glutathione S transferase-1

Overview
Nameglutathione S transferase-1 (AFJ24753.1)
Smed IDSMED30021545
Length (bp)793
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of glutathione S transferase-1 (SMED30021545) t-SNE clustered cells

Violin plots show distribution of expression levels for glutathione S transferase-1 (SMED30021545) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of glutathione S transferase-1 (SMED30021545) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for glutathione S transferase-1 (SMED30021545) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021545

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30021545SMESG000023958.1 Contig217GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30021545SMESG000003087.1 PL06010B2A03ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30021545SMESG000003087.1 Contig217GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30021545SMESG000003087.1 dd_Smed_v4_20_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021545SMESG000003087.1 dd_Smed_v4_20_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
tailSMED30021545SMESG000003087.1 dd_Smed_v6_20_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
intestinal phagocyteSMED30021545SMESG000003087.1 dd_Smed_v6_20_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30021545SMESG000003087.1 dd_Smed_v6_20_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021545SMESG000003087.1 dd_Smed_v6_20_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30021545SMESG000003087.1 dd_Smed_v6_20_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
goblet cellSMED30021545SMESG000003087.1 dd_Smed_v6_20_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of glutathione S transferase-1 vs. Ensembl Human
Match: HPGDS (hematopoietic prostaglandin D synthase [Source:HGNC Symbol;Acc:HGNC:17890])

HSP 1 Score: 112.464 bits (280), Expect = 6.707e-30
Identity = 63/204 (30.88%), Postives = 111/204 (54.41%), Query Frame = 1
Query:  160 MSTVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEK---KEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDYLVKL-PQLYDDFPKLKELRERILKANTDVEEWVNTRPVTEM 759
            M   K+TYF+ RGRAE+IR +     I+++D RI +  WPE+K T P GK+P++E +G  L QS+AIAR + +     G  + E    +  +  +VD L+     +   E+K   KE++  E +  +    ++ L+ ++    +  G  +T A+ ++ + S  L+   P L D+ P+L  LR+++ +A   V  W+  RP T++
Sbjct:    1 MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLTLHQSLAIARYLTKNTDLAGNTEME----QCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELLTYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKKV-QAIPAVANWIKRRPQTKL 199          
BLAST of glutathione S transferase-1 vs. Ensembl Human
Match: GSTM3 (glutathione S-transferase mu 3 [Source:HGNC Symbol;Acc:HGNC:4635])

HSP 1 Score: 71.2478 bits (173), Expect = 3.256e-14
Identity = 55/191 (28.80%), Postives = 98/191 (51.31%), Query Frame = 1
Query:  163 STVKVTYFDARGRAELIRLVLKASKIEFKDVRIT--------KDKWPEVKPTTPTG--KLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYV-ATSGRDNLKALEGFIKETGFFAGEKITLAE-LFFLVVSDYLVKLPQLYDDFPKLKELRER 699
            S++ + Y+D RG A  IRL+L+ +   +++ R T        + +W +VK         LP +     ++TQS AI R +ARKH   GE ++E   V+    Q++D    L ++ ++ +   E+L+ +Y+    G+  LK    F+ +  +FAGEK+T  + L + ++    +  P+  D+FP LK    R
Sbjct:    5 SSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDH--EKLKPQYLEELPGQ--LKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCR 191          
BLAST of glutathione S transferase-1 vs. Ensembl Human
Match: GSTM3 (glutathione S-transferase mu 3 [Source:HGNC Symbol;Acc:HGNC:4635])

HSP 1 Score: 71.2478 bits (173), Expect = 3.256e-14
Identity = 55/191 (28.80%), Postives = 98/191 (51.31%), Query Frame = 1
Query:  163 STVKVTYFDARGRAELIRLVLKASKIEFKDVRIT--------KDKWPEVKPTTPTG--KLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYV-ATSGRDNLKALEGFIKETGFFAGEKITLAE-LFFLVVSDYLVKLPQLYDDFPKLKELRER 699
            S++ + Y+D RG A  IRL+L+ +   +++ R T        + +W +VK         LP +     ++TQS AI R +ARKH   GE ++E   V+    Q++D    L ++ ++ +   E+L+ +Y+    G+  LK    F+ +  +FAGEK+T  + L + ++    +  P+  D+FP LK    R
Sbjct:    5 SSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDH--EKLKPQYLEELPGQ--LKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCR 191          
BLAST of glutathione S transferase-1 vs. Ensembl Human
Match: GSTM3 (glutathione S-transferase mu 3 [Source:HGNC Symbol;Acc:HGNC:4635])

HSP 1 Score: 70.4774 bits (171), Expect = 4.882e-14
Identity = 55/192 (28.65%), Postives = 98/192 (51.04%), Query Frame = 1
Query:  163 STVKVTYFDARGRAELIRLVLKASKIEFKDVRIT--------KDKWPEVKPTTPTG--KLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYV-ATSGRDNLKALEGFIKETGFFAGEKITLAE-LFFLVVSDYLVKLPQLYDDFPKLKELRERI 702
            S++ + Y+D RG A  IRL+L+ +   +++ R T        + +W +VK         LP +     ++TQS AI R +ARKH   GE ++E   V+    Q++D    L ++ ++ +   E+L+ +Y+    G+  LK    F+ +  +FAGEK+T  + L + ++    +  P+  D+FP LK    R 
Sbjct:    5 SSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLDFPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCYSSDH--EKLKPQYLEELPGQ--LKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRF 192          
BLAST of glutathione S transferase-1 vs. Ensembl Human
Match: GSTM4 (glutathione S-transferase mu 4 [Source:HGNC Symbol;Acc:HGNC:4636])

HSP 1 Score: 64.6994 bits (156), Expect = 4.574e-12
Identity = 50/189 (26.46%), Postives = 91/189 (48.15%), Query Frame = 1
Query:  166 TVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTG----------KLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAE-LFFLVVSDYLVKLPQLYDDFPKLKELRER 699
            ++ + Y+D RG A  IRL+L+ +   +++ + T    P+   +               LP +     ++TQS AI   +ARKH   GE ++E   V+    Q +DV   L ++ ++P+   E+L+ EY+       ++    F+ +  +F G+KIT  + L + V+  + +  P   D FP LK+   R
Sbjct:    2 SMTLGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPD--FEKLKPEYLEELPT-MMQHFSQFLGKRPWFVGDKITFVDFLAYDVLDLHRIFEPNCLDAFPNLKDFISR 187          
BLAST of glutathione S transferase-1 vs. Ensembl Celegans
Match: gst-3 (Glutathione S-transferase 3 [Source:UniProtKB/Swiss-Prot;Acc:O16116])

HSP 1 Score: 107.071 bits (266), Expect = 4.740e-28
Identity = 69/209 (33.01%), Postives = 119/209 (56.94%), Query Frame = 1
Query:  160 MSTVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFA-----PEEKKEELRAEYVATSGRDNLKALEGFIKE--TGFFAGEKITLAELFFLVVSDYLVKL--PQLYD--DFPKLKELRERILKANTDVEEWVNTRPVT 753
            M   K+TYF+ARG AE+ R +   + +EF+D RI ++K+ ++KPT P+G++P++  +G Q +QS AIAR +ARK GF+G+  +E    +  +    D +E   K   A      EE  + +R E +  + +     L+  +++  +G+  G ++T A+   LV++D L  L   +L D  +   LKE RE+I++    ++EW+  RP T
Sbjct:    1 MVHYKLTYFNARGLAEISRQLFHMAGVEFEDERINEEKFSQLKPTFPSGQVPILCIDGAQFSQSTAIARYLARKFGFVGQTAEEELQADEVVDTFKDFIESFRKFVIAVLSGESEEILKNIREEVIKPAVKTYTAYLKAILEKSSSGYLVGNELTWAD---LVIADNLTTLINAELLDIENDKLLKEFREKIIE-TPKLKEWLAKRPET 205          
BLAST of glutathione S transferase-1 vs. Ensembl Celegans
Match: gst-11 (Glutathione S-Transferase [Source:UniProtKB/TrEMBL;Acc:Q21945])

HSP 1 Score: 105.916 bits (263), Expect = 1.033e-27
Identity = 65/201 (32.34%), Postives = 111/201 (55.22%), Query Frame = 1
Query:  172 KVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEE--KKEELRAEYVATSGRDNLKALEGFI--KETGFFAGEKITLAELFFLVVSDYLVK--LPQLYDDFPKLKELRERILKANTDVEEWVNTRPVTE 756
            K+ YF+  GRAE  RL+   + +++ D R+ K  WPE+K TTP GKLPV+  +G +L QS  I R + +  G  GE D E   ++  +  + D L  + + +F  ++  KK E+  + + ++    + A E  +    TG+F G+KI+ A+L    +  ++    LP     +PKL+E  E+I   ++ ++ W+N+RP TE
Sbjct:    4 KLQYFNMMGRAEPARLIFAYAGVQYTDERVEKSAWPEIKATTPHGKLPVLYVDGAKLAQSRVIERYLGKVFGLAGETDWETAKMDELVACVEDFLIEI-QPWFKEQDNAKKVEIFKKLIESTIIPFISAFENILVTNGTGYFVGDKISYADLAIFHIFWFMNSKILPGALRKYPKLQEFIEKITAIDS-IKSWINSRPKTE 202          
BLAST of glutathione S transferase-1 vs. Ensembl Celegans
Match: gst-7 (Probable glutathione S-transferase 7 [Source:UniProtKB/Swiss-Prot;Acc:P91253])

HSP 1 Score: 102.064 bits (253), Expect = 3.416e-26
Identity = 71/208 (34.13%), Postives = 110/208 (52.88%), Query Frame = 1
Query:  160 MSTVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEG-----LYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKE--TGFFAGEKITLAELFFLVVSD---YLVKLPQLYDDFPKLKELRERILKANTDVEEWVNTRPVT 753
            M   KV+YF  RG  E+ R +L  +  +F+D RI K++WP VKP+TP G+LP++E +GK L QS AIAR +AR+ G  G+   E   V     Q  D L       + K+ FA E   + L  +      + +      F+K   +G+  G+ +T  +L  LV       L     L D+FP+ K  +E++  +N ++++W+ TRPVT
Sbjct:    1 MVHYKVSYFPIRGAGEIARQILAYAGQDFEDNRIPKEEWPAVKPSTPFGQLPLLEVDGKVLAQSHAIARYLARQFGINGKCAWEEAQVNSVADQFKDYLNEVRPYFMVKMGFA-EGDLDALAKDVFLPGFKKHYGFFANFLKSAGSGYLVGDSLTFVDL--LVAQHTADLLAANAALLDEFPQFKAHQEKV-HSNANIKKWLETRPVT 204          
BLAST of glutathione S transferase-1 vs. Ensembl Celegans
Match: gst-16 (Glutathione S-Transferase [Source:UniProtKB/TrEMBL;Acc:Q93698])

