Proteasome subunit beta

Overview
NameProteasome subunit beta
Smed IDSMED30021541
Length (bp)719
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Proteasome subunit beta (SMED30021541) t-SNE clustered cells

Violin plots show distribution of expression levels for Proteasome subunit beta (SMED30021541) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Proteasome subunit beta (SMED30021541) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Proteasome subunit beta (SMED30021541) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021541

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30021541SMESG000075365.1 SmedASXL_007241SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30021541SMESG000075365.1 SmedASXL_007241SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Proteasome subunit beta vs. Ensembl Human
Match: PSMB2 (proteasome 20S subunit beta 2 [Source:HGNC Symbol;Acc:HGNC:9539])

HSP 1 Score: 212.616 bits (540), Expect = 3.255e-69
Identity = 101/197 (51.27%), Postives = 149/197 (75.63%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVGK 656
            E LIGI+  +++L+ASD     +I+ M++D DK++++S+K+ L   G++GDTV FAE+I +NVQLYK+RNGYE+SP AAA+FTRR LA+ LR+R  YHVNLLL G D+   P+L++MDYL ++   PFA HGYG+++TLS+LDR Y P + +E A+ LL  C++E+QKRF+ NL  F V++ID+ GI  L++++  K
Sbjct:    2 EYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPK 198          
BLAST of Proteasome subunit beta vs. Ensembl Human
Match: PSMB2 (proteasome 20S subunit beta 2 [Source:HGNC Symbol;Acc:HGNC:9539])

HSP 1 Score: 83.1889 bits (204), Expect = 2.971e-20
Identity = 39/81 (48.15%), Postives = 59/81 (72.84%), Query Frame = 3
Query:  414 MDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVGK 656
            MDYL ++   PFA HGYG+++TLS+LDR Y P + +E A+ LL  C++E+QKRF+ NL  F V++ID+ GI  L++++  K
Sbjct:    1 MDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPK 81          
BLAST of Proteasome subunit beta vs. Ensembl Human
Match: PSMB4 (proteasome 20S subunit beta 4 [Source:HGNC Symbol;Acc:HGNC:9541])

HSP 1 Score: 60.077 bits (144), Expect = 3.470e-10
Identity = 43/189 (22.75%), Postives = 87/189 (46.03%), Query Frame = 3
Query:   69 CLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNV-QLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDR--KYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGI 626
             ++G++F   +++A+D  G    +A   +I +I  +++   LG  GD  D     + + Q V     + +G+  SP A   +  R +       N     +++GG    G   L ++D LG   + P    GYG+Y+   +L    +  P + + EA  L+  C++ +  R   + + F++  + E+G+
Sbjct:   55 SVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGY-ADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARDLVERCMRVLYYRDARSYNRFQIATVTEKGV 242          
BLAST of Proteasome subunit beta vs. Ensembl Human
Match: PSMB1 (proteasome 20S subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:9537])

HSP 1 Score: 58.9214 bits (141), Expect = 8.415e-10
Identity = 51/196 (26.02%), Postives = 88/196 (44.90%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRN--AYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYN-PNMCKEE--------AIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGI 626
            ++ I   +F ++ASD            D  K Y+L+DK  +G  G  GD ++  + I   +++YK  N   M+  A A      L+  L +R    Y+V  ++GG+D+ G  +++  D +GS     F   G  S +   +LD +    NM   E        A+ L+ D      +R VY     ++ ++ +EGI
Sbjct:   40 ILAIAGEDFAIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAM----LSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGI 231          
BLAST of Proteasome subunit beta vs. Ensembl Human
Match: PSMB10 (proteasome 20S subunit beta 10 [Source:HGNC Symbol;Acc:HGNC:9538])

HSP 1 Score: 58.5362 bits (140), Expect = 1.119e-9
Identity = 38/161 (23.60%), Postives = 73/161 (45.34%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCI 554
            + G+ F + +++ +D       +      +KI+ ++ K+     G + D       +   ++L+ +  G E          R+ L    R +     +L++GG+D +G P L+ +   GS   +PF   G G    L+VL+ ++ PNM  E A GLL + +
Sbjct:   42 IAGLVFQDGVILGADTRATNDSVVADKSCEKIHFIAPKIYCCGAGVAADAEMTTRMVASKMELHALSTGREPRVATVTRILRQTL---FRYQGHVGASLIVGGVDLTG-PQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQGLLVEAV 198          
BLAST of Proteasome subunit beta vs. Ensembl Celegans
Match: pbs-4 (Proteasome subunit beta type-2 [Source:UniProtKB/Swiss-Prot;Acc:P91477])

HSP 1 Score: 137.887 bits (346), Expect = 2.364e-40
Identity = 71/194 (36.60%), Postives = 117/194 (60.31%), Query Frame = 3
Query:   72 LIGIRFNNFILMASD-GNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGI-DKSGVPSLHFMDYLGS-IVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDV 644
            L+GI   N++++A+D        I   ++ DK Y L  KL +   G+ GD   F ++  +N+QLY +RNGYE+SP+ A HF RR +AE LR+++ Y V++L+GG  DK     L  +DYL + +   P+   G+      +++DR+Y  +M + E + L++ CI E ++RFV N+  +KV +ID++G   L+DV
Sbjct:    7 LVGISTENYVILAADKATFAYGAILADSENDKEYRLGKKLTMMCIGEEGDVAQFGDWTKRNLQLYSVRNGYEVSPSCAHHFVRRSIAEGLRSQDHYTVDVLIGGYDDKEDKAFLGSVDYLANGLGQQPYLFRGFCGRFCYAIMDREYKKDMTEAEGLALMNKCIGEAKRRFVANIPGYKVVIIDKKGYRKLDDV 200          
BLAST of Proteasome subunit beta vs. Ensembl Celegans
Match: pbs-2 (Proteasome subunit beta [Source:UniProtKB/TrEMBL;Acc:O62102])

