERKSKSTS
VTMPVSKQDIPRCSDFNFLLVLGKGSFGKVMLTERKGTDELYAIKILKKD
VIIQDDDIECTMIEKRVLALQGKPPMLVQLHSCFQTMDRLYFVMEYVNGG
DLMYRIQQEGKFKEPVAVFYSAEIAVGLIFLHNHGIIYRDLKLDNVLLDS
EGHIKIADFGMCKENIVGNSTTKTFCGTPDYIAPEIIKYQPYGKSVDWWA
FGVLLYEMLAGQPPFDGEDEEDLFNSITNHNVSFPRSMSREAVNICRGLM
TKEINKRLGCGLNGVRQIQEHVFFRRIEWDKIELREIQPPYKPKKISVTL
AISISYLQRNSTK*
back to top

protein sequence of SMED30021547-orf-2

>SMED30021547-orf-2 ID=SMED30021547-orf-2|Name=SMED30021547-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=224bp
MPSECEQRKAKKKRCESLKSLPGFMLQYIKRPSDGQGSKDVLPQSTIDMD
FSQVDSVHSSKEQLEHEIDAEIHNEIAVDEVEIEMHAENDSRHDTVNVMN
QLGDKNWNILSDASSWNAQVPDHCRVEIIKRGSYYFQNKDGPFNIVTRQG
TKTKGDVRQLSKEWFYKMMPKGDKILRSWMVYSLVMIYQKKIYQDGFQWK
FGIGIEPLAMISWAHCHLVLVSL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004698calcium-dependent protein kinase C activity
GO:0004674protein serine/threonine kinase activity
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0005515protein binding
GO:0000166nucleotide binding
GO:0004697protein kinase C activity
GO:0008270zinc ion binding
GO:0016301kinase activity
GO:0016740transferase activity
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR017892Pkinase_C
IPR000961AGC-kinase_C
IPR000719Prot_kinase_dom
IPR000008C2_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0035556intracellular signal transduction
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 70..90
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 66..358
e-value: 7.1E-37
score: 124.7
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 114..199
e-value: 7.4E-128
score: 428.0
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 200..395
e-value: 7.4E-128
score: 428.0
NoneNo IPR availablePANTHERPTHR24351:SF193coord: 10..399
NoneNo IPR availablePANTHERPTHR24351RIBOSOMAL PROTEIN S6 KINASEcoord: 10..399
NoneNo IPR availableCDDcd05587STKc_cPKCcoord: 119..394
e-value: 0.0
score: 609.778
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 10..64
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 116..374
e-value: 1.9E-92
score: 323.1
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 121..374
e-value: 1.3E-64
score: 218.1
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 116..374
score: 46.93
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 6..74
e-value: 1.3E-14
score: 56.0
IPR000008C2 domainPFAMPF00168C2coord: 15..56
e-value: 7.2E-5
score: 23.0
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 122..145
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 236..248
IPR000961AGC-kinase, C-terminalPROSITEPS51285AGC_KINASE_CTERcoord: 375..413
score: 9.657
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 100..405