HSP 1 Score: 102.064 bits (253), Expect = 3.938e-26
Identity = 75/213 (35.21%), Postives = 116/213 (54.46%), Query Frame = 1
Query:  160 MSTVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDK-WPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPE-------EKKEELRAEYVATSGRDNLKALEGFIKE--TGFFAGEKITLAELFFLVVSDYLVKLPQ--LYD--DFPKLKELRERILKANTDVEEWVNTRPVTE 756
            M + K+TYF  RG  E IRL+   + ++F++VR+  D+ W ++K +TP  +LPV+  +G +L QS AI R +ARK GF G+  +E   V+       D L    K  FA E       E+ E+ R+E+   +       L G +++  +GF  G  IT A+   LVV D L+ L    L+D  +F KL  LRE++  +   ++E++  RPVTE
Sbjct:    1 MPSYKLTYFFFRGLGEPIRLLFHLAGVQFEEVRMNPDQTWLDIKDSTPMKQLPVLNIDGFELPQSGAILRYLARKFGFAGKTPEEEAWVDAVHDLFKDFLAEFKK--FAAERRSGKSAEEVEKFRSEFFLPARNTYFNILNGLLEKSNSGFLIGSDITFAD---LVVVDNLLTLKNYGLFDESEFTKLAALREKV-NSYPGIKEYIAKRPVTE 207          
BLAST of glutathione S transferase-1 vs. Ensembl Celegans
Match: gst-8 (Probable glutathione S-transferase 8 [Source:UniProtKB/Swiss-Prot;Acc:P91254])

HSP 1 Score: 100.523 bits (249), Expect = 1.285e-25
Identity = 65/208 (31.25%), Postives = 109/208 (52.40%), Query Frame = 1
Query:  160 MSTVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEG-----LYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKE--TGFFAGEKITLAELFFLV-VSDYLVKLPQLYDDFPKLKELRERILKANTDVEEWVNTRPVTEM 759
            M   K++YF  RG  E+IR +   +   F+D RI+ ++W  VKPTTP G+LP++E +GK L QS +IAR +AR+ G  G+   E   V     Q  D         + K+ FA E   + L  +      + +   +  F+K   +G+  G+ +T  +L      +D L   P L ++FP+ K  +E++  +N ++++W+ TRP T+ 
Sbjct:    1 MVHYKLSYFPIRGAGEVIRQIFVYAGQSFEDHRISIEEWAAVKPTTPFGQLPLLEVDGKVLPQSHSIARFLARQFGINGKCAWEEAQVNSIADQFKDYRNEVRPYVMVKMGFA-EGDLDALSKDVFLPGFKKHYGFIYNFLKTAGSGYLVGDSLTFVDLLIAQHTADILSTDPALLEEFPQFKAHQEKV-HSNANIKKWLETRPETQF 206          
BLAST of glutathione S transferase-1 vs. Ensembl Fly
Match: GstS1 (gene:FBgn0010226 transcript:FBtr0087005)

HSP 1 Score: 98.5969 bits (244), Expect = 2.417e-24
Identity = 60/201 (29.85%), Postives = 114/201 (56.72%), Query Frame = 1
Query:  181 YFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEE-----LRAEYVATSGRDNLKALEGFIKET-GFFAGEKITLAELFFLVVSDYLVKLPQ--LYDDFPKLKELRERILKANTDVEEWVNTRPVTEM 759
            YF+ +  AE +R +      E++DVR+T+D+WP +KPT P G++PV+E +GK++ QS+++AR +A+  G  G    E   ++  +  + D    +  + + PE++ +E     L AE +       L+ LE  +K+  G  A  K+T A+++F  ++DY+  + +  L + +P L+ + + +  A   ++ W+  RPVTE+
Sbjct:   54 YFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVDGKRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLKIAVVSYEPEDEIKEKKLVTLNAEVIPFY----LEKLEQTVKDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDAV-NALEPIKAWIEKRPVTEV 249          
BLAST of glutathione S transferase-1 vs. Ensembl Fly
Match: GstS1 (gene:FBgn0010226 transcript:FBtr0100258)

HSP 1 Score: 98.5969 bits (244), Expect = 2.417e-24
Identity = 60/201 (29.85%), Postives = 114/201 (56.72%), Query Frame = 1
Query:  181 YFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEE-----LRAEYVATSGRDNLKALEGFIKET-GFFAGEKITLAELFFLVVSDYLVKLPQ--LYDDFPKLKELRERILKANTDVEEWVNTRPVTEM 759
            YF+ +  AE +R +      E++DVR+T+D+WP +KPT P G++PV+E +GK++ QS+++AR +A+  G  G    E   ++  +  + D    +  + + PE++ +E     L AE +       L+ LE  +K+  G  A  K+T A+++F  ++DY+  + +  L + +P L+ + + +  A   ++ W+  RPVTE+
Sbjct:   54 YFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVDGKRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLKIAVVSYEPEDEIKEKKLVTLNAEVIPFY----LEKLEQTVKDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDAV-NALEPIKAWIEKRPVTEV 249          
BLAST of glutathione S transferase-1 vs. Ensembl Fly
Match: GstS1 (gene:FBgn0010226 transcript:FBtr0087006)

HSP 1 Score: 98.5969 bits (244), Expect = 2.417e-24
Identity = 60/201 (29.85%), Postives = 114/201 (56.72%), Query Frame = 1
Query:  181 YFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEE-----LRAEYVATSGRDNLKALEGFIKET-GFFAGEKITLAELFFLVVSDYLVKLPQ--LYDDFPKLKELRERILKANTDVEEWVNTRPVTEM 759
            YF+ +  AE +R +      E++DVR+T+D+WP +KPT P G++PV+E +GK++ QS+++AR +A+  G  G    E   ++  +  + D    +  + + PE++ +E     L AE +       L+ LE  +K+  G  A  K+T A+++F  ++DY+  + +  L + +P L+ + + +  A   ++ W+  RPVTE+
Sbjct:   54 YFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVDGKRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLKIAVVSYEPEDEIKEKKLVTLNAEVIPFY----LEKLEQTVKDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDAV-NALEPIKAWIEKRPVTEV 249          
BLAST of glutathione S transferase-1 vs. Ensembl Fly
Match: GstS1 (gene:FBgn0010226 transcript:FBtr0333551)

HSP 1 Score: 95.9005 bits (237), Expect = 2.005e-23
Identity = 61/202 (30.20%), Postives = 114/202 (56.44%), Query Frame = 1
Query:  181 YFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDV-LEGLYKIYFAPEEKKEE-----LRAEYVATSGRDNLKALEGFIKET-GFFAGEKITLAELFFLVVSDYLVKLPQ--LYDDFPKLKELRERILKANTDVEEWVNTRPVTEM 759
            YF+ +  AE +R +      E++DVR+T+D+WP +KPT P G++PV+E +GK++ QS+++AR +A+  G  G    E   ++  +  + D  L     + + PE++ +E     L AE +       L+ LE  +K+  G  A  K+T A+++F  ++DY+  + +  L + +P L+ + + +  A   ++ W+  RPVTE+
Sbjct:   54 YFNVKALAEPLRYLFAYGNQEYEDVRVTRDEWPALKPTMPMGQMPVLEVDGKRVHQSISMARFLAKTVGLCGATPWEDLQIDIVVDTINDFRLSSEQFVSYEPEDEIKEKKLVTLNAEVIPFY----LEKLEQTVKDNDGHLALGKLTWADVYFAGITDYMNYMVKRDLLEPYPALRGVVDAV-NALEPIKAWIEKRPVTEV 250          
BLAST of glutathione S transferase-1 vs. Ensembl Zebrafish
Match: gsta.1 (glutathione S-transferase, alpha tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2720])

HSP 1 Score: 72.7886 bits (177), Expect = 6.803e-15
Identity = 51/183 (27.87%), Postives = 98/183 (53.55%), Query Frame = 1
Query:  169 VKVTYFDARGRAELIRLVLKASKIEFKDVRITK----DKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDYLVKL-PQLYDDFPKLKELRERI 702
            V + YF+ RG+ E IR +L A+ ++F++V +T+    DK       T   ++P+VE +G +L QS AI   +A K+   G+D KE  +++     ++D++E +    F P E KE++ +     +    L   E  +  + F  G++++ A++  L  +  L +L P +   FPK++  +E++
Sbjct:    5 VVLHYFNGRGKMESIRWLLAAAGVQFEEVFLTEKEQFDKLLSDGALT-FQQVPLVEIDGMKLVQSKAILNYIAGKYNLYGKDLKERAMIDIYSEGLIDLMEMIMVSPFTPAENKEKVFSNIEEKAKVRFLPVFEKALANSSFLVGKQLSRADVHLLEATLMLQELFPSILATFPKIQAFQEQM 186          
BLAST of glutathione S transferase-1 vs. Ensembl Zebrafish
Match: gsta.1 (glutathione S-transferase, alpha tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2720])

HSP 1 Score: 72.7886 bits (177), Expect = 6.803e-15
Identity = 51/183 (27.87%), Postives = 98/183 (53.55%), Query Frame = 1
Query:  169 VKVTYFDARGRAELIRLVLKASKIEFKDVRITK----DKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDYLVKL-PQLYDDFPKLKELRERI 702
            V + YF+ RG+ E IR +L A+ ++F++V +T+    DK       T   ++P+VE +G +L QS AI   +A K+   G+D KE  +++     ++D++E +    F P E KE++ +     +    L   E  +  + F  G++++ A++  L  +  L +L P +   FPK++  +E++
Sbjct:    5 VVLHYFNGRGKMESIRWLLAAAGVQFEEVFLTEKEQFDKLLSDGALT-FQQVPLVEIDGMKLVQSKAILNYIAGKYNLYGKDLKERAMIDIYSEGLIDLMEMIMVSPFTPAENKEKVFSNIEEKAKVRFLPVFEKALANSSFLVGKQLSRADVHLLEATLMLQELFPSILATFPKIQAFQEQM 186          
BLAST of glutathione S transferase-1 vs. Ensembl Zebrafish
Match: gstp2 (glutathione S-transferase pi 2 [Source:ZFIN;Acc:ZDB-GENE-050601-1])

HSP 1 Score: 70.0922 bits (170), Expect = 4.344e-14
Identity = 54/186 (29.03%), Postives = 90/186 (48.39%), Query Frame = 1
Query:  160 MSTVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKW--PEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFI--KETGFFAGEKITLAEL-FFLVVSDYLVKLPQLYDDFPKLKELRERI 702
            M+   +TYF  +GRA  ++++L   + + K+  +T   W   +++ T   G+LP  E     L QS AI R + RKHG  G++D E  L++     M D  + L + Y     ++ E   E       +  K  E  +   +TGF  G++I+LA+   F ++ +  V  P   D FP LK   ++I
Sbjct:    1 MAPYTLTYFAIKGRAGPLKILLADKEQQLKENVVTVQDWMKGDIRATCLFGQLPKFEDGDLVLYQSNAILRHLGRKHGAYGKNDCEASLID----MMNDAAQDLRQKYIKLIYQEYETGKEAFIKDLPNEFKPFENILAKSKTGFLVGDQISLADYNLFDLLLNLKVLSPSCLDSFPSLKSFVDKI 182          
BLAST of glutathione S transferase-1 vs. Ensembl Zebrafish
Match: AL929536.3 (pep chromosome:GRCz11:13:835390:840787:1 gene:ENSDARG00000113274.1 transcript:ENSDART00000171329.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL929536.3)

HSP 1 Score: 69.707 bits (169), Expect = 6.866e-14
Identity = 49/182 (26.92%), Postives = 97/182 (53.30%), Query Frame = 1
Query:  169 VKVTYFDARGRAELIRLVLKASKIEFKDVRIT-KDKWPEVKP--TTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDYLVKL-PQLYDDFPKLKELRERI 702
            V + YF+ RGR E IR +L A+ ++F++V +T K+++ ++         ++P+VE +G +L QS AI   +A K+   G+D KE  +++     ++D++  +    F P E KEE        +    L   E  +  + F  G++++ A++  L  +  L +L P +   FPK++  ++++
Sbjct:    5 VVLHYFNGRGRMESIRWLLAAAGVQFEEVFLTEKEQFDKLLSDGVLTFQQVPLVEIDGMKLVQSKAILNYIAGKYNLYGKDLKERAMIDIYSEGLIDLMGMIIMAPFTPAENKEETFRNIEEKAKVRFLPVFEKALANSSFLVGKQLSRADVHLLEATLMLQELFPSILATFPKIQAFQDQM 186          
BLAST of glutathione S transferase-1 vs. Ensembl Zebrafish
Match: AL929536.1 (pep chromosome:GRCz11:CHR_ALT_CTG13_1_1:843683:849080:1 gene:ENSDARG00000110578.1 transcript:ENSDART00000182617.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL929536.1)

HSP 1 Score: 69.707 bits (169), Expect = 6.866e-14
Identity = 49/182 (26.92%), Postives = 97/182 (53.30%), Query Frame = 1
Query:  169 VKVTYFDARGRAELIRLVLKASKIEFKDVRIT-KDKWPEVKP--TTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDYLVKL-PQLYDDFPKLKELRERI 702
            V + YF+ RGR E IR +L A+ ++F++V +T K+++ ++         ++P+VE +G +L QS AI   +A K+   G+D KE  +++     ++D++  +    F P E KEE        +    L   E  +  + F  G++++ A++  L  +  L +L P +   FPK++  ++++
Sbjct:    5 VVLHYFNGRGRMESIRWLLAAAGVQFEEVFLTEKEQFDKLLSDGVLTFQQVPLVEIDGMKLVQSKAILNYIAGKYNLYGKDLKERAMIDIYSEGLIDLMGMIIMAPFTPAENKEETFRNIEEKAKVRFLPVFEKALANSSFLVGKQLSRADVHLLEATLMLQELFPSILATFPKIQAFQDQM 186          
BLAST of glutathione S transferase-1 vs. Ensembl Xenopus
Match: hpgds (hematopoietic prostaglandin D synthase [Source:NCBI gene;Acc:448666])

HSP 1 Score: 113.62 bits (283), Expect = 1.946e-30
Identity = 63/197 (31.98%), Postives = 105/197 (53.30%), Query Frame = 1
Query:  160 MSTVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDYLVK-LPQLYDDFPKLKELRERILKANTDVEEWVNTRP 747
            M +  + YF+  GR E++R +   S I F+D RI    WP +KP  P G+LPVVE +G    QS+A+ R +A+K G +G++D    L E  +  ++D ++  +  +  P    E+ + E++  SG   L  LE  +    +F G+ +T A+ ++   SD     +P    D+PKL  L++R+ KA   +  W+  RP
Sbjct:    1 MPSYTLKYFNLEGRGEILRYLFSYSDIPFEDQRIEFADWPALKPKIPYGQLPVVEIDGVIYNQSLAVGRYLAKKGGLIGKND----LDEIRVDALIDTIDDFFSKF--PWMDTEKAKKEFMEKSGPQLLSYLEKTLGNNSWFVGDSVTWADFYWDTCSDSFENYVPGFAKDYPKLLALKDRV-KAIPAIAAWIKKRP 190          
BLAST of glutathione S transferase-1 vs. Ensembl Xenopus
Match: gnrhr (gonadotropin releasing hormone receptor [Source:Xenbase;Acc:XB-GENE-5753573])

HSP 1 Score: 67.781 bits (164), Expect = 4.743e-13
Identity = 60/213 (28.17%), Postives = 99/213 (46.48%), Query Frame = 1
Query:  160 MSTVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWP----EVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYK-----IYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFL-VVSDYLVKLPQLYDDFPKLKELRERILKANTDVEEWVNT-----RPVT 753
            MS   +TYF  RGRAE IRL+L    I +++  +    W     + +     G+LP  +     L QS +I R +A KHG  G++D+E       I  + D +E L K     IYF  +EK +    E +        + L      + F  G+KI+ A+   + ++  +L   P+    FP L+   ER++   T + +++N+     RP+T
Sbjct:    1 MSGYTLTYFPVRGRAEAIRLLLADQDIPWEEDEVQWQDWCSGNHDERKKAVFGRLPQFQNGDFVLCQSNSILRYLAHKHGLTGDNDEE----SAHIDMVNDSVEDLRKKYGRFIYFTCQEKGKGKYLEGLPQQLEFFERVLSKNHNGSKFVVGQKISYADYNLVDLLQCHLDLSPECLSAFPLLRAYLERLVSQPT-LSDYLNSDARKRRPIT 208          
BLAST of glutathione S transferase-1 vs. Ensembl Xenopus
Match: ENSXETT00000044740.1 (glutathione S-transferase 3-like [Source:NCBI gene;Acc:100496158])

HSP 1 Score: 65.855 bits (159), Expect = 2.966e-12
Identity = 53/187 (28.34%), Postives = 94/187 (50.27%), Query Frame = 1
Query:  181 YFDARGRAELIRLVLKASKIEFKDVRITKDKWPEV---KPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIY-FAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDYLVKLPQLYDD----FPKLKELRERILKANT 717
            YF+ RGR E IR +L A+ IEF++V + K +  E    +     G++P+VE +G  LTQ+  I   +A K+   G+D KE Y ++R     +D++ GL   Y F  +  KE+ +      +        E  +K+  +  G K + A++  +   + ++ + + + D    FP+L+  +ER  K  T
Sbjct:    9 YFNGRGRMESIRWLLGAAGIEFEEVYLEKREQYEQLIKEGRLMFGQVPLVEMDGMNLTQTHPILSYIAAKYNLYGKDPKERYEIDRYADGTIDLM-GLGLAYPFLDDAGKEKQKGLIKERATNKYFPVYETALKDKDYLVGNKFSWADIQLM---EAILMVEEFHSDILSCFPQLQAFKERTKKMPT 191          
BLAST of glutathione S transferase-1 vs. Ensembl Xenopus
Match: ENSXETT00000044727.1 (glutathione S-transferase 3-like [Source:NCBI gene;Acc:100496158])

HSP 1 Score: 65.855 bits (159), Expect = 3.243e-12
Identity = 53/187 (28.34%), Postives = 94/187 (50.27%), Query Frame = 1
Query:  181 YFDARGRAELIRLVLKASKIEFKDVRITKDKWPEV---KPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIY-FAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDYLVKLPQLYDD----FPKLKELRERILKANT 717
            YF+ RGR E IR +L A+ IEF++V + K +  E    +     G++P+VE +G  LTQ+  I   +A K+   G+D KE Y ++R     +D++ GL   Y F  +  KE+ +      +        E  +K+  +  G K + A++  +   + ++ + + + D    FP+L+  +ER  K  T
Sbjct:   36 YFNGRGRMESIRWLLGAAGIEFEEVYLEKREQYEQLIKEGRLMFGQVPLVEMDGMNLTQTHPILSYIAAKYNLYGKDPKERYEIDRYADGTIDLM-GLGLAYPFLDDAGKEKQKGLIKERATNKYFPVYETALKDKDYLVGNKFSWADIQLM---EAILMVEEFHSDILSCFPQLQAFKERTKKMPT 218          
BLAST of glutathione S transferase-1 vs. Ensembl Xenopus
Match: gnrhr (gonadotropin releasing hormone receptor [Source:Xenbase;Acc:XB-GENE-5753573])

HSP 1 Score: 65.0846 bits (157), Expect = 6.258e-12
Identity = 59/216 (27.31%), Postives = 100/216 (46.30%), Query Frame = 1
Query:  151 FGNMSTVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWP----EVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYK-----IYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFL-VVSDYLVKLPQLYDDFPKLKELRERILKANTDVEEWVNT-----RPVT 753
            F  +S   +TY+  RGRAE IRL+L    I +++  +    W     + +     G+LP  +     L QS +I R +A KHG  G++D+E       I  + D +E L K     IYF  +EK +    E +        + L      + F  G+KI+ A+   + ++  +L   P+    FP L+   ER++   T + +++N+     RP+T
Sbjct:   14 FPLVSGYTLTYYPVRGRAEAIRLLLADQDIPWEEDEVQWQDWCSGNHDERKKAVFGRLPQFQNGDFVLCQSNSILRYLAHKHGLTGDNDEE----SAHIDMVNDSVEDLRKKYGRFIYFTCQEKGKGKYLEGLPQQLEFFERVLSKNHNGSKFVVGQKISYADYNLVDLLQCHLDLSPECLSAFPLLRAYLERLVSQPT-LSDYLNSDARKRRPIT 224          
BLAST of glutathione S transferase-1 vs. Ensembl Mouse
Match: Hpgds (hematopoietic prostaglandin D synthase [Source:MGI Symbol;Acc:MGI:1859384])

HSP 1 Score: 110.923 bits (276), Expect = 2.168e-29
Identity = 64/201 (31.84%), Postives = 109/201 (54.23%), Query Frame = 1
Query:  160 MSTVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDYLVKL-PQLYDDFPKLKELRERILKANTDVEEWVNTRPVTEM 759
            M   K+ YF+ RGRAE+IR +     I+++D RI +  WP++KPT P GK+PV+E EG  + QS+AIAR + +     G+   E    +  +  + D +  L+      ++ KE +  E +       LK L+ ++ +  +F G  +T A+ ++ + S  L+ L P L D +PKL  LR ++ +A   +  W+  RP T++
Sbjct:    1 MPNYKLLYFNMRGRAEIIRYIFAYLDIKYEDHRIEQADWPKIKPTLPFGKIPVLEVEGLTIHQSLAIARYLTKNTDLAGKTALEQCQADAVVDTLDDFM-SLFPWAEKDQDLKERMFNELLTHQAPRLLKDLDTYLGDKEWFIGNYVTWADFYWDICSTTLLVLKPGLLDIYPKLVSLRNKV-QAIPAISAWILKRPQTKL 199          
BLAST of glutathione S transferase-1 vs. Ensembl Mouse
Match: Gstm4 (glutathione S-transferase, mu 4 [Source:MGI Symbol;Acc:MGI:95862])

HSP 1 Score: 71.633 bits (174), Expect = 1.830e-14
Identity = 54/184 (29.35%), Postives = 90/184 (48.91%), Query Frame = 1
Query:  181 YFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTG----------KLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAE-LFFLVVSDYLVKLPQLYDDFPKLKELRER 699
            Y+D RG A  IRL+L+ +   +++ R T    P+   +               LP +     ++TQS AI R +ARKH   GE ++E   V+    Q +DV   L ++ ++P+   E+L+ EY+       +K    F+ +  +F GEKIT  + L + ++  +L+  P   D FP LK+   R
Sbjct:    7 YWDIRGLAHAIRLLLEYTGSSYEEKRYTMGDAPDYDRSQWLSEKFKLGLDFPNLPYLIDGSHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQAMDVSNQLARVCYSPD--FEKLKVEYLEQLP-GMVKLFSQFLGQRTWFVGEKITFVDFLAYDILDLHLIFEPTCLDAFPNLKDFVAR 187          
BLAST of glutathione S transferase-1 vs. Ensembl Mouse
Match: Gsta3 (glutathione S-transferase, alpha 3 [Source:MGI Symbol;Acc:MGI:95856])

HSP 1 Score: 70.4774 bits (171), Expect = 3.908e-14
Identity = 55/183 (30.05%), Postives = 97/183 (53.01%), Query Frame = 1
Query:  175 VTYFDARGRAELIRLVLKASKIEFKDVRI-TKDKWPEVKPTTPT--GKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDV-LEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETG--FFAGEKITLAELFFLVVSDYLVKL-PQLYDDFPKLKELRERI 702
            + YFD RGR E IR +L A+ +EF++  + T+D    ++        ++P+VE +G +L Q+ AI   +A K+   G+D KE  +++     + D+ +  LY  +  PEEK+  L      T  R    A E  +K  G  +  G +++ A++  + +  ++ +L P + D+FP LK LR R+
Sbjct:    7 LHYFDGRGRMEPIRWLLAAAGVEFEEKFLKTRDDLARLRSDGSLMFQQVPMVEIDGMKLVQTKAILNYIASKYNLYGKDMKERAIIDMYTEGVADLEIMILYYPHMPPEEKEASLAKIKEQTRNR-YFPAFEKVLKSHGQDYLVGNRLSRADIALVELLYHVEELDPGVVDNFPLLKALRSRV 188          
BLAST of glutathione S transferase-1 vs. Ensembl Mouse
Match: Gsta3 (glutathione S-transferase, alpha 3 [Source:MGI Symbol;Acc:MGI:95856])

HSP 1 Score: 70.4774 bits (171), Expect = 3.908e-14
Identity = 55/183 (30.05%), Postives = 97/183 (53.01%), Query Frame = 1
Query:  175 VTYFDARGRAELIRLVLKASKIEFKDVRI-TKDKWPEVKPTTPT--GKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDV-LEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETG--FFAGEKITLAELFFLVVSDYLVKL-PQLYDDFPKLKELRERI 702
            + YFD RGR E IR +L A+ +EF++  + T+D    ++        ++P+VE +G +L Q+ AI   +A K+   G+D KE  +++     + D+ +  LY  +  PEEK+  L      T  R    A E  +K  G  +  G +++ A++  + +  ++ +L P + D+FP LK LR R+
Sbjct:    7 LHYFDGRGRMEPIRWLLAAAGVEFEEKFLKTRDDLARLRSDGSLMFQQVPMVEIDGMKLVQTKAILNYIASKYNLYGKDMKERAIIDMYTEGVADLEIMILYYPHMPPEEKEASLAKIKEQTRNR-YFPAFEKVLKSHGQDYLVGNRLSRADIALVELLYHVEELDPGVVDNFPLLKALRSRV 188          
BLAST of glutathione S transferase-1 vs. Ensembl Mouse
Match: Gsta1 (glutathione S-transferase, alpha 1 (Ya) [Source:MGI Symbol;Acc:MGI:1095417])

HSP 1 Score: 67.781 bits (164), Expect = 4.062e-13
Identity = 53/184 (28.80%), Postives = 92/184 (50.00%), Query Frame = 1
Query:  175 VTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKL-----PVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETG--FFAGEKITLAELFFLVVSDYLVKL-PQLYDDFPKLKELRERI 702
            + YF+ARGR E IR +L A+ +EF++  I   +  +++     G L     P+VE +G +L Q+ AI   +A K+   G+D KE  L++     ++D+ E + ++   P +++E   A     +    L A E  +K  G  +  G ++T  ++  L V  Y+ +    L   FP LK  + RI
Sbjct:    7 LHYFNARGRMECIRWLLAAAGVEFEEKFIQSPE--DLEKLKKDGNLMFDQVPMVEIDGMKLAQTRAILNYIATKYDLYGKDMKERALIDMYSEGILDLTEMIGQLVLCPPDQREAKTALAKDRTKNRYLPAFEKVLKSHGQDYLVGNRLTRVDIHLLEVLLYVEEFDASLLTPFPLLKAFKSRI 188          
BLAST of glutathione S transferase-1 vs. UniProt/SwissProt
Match: sp|P09792|GST28_SCHMA (Glutathione S-transferase class-mu 28 kDa isozyme OS=Schistosoma mansoni OX=6183 GN=GST28 PE=1 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 1.293e-38
Identity = 78/204 (38.24%), Postives = 123/204 (60.29%), Query Frame = 1
Query:  169 VKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEG-----KQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKAL-EGFIKETGFFA-GEKITLAELFFLVVSDYLVKLPQ--LYDDFPKLKELRERILKANTDVEEWVNTRPVT 753
            +KV YFD RGRAE IR+ L A+ ++++D RI+   WP++KPT P G+LP V+        K + +S+AIAR +A+KH  MGE D+EYY VE+ IGQ  DV    +K    P+E+KE++  E +       L  + E     TG  A G+K+TLA+L  + V D++  L +  L   +P++ + RE +L ++  + ++++ RP T
Sbjct:    6 IKVIYFDGRGRAESIRMTLVAAGVDYEDERISFQDWPKIKPTIPGGRLPAVKVTDDHGHVKWMLESLAIARYMAKKHHMMGETDEEYYSVEKLIGQAEDVEHEYHKTLMKPQEEKEKITKEILNGKVPVLLNMICESLKGSTGKLAVGDKVTLADLVLIAVIDHVTDLDKGFLTGKYPEIHKHRENLLASSPRLAKYLSNRPAT 209          
BLAST of glutathione S transferase-1 vs. UniProt/SwissProt
Match: sp|P26624|GST28_SCHJA (Glutathione S-transferase class-mu 28 kDa isozyme (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 2.684e-38
Identity = 73/204 (35.78%), Postives = 125/204 (61.27%), Query Frame = 1
Query:  169 VKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEGKQ-----LTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKET--GFFAGEKITLAELFFLVVSDYLVKLPQ--LYDDFPKLKELRERILKANTDVEEWVNTRPVT 753
            VK+ YF+ RGRAE IR++L A+ +EF+D RI    WP++KPT P G+LP+V+   K+     +++S+AIAR +ARKH  MG+ D EYY++E+ IGQ+ DV    +K    P E+KE++  E +       L+A+   +KE+      G+K+TLA++  +   D++  L +  L   +P++ + R+ +L  +  + ++++ R  T
Sbjct:    1 VKLIYFNGRGRAEPIRMILVAAGVEFEDERIEFQDWPKIKPTIPGGRLPIVKITDKRGDVKTMSESLAIARFIARKHNMMGDTDDEYYIIEKMIGQVEDVESEYHKTLIKPPEEKEKISKEILNGKVPILLQAICETLKESTGNLTVGDKVTLADVVLIASIDHITDLDKEFLTGKYPEIHKHRKHLLATSPKLAKYLSERHAT 204          
BLAST of glutathione S transferase-1 vs. UniProt/SwissProt
Match: sp|P30114|GST28_SCHHA (Glutathione S-transferase class-mu 28 kDa isozyme OS=Schistosoma haematobium OX=6185 PE=1 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 8.016e-36
Identity = 75/204 (36.76%), Postives = 122/204 (59.80%), Query Frame = 1
Query:  169 VKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEG-----KQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKAL-EGFIKETGFFA-GEKITLAELFFLVVSDYLVKLPQ--LYDDFPKLKELRERILKANTDVEEWVNTRPVT 753
            +KV YF+ RGRAE IR+ L A+ + ++D RI+   WP++KPT P G+LP V+        K + +S+AIAR +A+KH  MGE D+EYY VE+ IGQ+ D+    +K    PEE+K+++  E +       L  + E     TG  A G+K+TLA+L  + V D++  L +  L   +P++ + RE +L ++  + ++++ R  T
Sbjct:    6 IKVIYFNGRGRAESIRMTLVAAGVNYEDERISFQDWPKIKPTIPGGRLPAVKITDNHGHVKWMLESLAIARYMAKKHHMMGETDEEYYNVEKLIGQVEDLEHEYHKTLMKPEEEKQKITKEILNGKVPVLLDIICESLKASTGKLAVGDKVTLADLVLIAVIDHVTDLDKEFLTGKYPEIHKHRENLLASSPRLAKYLSDRAAT 209          
BLAST of glutathione S transferase-1 vs. UniProt/SwissProt
Match: sp|P30113|GST28_SCHBO (Glutathione S-transferase class-mu 28 kDa isozyme OS=Schistosoma bovis OX=6184 PE=1 SV=2)

HSP 1 Score: 126.331 bits (316), Expect = 2.729e-34
Identity = 74/204 (36.27%), Postives = 120/204 (58.82%), Query Frame = 1
Query:  169 VKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEG-----KQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKAL-EGFIKETGFFA-GEKITLAELFFLVVSDYLVKLPQ--LYDDFPKLKELRERILKANTDVEEWVNTRPVT 753
            +KV YF+ RGRAE IR+ L A+ + ++D RI+   WP++KPT P G+LP V+        K + +S+AIAR +A+KH  MG  ++EYY VE+ IGQ  D+    YK    PEE+K+++  E +       L  + E     TG  A G+K+TLA+L  + V D++  L +  L   +P++ + RE +L ++  + ++++ R  T
Sbjct:    6 IKVIYFNGRGRAESIRMTLVAAGVNYEDERISFQDWPKIKPTIPGGRLPAVKITDNHGHVKWMVESLAIARYMAKKHHMMGGTEEEYYNVEKLIGQAEDLEHEYYKTLMKPEEEKQKIIKEILNGKVPVLLDIICESLKASTGKLAVGDKVTLADLVLIAVIDHVTDLDKEFLTGKYPEIHKHRENLLASSPRLAKYLSDRAAT 209          
BLAST of glutathione S transferase-1 vs. UniProt/SwissProt
Match: sp|O73888|HPGDS_CHICK (Hematopoietic prostaglandin D synthase OS=Gallus gallus OX=9031 GN=HPGDS PE=1 SV=3)

HSP 1 Score: 115.546 bits (288), Expect = 2.333e-30
Identity = 66/201 (32.84%), Postives = 113/201 (56.22%), Query Frame = 1
Query:  160 MSTVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDYLVKL-PQLYDDFPKLKELRERILKANTDVEEWVNTRPVTEM 759
            M   K+TYF+ RGRAE+ R +   + I+++D R+    WP++KPT P GK+P++E +G  + QS+AIAR +AR+ G  G+   E  L + AI   +D    L+      ++ KE+   + +     + LK L+ F+ +  +F G+ +T A+ ++ V S  L+     L D +P+L  LR+R+ +A   +  W+  RP T +
Sbjct:    1 MPNYKLTYFNLRGRAEICRYLFAYAGIKYEDHRLEGADWPKIKPTIPFGKVPILEVDGVIIHQSLAIARYLARESGLAGQTPVEQALAD-AIVDTIDDFMMLFPWAEKNQDVKEKAFNDILTNKAPELLKDLDTFLGDKKWFVGKSVTWADFYWDVCSTTLLSYKADLADKYPRLLALRDRV-EALPAIAAWIQKRPKTAI 199          
BLAST of glutathione S transferase-1 vs. TrEMBL
Match: I1ZI99 (Glutathione S transferase-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 400.593 bits (1028), Expect = 7.369e-140
Identity = 199/200 (99.50%), Postives = 200/200 (100.00%), Query Frame = 1
Query:  160 MSTVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDYLVKLPQLYDDFPKLKELRERILKANTDVEEWVNTRPVTEM 759
            MSTVKVTYFDARGRAELIRLVLKASKIEF+DVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDYLVKLPQLYDDFPKLKELRERILKANTDVEEWVNTRPVTEM
Sbjct:    1 MSTVKVTYFDARGRAELIRLVLKASKIEFEDVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDYLVKLPQLYDDFPKLKELRERILKANTDVEEWVNTRPVTEM 200          
BLAST of glutathione S transferase-1 vs. TrEMBL
Match: A0A5A4MJP5 (Glutathione S-transferase OS=Dugesia japonica OX=6161 GN=GST PE=2 SV=1)

HSP 1 Score: 356.681 bits (914), Expect = 1.496e-122
Identity = 168/200 (84.00%), Postives = 192/200 (96.00%), Query Frame = 1
Query:  160 MSTVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDYLVKLPQLYDDFPKLKELRERILKANTDVEEWVNTRPVTEM 759
            M+TVKVTYF+ARGRAE+IRLVLKASK+EF+DVR+TK++W EVKPTTPTGKLP+VE+EGK+LTQSMAIAR +ARK+GFMGEDDKEYYL+ERAIGQMVDVLEG+YKIYFAPEEKKEELR E+V TSGRDNLK LEGFIKE+GFF GEKITLAELFF+V+SDYL K+P+LYDDFPKLKELRER+LKANTDVE+WV TRPVT+M
Sbjct:    1 MTTVKVTYFNARGRAEIIRLVLKASKVEFEDVRLTKEQWAEVKPTTPTGKLPIVEHEGKKLTQSMAIARAIARKYGFMGEDDKEYYLIERAIGQMVDVLEGMYKIYFAPEEKKEELRTEFVTTSGRDNLKTLEGFIKESGFFVGEKITLAELFFVVLSDYLEKMPKLYDDFPKLKELRERVLKANTDVEDWVKTRPVTDM 200          
BLAST of glutathione S transferase-1 vs. TrEMBL
Match: A0A267H4F2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005819g2 PE=4 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 5.992e-55
Identity = 96/196 (48.98%), Postives = 130/196 (66.33%), Query Frame = 1
Query:  172 KVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKE--TGFFAGEKITLAELFFLVVSDYLVKLPQLYDDFPKLKELRERILKANTDVEEWVNTRPVT 753
            KV YF+ARGRAELIRL L A  +EF DVR T+++WPE K   PTG  P VE    +L QS AIAR +A+KHG  GE D E+YLVERA+ Q+ DV   L K+YFAPE+KK EL  ++    G   ++ L  FI++  +GFFAG+ +TLA+L  + + D L  +P+L   FP+L+  ++R+L+A   V EW+  RP T
Sbjct:   24 KVCYFNARGRAELIRLALTAGGVEFDDVRFTREEWPEKKKIAPTGVAPWVETPNGKLVQSGAIARFIAKKHGLYGEGDWEFYLVERALAQIEDVATELMKMYFAPEDKKAELVKQFQTEKGPKLIEGLLKFIEDGGSGFFAGKSVTLADLASVNMVDQLALVPELLAKFPQLEAHKKRVLEAKPKVAEWIKNRPQT 219          
BLAST of glutathione S transferase-1 vs. TrEMBL
Match: A0A267DQQ2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031684g1 PE=4 SV=1)

HSP 1 Score: 185.652 bits (470), Expect = 7.915e-55
Identity = 96/196 (48.98%), Postives = 130/196 (66.33%), Query Frame = 1
Query:  172 KVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKE--TGFFAGEKITLAELFFLVVSDYLVKLPQLYDDFPKLKELRERILKANTDVEEWVNTRPVT 753
            KV YF+ARGRAELIRL L A  +EF DVR T+++WPE K   PTG  P VE    +L QS AIAR +A+KHG  GE D E+YLVERA+ Q+ DV   L K+YFAPE+KK EL  ++    G   ++ L  FI++  +GFFAG+ +TLA+L  + + D L  +P+L   FP+L+  ++R+L+A   V EW+  RP T
Sbjct:   26 KVCYFNARGRAELIRLALTAGGVEFDDVRFTREEWPEKKKIAPTGVAPWVETPNGKLVQSGAIARFIAKKHGLYGEGDWEFYLVERALAQIDDVATELMKMYFAPEDKKSELVKQFQTEKGPKLIEGLLKFIEDGGSGFFAGKSVTLADLASVNMVDQLALVPELLAKFPQLEAHKKRVLEAKPKVAEWIKNRPQT 221          
BLAST of glutathione S transferase-1 vs. TrEMBL
Match: A0A267GL96 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005819g1 PE=4 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 8.478e-55
Identity = 96/196 (48.98%), Postives = 130/196 (66.33%), Query Frame = 1
Query:  172 KVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKE--TGFFAGEKITLAELFFLVVSDYLVKLPQLYDDFPKLKELRERILKANTDVEEWVNTRPVT 753
            KV YF+ARGRAELIRL L A  +EF DVR T+++WPE K   PTG  P VE    +L QS AIAR +A+KHG  GE D E+YLVERA+ Q+ DV   L K+YFAPE+KK EL  ++    G   ++ L  FI++  +GFFAG+ +TLA+L  + + D L  +P+L   FP+L+  ++R+L+A   V EW+  RP T
Sbjct:   35 KVCYFNARGRAELIRLALTAGGVEFDDVRFTREEWPEKKKIAPTGVAPWVETPNGKLVQSGAIARFIAKKHGLYGEGDWEFYLVERALAQIEDVATELMKMYFAPEDKKAELVKQFQTEKGPKLIEGLLKFIEDGGSGFFAGKSVTLADLASVNMVDQLALVPELLAKFPQLEAHKKRVLEAKPKVAEWIKNRPQT 230          
BLAST of glutathione S transferase-1 vs. Ensembl Cavefish
Match: ENSAMXT00000030565.1 (glutathione S-transferase Mu 3 [Source:NCBI gene;Acc:103025109])

HSP 1 Score: 69.3218 bits (168), Expect = 7.757e-14
Identity = 57/193 (29.53%), Postives = 99/193 (51.30%), Query Frame = 1
Query:  169 VKVTYFDARGRAELIRLVLKASKIEFKDVRIT--------KDKW----PEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKI-YFAPEEKKEELRAEYV-ATSGRDNLKALEGFIKETGFFAGEKITLAE-LFFLVVSDYLVKLPQLYDDFPKLKELRERI 702
            +K+ Y+D RG A+ IRL+L+ + ++++D   +        K  W    P++K   P   LP +E   ++++QS AI R + RKH   GE + E   V+    Q +D   G   + Y   +EKK    A Y+ A  G   LK    F+ +  +FAG+KIT  + + + ++  + +  P+  D+F  L++L +R 
Sbjct:    1 MKLHYWDIRGLAQPIRLLLEYTGVKYEDKFYSCGEAPDYDKSCWFNEKPKLKMDFPN--LPYLEDGDRKISQSNAIMRYIGRKHNLCGETEDEKVRVDILENQAMDFRNGFVMLCYLNYQEKK----AGYLEALPGV--LKQFSDFLGDRKWFAGDKITFVDFIMYELLDQHRMFEPKCLDNFKNLQDLLDRF 185          
BLAST of glutathione S transferase-1 vs. Ensembl Cavefish
Match: ENSAMXT00000048694.1 (glutathione S-transferase Mu 3 [Source:NCBI gene;Acc:103025109])

HSP 1 Score: 69.3218 bits (168), Expect = 7.757e-14
Identity = 57/193 (29.53%), Postives = 99/193 (51.30%), Query Frame = 1
Query:  169 VKVTYFDARGRAELIRLVLKASKIEFKDVRIT--------KDKW----PEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKI-YFAPEEKKEELRAEYV-ATSGRDNLKALEGFIKETGFFAGEKITLAE-LFFLVVSDYLVKLPQLYDDFPKLKELRERI 702
            +K+ Y+D RG A+ IRL+L+ + ++++D   +        K  W    P++K   P   LP +E   ++++QS AI R + RKH   GE + E   V+    Q +D   G   + Y   +EKK    A Y+ A  G   LK    F+ +  +FAG+KIT  + + + ++  + +  P+  D+F  L++L +R 
Sbjct:    1 MKLHYWDIRGLAQPIRLLLEYTGVKYEDKFYSCGEAPDYDKSCWFNEKPKLKMDFPN--LPYLEDGDRKISQSNAIMRYIGRKHNLCGETEDEKVRVDILENQAMDFRNGFVMLCYLNYQEKK----AGYLEALPGV--LKQFSDFLGDRKWFAGDKITFVDFIMYELLDQHRMFEPKCLDNFKNLQDLLDRF 185          
BLAST of glutathione S transferase-1 vs. Ensembl Cavefish
Match: GSTP1 (glutathione S-transferase pi 1 [Source:NCBI gene;Acc:103038276])

HSP 1 Score: 68.1662 bits (165), Expect = 1.654e-13
Identity = 56/201 (27.86%), Postives = 92/201 (45.77%), Query Frame = 1
Query:  160 MSTVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKW--PEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFI--KETGFFAGEKITLAEL-FFLVVSDYLVKLPQLYDDFPKLKELRERI-----LKANTDVEEW 732
            M+   +TYF  RGR    R++L     E+K++ ++ + W   ++K T   G+LP  E  G  L QS    R + RKHG  G++D E       I    D +E L   Y     ++ E   +       ++L   E  +   ++GF  G+ I+ A+   F V+ ++LV  P   D  P LK   + +     +KA  D E++
Sbjct:    1 MAPYTITYFAVRGRCGATRIMLADQGQEWKEIVVSFEDWMKGDLKKTCVFGQLPKFEDGGLTLFQSNTFLRHLGRKHGAYGKNDCE----AAQIDMFNDGVEDLRTKYLKMIYQEYETGKDAYIKDLPNHLCKFEAVLAKNKSGFLVGDSISFADYSLFEVLLNHLVLSPTCLDSLPALKSFVDTLSARPKIKAFLDSEDY 197          
BLAST of glutathione S transferase-1 vs. Ensembl Cavefish
Match: GSTP1 (glutathione S-transferase pi 1 [Source:NCBI gene;Acc:103038276])

HSP 1 Score: 67.0106 bits (162), Expect = 6.646e-13
Identity = 55/196 (28.06%), Postives = 90/196 (45.92%), Query Frame = 1
Query:  175 VTYFDARGRAELIRLVLKASKIEFKDVRITKDKW--PEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFI--KETGFFAGEKITLAEL-FFLVVSDYLVKLPQLYDDFPKLKELRERI-----LKANTDVEEW 732
            +TYF  RGR    R++L     E+K++ ++ + W   ++K T   G+LP  E  G  L QS    R + RKHG  G++D E       I    D +E L   Y     ++ E   +       ++L   E  +   ++GF  G+ I+ A+   F V+ ++LV  P   D  P LK   + +     +KA  D E++
Sbjct:   26 ITYFAVRGRCGATRIMLADQGQEWKEIVVSFEDWMKGDLKKTCVFGQLPKFEDGGLTLFQSNTFLRHLGRKHGAYGKNDCE----AAQIDMFNDGVEDLRTKYLKMIYQEYETGKDAYIKDLPNHLCKFEAVLAKNKSGFLVGDSISFADYSLFEVLLNHLVLSPTCLDSLPALKSFVDTLSARPKIKAFLDSEDY 217          
BLAST of glutathione S transferase-1 vs. Ensembl Cavefish
Match: gsta.1 (glutathione S-transferase A4-like [Source:NCBI gene;Acc:103033890])

HSP 1 Score: 63.929 bits (154), Expect = 8.799e-12
Identity = 44/184 (23.91%), Postives = 91/184 (49.46%), Query Frame = 1
Query:  169 VKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKL-----PVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDYLVKL-PQLYDDFPKLKELRERI 702
            V + YF  RG+ E IR +L  + +EF++   +  +  E +    +G L     P++E +G ++ Q+ AI   +A K+   G+D KE  +++       D+++ +  + F P EKK+         +   +L A E  +  + +  G +++ A++    V+  L +L P +   FP ++  ++R+
Sbjct:    5 VVLHYFIGRGKMESIRWLLTVAGVEFEEKFFSTKE--EFQKLVESGDLLFHQVPLIEMDGMKMVQTKAILNYIAGKYNLYGKDLKERLMIDTYAEGARDIMDLIMGVPFTPPEKKQSTLNNLETKAKVRSLPAYEKALSSSQYLVGNQLSCADVSLFEVALMLEELFPTILSTFPNIQAFQKRM 186          
BLAST of glutathione S transferase-1 vs. Ensembl Nematostella
Match: EDO45159 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTW9])

HSP 1 Score: 93.5893 bits (231), Expect = 2.868e-23
Identity = 67/205 (32.68%), Postives = 108/205 (52.68%), Query Frame = 1
Query:  160 MSTVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKP--TTPTGKLPVVEYEGK-QLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEE-KKEELRAEYVATSGRDNLKALEGFIKE--TGFFAGEKITLAELFFLVVSDYLVKLPQLYDDFPKLKELRERILKANTDVEEWVNTRPVTE 756
            M + K+ YF+ARGRAE  RLV  A+ IEF+D R+   +WP+VK     P G++P++  + K +L QS+AI   +AR+ G    +  +    +  +G   D L    + +F  +E KK+EL      T     + AL   ++E  TGF   +K+T A++      + L       D FPKLK+  +RI  +N  ++ ++  RP T+
Sbjct:    1 MPSYKLYYFNARGRAEPARLVFAAAGIEFEDNRMAMGEWPKVKKELHAPFGQVPLLVIDDKIKLAQSLAIMTFIAREGGLAPSNSLDIAKCDMIVGAEEDFLTKKIQCHFEKDEAKKKELDEAIQNTHLPAFMGALTKILEENGTGFLVTDKMTYADIIVFNACNNLDS--GALDKFPKLKQHHDRI-ASNPGIKAYLEKRPKTD 202          
BLAST of glutathione S transferase-1 vs. Ensembl Nematostella
Match: EDO45327 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT47])

HSP 1 Score: 92.4337 bits (228), Expect = 8.724e-23
Identity = 60/207 (28.99%), Postives = 101/207 (48.79%), Query Frame = 1
Query:  160 MSTVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPT--GKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYF-APEEKKEELRAEYVATSGRDNLKALEGFIK-------ETGFFAGEKITLAELFFLVVSDYLVKL-PQLYDDFPKLKELRERILKANTDVEEWVNTRP 747
            M   K+ YF+ RGRAE  RL   A  I ++DVR+T ++W ++K    T  G LPV+E +G Q  +SMAI R+ A+  G       E    +  +    D+     K +F   +E+K++L+ E+           +E  +           +F G K+T A++     SD    + P + ++FP L++L +R+   N  ++ W+  RP
Sbjct:    1 MPNYKLIYFNTRGRAEPTRLCFAAGGIPYEDVRLTGEEWTKMKAENKTIMGYLPVLEVDGIQYCESMAIFRLAAKLAGLCPTCPYEQARCDMVVDCSSDLFAKAMKFFFEKDQEQKKKLQEEFKEQHLNKFWDIMERLLTAKCNLDGSAQYFVGNKLTYADIILFSTSDTFESMFPGMLENFPGLRDLFKRV-GENPGIKAWIEKRP 206          
BLAST of glutathione S transferase-1 vs. Ensembl Nematostella
Match: EDO38608 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCI4])

HSP 1 Score: 88.9669 bits (219), Expect = 1.566e-21
Identity = 67/208 (32.21%), Postives = 110/208 (52.88%), Query Frame = 1
Query:  160 MSTVKVTYFDARGRAELIRLVLKASKIEFKDVRI-TKDKWPEVKP--TTPTGKLPVVEYEGK-QLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKE--ELRAEYVATSGRDNLKALEGFIKE--TGFFAGEKITLAELFFLVVSDYLVKLPQLYDDFPKLKELRERILKANTDVEEWVNTRPVTEM 759
            M + K+ YF+ARGRAE  RL   A+ IE++D R   +++W  VKP    P G++P++  + K +L QSMAI   VAR+ G    +  +  + +  +G   D+     K +   +EKK+  +LR E   T     L+A+  F+++  TGF   +K+T A++    V D      ++    PK+KE  E ++ A   ++ W+  RP T M
Sbjct:    1 MPSYKLHYFNARGRAEPARLAFAAAGIEYEDKRFEGREEWLRVKPELDPPFGQVPLLVIDDKIKLAQSMAILAYVAREGGLAPTNSLDIAMCDMIVGVEGDLNSKGMKWFMEKDEKKKVLKLREELDTTHIPAFLEAMSKFLEKNGTGFLVTDKLTYADILVFNVCDNAPA--EVLKKCPKMKEFHE-LIAAIPGIKAWLEKRPKTSM 205          
BLAST of glutathione S transferase-1 vs. Ensembl Nematostella
Match: EDO47468 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMA1])

HSP 1 Score: 88.5817 bits (218), Expect = 1.891e-21
Identity = 64/207 (30.92%), Postives = 109/207 (52.66%), Query Frame = 1
Query:  160 MSTVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKP--TTPTGKLPVVEYEGK-QLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEE-KKEELRAEYVATSGRDNLKALEGFIK----ETGFFAGEKITLAELFFLVVSDYLVKLPQL-YDDFPKLKELRERILKANTDVEEWVNTRPVT 753
            M + K+ YFD RGRAE  RL   A+ IE++D R+  ++WP++K     P G++P++  + K +L QS+AI   +AR+ G    +  +  + +  +G   D ++  YK +F  +E KK EL      T     ++AL   +K    +TGF   +K+T A++    V + L        D FP++K   + ++ AN  ++ W+  RP T
Sbjct:    1 MPSYKLYYFDGRGRAEPARLAFAAAGIEYEDKRMQFEEWPKIKKEIDAPFGQVPLLVIDDKIKLAQSLAIMTYIAREGGLAPVNSLDIAMCDMIVGAEEDFVQKQYKWHFEKDEAKKTELGEALEKTHLPAFVEALTRILKKNDNKTGFLVTDKMTYADIVVFNVFNNLSSTDGFSLDKFPEIKAHHD-LVAANEGIKAWLEKRPKT 206          
BLAST of glutathione S transferase-1 vs. Ensembl Nematostella
Match: EDO33767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR87])

HSP 1 Score: 85.5001 bits (210), Expect = 3.863e-20
Identity = 58/207 (28.02%), Postives = 105/207 (50.72%), Query Frame = 1
Query:  166 TVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPT--TPTGKLPVVEY-EGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEK-KEELRAEYVATSGRDNLKALEGFIKET----GFFAGEKITLAEL-FFLVVSDYL----VKLPQLYDDFPKLKELRERILKANTDVEEWVNTRP 747
            T +V YFDAR RAE IR++L  + + F D R+    W  +K +   P G+LP++E  +G++L QS AI R +A++HG    D       +  +    D++E +   ++  +EK KE+   E+   +    L+ +    +E     G+  G+KIT A++ FF   + ++    + +P+    +P L +L  R++     +E     +P
Sbjct:    4 TYRVVYFDARARAECIRVLLHLADVPFTDERVAPPDWAAMKTSGRCPFGELPLLEISDGRKLAQSHAIFRFLAKEHGLAPSDSYSQARCDMFLDNTKDMIEKVGTAFWEKDEKLKEQKSKEFHEETLPKRLEFINKLFQENKGGKGYLVGDKITYADIDFFCFFNGFINSGKLDVPEQLSKYPLLVDLYNRVMNEKKILEYLKQRKP 210          
BLAST of glutathione S transferase-1 vs. Ensembl Medaka
Match: gstm.1 (glutathione S-transferase Mu 3 [Source:NCBI gene;Acc:101157367])

HSP 1 Score: 69.3218 bits (168), Expect = 2.023e-13
Identity = 58/208 (27.88%), Postives = 99/208 (47.60%), Query Frame = 1
Query:  130 YILK--SSRFGNMSTVKVT----YFDARGRAELIRLVLKASKIEFKD--------VRITKDKWPEVKPTTPTG--KLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAE-LFFLVVSDYLVKLPQLYDDFPKLKELRERI 702
            Y++K  S+ FG    +K+     Y+D RG A+ IRL+L+ +   ++D            K  W ++K         LP +    +++ QS AI R +ARKH   GE + E   V+    Q +D   G  ++ +   +K   ++  Y+  S  + LK    F+ +  +FAGEKIT  + L + ++  + +  P   DDF  LK+  +R 
Sbjct:   49 YLIKATSAAFGANKYIKMAMTLAYWDIRGLAQPIRLLLEYTGTSYEDKFYVCGEAPNYDKSCWFDIKEKLGMDFPNLPYLLDGDRKIVQSNAIMRYIARKHNLCGETEDEKVRVDIIENQAMDFRNGFVRMCYTDLDK---MKPGYL-KSLPEVLKQFSDFLGDRDWFAGEKITFVDFLMYELLDQHRMFHPSCLDDFKNLKDFLDRF 252          
BLAST of glutathione S transferase-1 vs. Ensembl Medaka
Match: ENSORLT00000012133.2 (glutathione S-transferase alpha 4 [Source:NCBI gene;Acc:101174370])

HSP 1 Score: 60.4622 bits (145), Expect = 1.376e-10
Identity = 45/183 (24.59%), Postives = 94/183 (51.37%), Query Frame = 1
Query:  175 VTYFDARGRAELIRLVLKASKIEFKDVRIT-KDKWPEV--KPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDN-LKALEGFIKETGFFAGEKITLAELFFLVVSDYL-VKLPQLYDDFPKLKELRERILK 708
            + YF+ RG+ E IR +L   + EF ++ +T +D++ ++    +    ++P+VE +G +L Q+ AI   +A K+   G+D KE  +V      ++D++E +  + F  + K    + + + +  ++  L   E  +    +  G K++ A++  L  +  L  K   +  DFP +K  + R++K
Sbjct:    7 LHYFNGRGKMESIRWLLTVVEAEFDEMYLTSRDQYEKLLNDGSLMFQQVPLVEIDGMKLVQTKAILHYIAEKYNLHGKDIKERAMVNMYAEGLIDLMEMMMMLPFVADPKP---KLDNIQSKAKERYLPVFEKALSGPVYLVGGKLSYADVLLLECTLMLEEKFTGILGDFPSVKSFQGRMIK 186          
BLAST of glutathione S transferase-1 vs. Planmine SMEST
Match: SMESG000003087.1 (SMESG000003087.1)

HSP 1 Score: 400.593 bits (1028), Expect = 2.049e-143
Identity = 199/200 (99.50%), Postives = 200/200 (100.00%), Query Frame = 1
Query:  160 MSTVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDYLVKLPQLYDDFPKLKELRERILKANTDVEEWVNTRPVTEM 759
            MSTVKVTYFDARGRAELIRLVLKASKIEF+DVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDYLVKLPQLYDDFPKLKELRERILKANTDVEEWVNTRPVTEM
Sbjct:    1 MSTVKVTYFDARGRAELIRLVLKASKIEFEDVRITKDKWPEVKPTTPTGKLPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDYLVKLPQLYDDFPKLKELRERILKANTDVEEWVNTRPVTEM 200          
BLAST of glutathione S transferase-1 vs. Planmine SMEST
Match: SMESG000016836.1 (SMESG000016836.1)

HSP 1 Score: 120.939 bits (302), Expect = 1.848e-33
Identity = 74/202 (36.63%), Postives = 114/202 (56.44%), Query Frame = 1
Query:  160 MSTVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYE-GKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDV-LEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKE--TGFFAGEKITLAELFFLVVSDYLVKLPQLYDDFPKLKELRERILKANTDVEEWVNTRPVT 753
            M   K+TYFD RGR ELIR +L +   +F D R+T ++W   KP+   G+LPV+  E G QL +SMAI+R +ARK    G+D+ E Y ++RAI  + D+ L+ +  I+   E+KK E++ +            L  +I E    F AG   +LA+LF  V+ D    LP+    FPKL+ +  +++ +   +++ V TRP T
Sbjct:    1 MPVKKLTYFDGRGRGELIRFILHSQNEKFDDERLTFEQWGARKPSVTYGQLPVLTLECGTQLNESMAISRFLARKAKLYGKDEMETYRIDRAIDTINDLYLKAVQSIFEKDEKKKAEMQKDLKEKFVPQYFGNLVKYIDEGKGAFLAGANASLADLFLCVILD---SLPEAKPAFPKLENIYNKVMTSYPGIKKHVETRPQT 199          
BLAST of glutathione S transferase-1 vs. Planmine SMEST
Match: SMESG000016846.1 (SMESG000016846.1)

HSP 1 Score: 116.316 bits (290), Expect = 1.267e-31
Identity = 69/199 (34.67%), Postives = 116/199 (58.29%), Query Frame = 1
Query:  169 VKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVEYE-GKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPE-EKKEELRAEYVATSGRDNLKALEGFIKET--GFFAGEKITLAELFFLVVSDYLVKLPQLYDDFPKLKELRERILKANTDVEEWVNTRPVT 753
            +K+TYF+A+ +AELIRL+L AS ++F+D RI  + WP++KP+ P+G+LPVV+   G  L +S+AIAR  A+K+   G  + E Y  +RA+  + D+   +  I+   + EK + LR E   T     L  + G+  E    FF G K + A+L  + + D+  +    Y ++PK+ +  +++L+    V+E+  TR  T
Sbjct:    5 IKITYFNAKAKAELIRLILVASNVDFEDKRIEFEDWPQLKPSIPSGQLPVVQLTCGTILNESLAIARYFAKKYHLAGSGEIEEYKADRAVCTLDDLFTKIVDIFHEKDVEKSKLLRTELNETHLAIFLNRVSGYFTEHDGDFFLGSKPSYADLQLVNIMDHFEE--SQYQNYPKIVKCYQQVLEHFPKVKEYKATRVAT 201          
BLAST of glutathione S transferase-1 vs. Planmine SMEST
Match: SMESG000032177.1 (SMESG000032177.1)

HSP 1 Score: 107.457 bits (267), Expect = 2.482e-28
Identity = 60/200 (30.00%), Postives = 110/200 (55.00%), Query Frame = 1
Query:  169 VKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLPVVE-YEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLAELFFLVVSDY--LVKLPQLYDDFPKLKELRERILKANTDVEEWVNT-RPVTE 756
            V++ Y+D RG AE++RL+ KA+ I+F+D R T+++W   K      +LP+VE Y+G+ LT+  AI R  +   G +G  D EYY++E+ I    +    L  + F      +    E+  +S    L  +   + + GF  G+  +LA+++ LV+ D+  +    + +  F KL E+++++L    ++  W+ T RP+T+
Sbjct:    5 VRLHYYDCRGEAEVLRLLFKAANIKFEDKRYTEEEWETAKSAFKIKELPLVENYDGRLLTEPSAICRFYSLNRGLLGSSDWEYYMIEKCIEHADESCHILNDVVFKNITLDD--HHEHALSSSLKTLNKV-AEVNKNGFLVGKTASLADIYLLVLLDFAEMRAAKEHFTRFKKLHEVKKKLLNTFPEINTWITTMRPITD 201          
BLAST of glutathione S transferase-1 vs. Planmine SMEST
Match: SMESG000066038.1 (SMESG000066038.1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.101e-13
Identity = 52/196 (26.53%), Postives = 97/196 (49.49%), Query Frame = 1
Query:  166 TVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGKLP--VVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLEGLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKET--GFFAGEKITLAELFFLVVSDYL--VKLPQLYDDFPKLKELRERILKANTDVEEWV 735
            ++K+ +       +LI + L A+ + ++D+R++ D        T  GK P  +   EGK L +++AIA+  A++   MG+DD + Y +E+ I  +  ++  L  I     E  E  + + +       L+ +E  I E   GF   + ITL +L+FLV+ +YL      +  ++ P    + E+IL     V+E++
Sbjct:    2 SLKLYWNPKNPTHQLIPITLIATGVVYEDIRLSDD-------NTHHGKHPPYIENAEGKVLDKTLAIAKFYAKRKNCMGKDDWDLYCIEKGISLISKIVRLLSSILNRKCEISEWDKNKEMY------LRHIEKLITENGHGFLVTKGITLTDLYFLVMMNYLKFTTFSKTLENHPNFITVHEKILATLPQVKEYL 184          
The following BLAST results are available for this feature:
BLAST of glutathione S transferase-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HPGDS6.707e-3030.88hematopoietic prostaglandin D synthase [Source:HGN... [more]
GSTM33.256e-1428.80glutathione S-transferase mu 3 [Source:HGNC Symbol... [more]
GSTM33.256e-1428.80glutathione S-transferase mu 3 [Source:HGNC Symbol... [more]
GSTM34.882e-1428.65glutathione S-transferase mu 3 [Source:HGNC Symbol... [more]
GSTM44.574e-1226.46glutathione S-transferase mu 4 [Source:HGNC Symbol... [more]
back to top
BLAST of glutathione S transferase-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gst-34.740e-2833.01Glutathione S-transferase 3 [Source:UniProtKB/Swi... [more]
gst-111.033e-2732.34Glutathione S-Transferase [Source:UniProtKB/TrEMB... [more]
gst-73.416e-2634.13Probable glutathione S-transferase 7 [Source:UniP... [more]
gst-163.938e-2635.21Glutathione S-Transferase [Source:UniProtKB/TrEMB... [more]
gst-81.285e-2531.25Probable glutathione S-transferase 8 [Source:UniP... [more]
back to top
BLAST of glutathione S transferase-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GstS12.417e-2429.85gene:FBgn0010226 transcript:FBtr0087005[more]
GstS12.417e-2429.85gene:FBgn0010226 transcript:FBtr0100258[more]
GstS12.417e-2429.85gene:FBgn0010226 transcript:FBtr0087006[more]
GstS12.005e-2330.20gene:FBgn0010226 transcript:FBtr0333551[more]
back to top
BLAST of glutathione S transferase-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsta.16.803e-1527.87glutathione S-transferase, alpha tandem duplicate ... [more]
gsta.16.803e-1527.87glutathione S-transferase, alpha tandem duplicate ... [more]
gstp24.344e-1429.03glutathione S-transferase pi 2 [Source:ZFIN;Acc:ZD... [more]
AL929536.36.866e-1426.92pep chromosome:GRCz11:13:835390:840787:1 gene:ENSD... [more]
AL929536.16.866e-1426.92pep chromosome:GRCz11:CHR_ALT_CTG13_1_1:843683:849... [more]
back to top
BLAST of glutathione S transferase-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hpgds1.946e-3031.98hematopoietic prostaglandin D synthase [Source:NCB... [more]
gnrhr4.743e-1328.17gonadotropin releasing hormone receptor [Source:Xe... [more]
ENSXETT00000044740.12.966e-1228.34glutathione S-transferase 3-like [Source:NCBI gene... [more]
ENSXETT00000044727.13.243e-1228.34glutathione S-transferase 3-like [Source:NCBI gene... [more]
gnrhr6.258e-1227.31gonadotropin releasing hormone receptor [Source:Xe... [more]
back to top
BLAST of glutathione S transferase-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hpgds2.168e-2931.84hematopoietic prostaglandin D synthase [Source:MGI... [more]
Gstm41.830e-1429.35glutathione S-transferase, mu 4 [Source:MGI Symbol... [more]
Gsta33.908e-1430.05glutathione S-transferase, alpha 3 [Source:MGI Sym... [more]
Gsta33.908e-1430.05glutathione S-transferase, alpha 3 [Source:MGI Sym... [more]
Gsta14.062e-1328.80glutathione S-transferase, alpha 1 (Ya) [Source:MG... [more]
back to top
BLAST of glutathione S transferase-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P09792|GST28_SCHMA1.293e-3838.24Glutathione S-transferase class-mu 28 kDa isozyme ... [more]
sp|P26624|GST28_SCHJA2.684e-3835.78Glutathione S-transferase class-mu 28 kDa isozyme ... [more]
sp|P30114|GST28_SCHHA8.016e-3636.76Glutathione S-transferase class-mu 28 kDa isozyme ... [more]
sp|P30113|GST28_SCHBO2.729e-3436.27Glutathione S-transferase class-mu 28 kDa isozyme ... [more]
sp|O73888|HPGDS_CHICK2.333e-3032.84Hematopoietic prostaglandin D synthase OS=Gallus g... [more]
back to top
BLAST of glutathione S transferase-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZI997.369e-14099.50Glutathione S transferase-1 OS=Schmidtea mediterra... [more]
A0A5A4MJP51.496e-12284.00Glutathione S-transferase OS=Dugesia japonica OX=6... [more]
A0A267H4F25.992e-5548.98Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DQQ27.915e-5548.98Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GL968.478e-5548.98Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of glutathione S transferase-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000030565.17.757e-1429.53glutathione S-transferase Mu 3 [Source:NCBI gene;A... [more]
ENSAMXT00000048694.17.757e-1429.53glutathione S-transferase Mu 3 [Source:NCBI gene;A... [more]
GSTP11.654e-1327.86glutathione S-transferase pi 1 [Source:NCBI gene;A... [more]
GSTP16.646e-1328.06glutathione S-transferase pi 1 [Source:NCBI gene;A... [more]
gsta.18.799e-1223.91glutathione S-transferase A4-like [Source:NCBI gen... [more]
back to top
BLAST of glutathione S transferase-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of glutathione S transferase-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of glutathione S transferase-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO451592.868e-2332.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453278.724e-2328.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386081.566e-2132.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474681.891e-2130.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337673.863e-2028.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of glutathione S transferase-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gstm.12.023e-1327.88glutathione S-transferase Mu 3 [Source:NCBI gene;A... [more]
ENSORLT00000012133.21.376e-1024.59glutathione S-transferase alpha 4 [Source:NCBI gen... [more]
back to top
BLAST of glutathione S transferase-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003087.12.049e-14399.50SMESG000003087.1[more]
SMESG000016836.11.848e-3336.63SMESG000016836.1[more]
SMESG000016846.11.267e-3134.67SMESG000016846.1[more]
SMESG000032177.12.482e-2830.00SMESG000032177.1[more]
SMESG000066038.11.101e-1326.53SMESG000066038.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30021545
GenBankAFJ24753.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021545 ID=SMED30021545|Name=glutathione S transferase-1|organism=Schmidtea mediterranea sexual|type=transcript|length=793bp
CTTGAAACGACTTGAAAGATTGTCTGTAATTGTAAACGATAGACTTTATC
TCACAAAGTTCAAGATTTGTCATCAGTTTTGTAGTTCCAAGTACACGAAA
TTCATATCATTTATAGTATAAATACACAGTACATATTAAAATCTTCACGA
TTTGGAAACATGAGCACAGTTAAAGTAACATATTTTGATGCTAGAGGAAG
AGCTGAACTGATTCGACTGGTACTAAAAGCTAGTAAAATCGAATTTAAAG
ATGTTAGAATCACCAAAGACAAATGGCCAGAAGTGAAACCAACAACTCCA
ACTGGAAAGTTACCAGTTGTTGAATATGAAGGAAAACAACTAACTCAAAG
CATGGCTATTGCTCGAGTTGTTGCACGAAAACATGGGTTCATGGGAGAAG
ATGACAAAGAATATTATTTAGTTGAAAGAGCCATTGGTCAAATGGTAGAT
GTCTTGGAAGGTTTATACAAAATCTACTTTGCACCAGAAGAGAAAAAAGA
AGAACTTCGAGCTGAATATGTTGCAACCTCTGGTCGGGATAATTTAAAAG
CTCTTGAGGGTTTCATTAAAGAAACAGGATTTTTCGCTGGAGAAAAAATT
ACTCTGGCTGAATTATTTTTCTTGGTTGTATCTGATTATTTGGTTAAATT
ACCGCAACTTTATGATGATTTCCCAAAACTCAAAGAATTGAGAGAAAGAA
TTTTAAAAGCCAACACTGACGTTGAAGAATGGGTTAATACTCGTCCTGTG
ACTGAAATGTAGGGACTTGAAAAGAATAATTACGATTTTCAAA
back to top

protein sequence of SMED30021545-orf-1

>SMED30021545-orf-1 ID=SMED30021545-orf-1|Name=SMED30021545-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=201bp
MSTVKVTYFDARGRAELIRLVLKASKIEFKDVRITKDKWPEVKPTTPTGK
LPVVEYEGKQLTQSMAIARVVARKHGFMGEDDKEYYLVERAIGQMVDVLE
GLYKIYFAPEEKKEELRAEYVATSGRDNLKALEGFIKETGFFAGEKITLA
ELFFLVVSDYLVKLPQLYDDFPKLKELRERILKANTDVEEWVNTRPVTEM
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000067goblet cell
PLANA:0000070intestinal phagocyte
PLANA:0000421tail
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR036282Glutathione-S-Trfase_C_sf
IPR010987Glutathione-S-Trfase_C-like
IPR004046GST_C
IPR012336Thioredoxin-like_fold
IPR004045Glutathione_S-Trfase_N
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 174..194
NoneNo IPR availableGENE3DG3DSA:1.20.1050.10coord: 82..200
e-value: 4.6E-32
score: 113.0
NoneNo IPR availableSFLDSFLDG00363AMPS_(cytGST):_Alpha-,_Mu-,_Pcoord: 1..199
e-value: 0.0
score: 188.8
NoneNo IPR availableSFLDSFLDG01205AMPS.1coord: 1..199
e-value: 0.0
score: 188.8
NoneNo IPR availablePANTHERPTHR11571GLUTATHIONE S-TRANSFERASEcoord: 1..196
NoneNo IPR availablePANTHERPTHR11571:SF206HEMATOPOIETIC PROSTAGLANDIN D SYNTHASEcoord: 1..196
NoneNo IPR availableCDDcd03039GST_N_Sigma_likecoord: 4..73
e-value: 1.22825E-28
score: 99.9308
NoneNo IPR availableCDDcd03192GST_C_Sigma_likecoord: 84..181
e-value: 1.31305E-14
score: 64.9514
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 1..81
e-value: 6.0E-30
score: 105.1
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 1..76
IPR004045Glutathione S-transferase, N-terminalPFAMPF02798GST_Ncoord: 5..72
e-value: 4.3E-12
score: 46.2
IPR004045Glutathione S-transferase, N-terminalPROSITEPS50404GST_NTERcoord: 2..79
score: 25.405
IPR004046Glutathione S-transferase, C-terminalPFAMPF14497GST_C_3coord: 97..194
e-value: 3.5E-13
score: 49.6
IPR010987Glutathione S-transferase, C-terminal-likePROSITEPS50405GST_CTERcoord: 81..200
score: 15.763
IPR036282Glutathione S-transferase, C-terminal domain superfamilySUPERFAMILYSSF47616GST C-terminal domain-likecoord: 73..199