HSP 1 Score: 58.9214 bits (141), Expect = 3.942e-10
Identity = 37/162 (22.84%), Postives = 76/162 (46.91%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIK 557
            ++ + F   ++M +D       I      +K+++L++ +     G + D     + +  N++L ++  G +     A    ++ L        AY   LL+GG+D +G P L+     G+ +  PF   G GSY  +++L+R +  +M K+EA  L+   ++
Sbjct:   49 IVAVAFKGGLVMGADSRATAGNIIADKHCEKVHKLTESIYACGAGTAADLDQVTKMLSGNLRLLELNTGRKARVITALRQAKQHLFNYQGYIGAY---LLIGGVDPTG-PHLYMCSANGTTMAFPFTAQGSGSYAAITILERDFKVDMTKDEAEKLVQRALE 206          
BLAST of Proteasome subunit beta vs. Ensembl Celegans
Match: pbs-3 (Proteasome subunit beta type-3 [Source:UniProtKB/Swiss-Prot;Acc:Q23237])

HSP 1 Score: 50.447 bits (119), Expect = 1.842e-7
Identity = 38/154 (24.68%), Postives = 69/154 (44.81%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVP--FAVHGYGSYVTLSVLDRKYNPNMCKEE 527
            ++ +  +  + +ASD   G  +  +  D  K+++++DK+ +G+ G   D  +  E I+    LY++R    + P   +      LA   R   +Y    L+ G+D +  P +  MD +G  V  P  F   G G    L V +  +  NM  +E
Sbjct:   11 VVAMAGDECVCIASDLRIGEQMTTIATDQKKVHKVTDKVYVGLAGFQSDARTVLEKIMFRKNLYELRENRNIKPQVLSEMI-SNLAYQHRF-GSYFTEPLVAGLDDTNKPYICCMDTIGC-VSAPRDFVAVGTGQEYLLGVCENFWRENMKPDE 161          
BLAST of Proteasome subunit beta vs. Ensembl Fly
Match: Prosbeta4 (gene:FBgn0032596 transcript:FBtr0335142)

HSP 1 Score: 194.512 bits (493), Expect = 1.770e-62
Identity = 88/196 (44.90%), Postives = 131/196 (66.84%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVG 653
            E L+GI+  +F+++A+D    RSII M+ D +KI+++SD L +   G+SGDT  F EFI +N+ LYK+RNGY++SP  +AHFTR+ LAE LR+R  Y V + + G D +  P L F+DYL + + V +A HGYG+    S+ DR ++PN+ + EA  +   CI EIQKR V NL NF V ++D++G+  LE ++  
Sbjct:    2 ETLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALYKMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYLANALPVNYAGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDGVRDLEPISAA 197          
BLAST of Proteasome subunit beta vs. Ensembl Fly
Match: Prosbeta4 (gene:FBgn0032596 transcript:FBtr0080936)

HSP 1 Score: 194.512 bits (493), Expect = 1.770e-62
Identity = 88/196 (44.90%), Postives = 131/196 (66.84%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVG 653
            E L+GI+  +F+++A+D    RSII M+ D +KI+++SD L +   G+SGDT  F EFI +N+ LYK+RNGY++SP  +AHFTR+ LAE LR+R  Y V + + G D +  P L F+DYL + + V +A HGYG+    S+ DR ++PN+ + EA  +   CI EIQKR V NL NF V ++D++G+  LE ++  
Sbjct:    2 ETLLGIKGPDFVMLAADTTHARSIIVMKEDQNKIHKVSDSLLISTVGESGDTEQFTEFISKNIALYKMRNGYDLSPRESAHFTRKNLAEYLRSRTPYQVFMFVAGYDPNAGPELTFIDYLANALPVNYAGHGYGAIFASSIYDRYWHPNITQAEAYDVFKKCIAEIQKRLVVNLKNFTVAVVDKDGVRDLEPISAA 197          
BLAST of Proteasome subunit beta vs. Ensembl Fly
Match: Prosbeta4R2 (gene:FBgn0031443 transcript:FBtr0077699)

HSP 1 Score: 166.392 bits (420), Expect = 3.224e-51
Identity = 77/196 (39.29%), Postives = 123/196 (62.76%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVG 653
            E ++GI+  +F+++ASD    +S++ M++D  KI+ LSD   +   GD GDT+ F +FI +N+ LYKI +GY +S  +AAHFTR+ LA+ +RT   Y V +LL G D    P LH++D  G+   +  A HG+GS    S+L R +N  + +E+A  L+  C+ EIQ+R + N  NF+V ++D +G+  +E +  G
Sbjct:    4 ETILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLHLYKISHGYHLSAKSAAHFTRKTLADYIRTNTRYQVAMLLAGYDAVEGPDLHYIDSYGAAQSINHAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYVVDSKGMRKMEAINPG 199          
BLAST of Proteasome subunit beta vs. Ensembl Fly
Match: Prosbeta4R2 (gene:FBgn0031443 transcript:FBtr0332513)

HSP 1 Score: 166.392 bits (420), Expect = 3.224e-51
Identity = 77/196 (39.29%), Postives = 123/196 (62.76%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVG 653
            E ++GI+  +F+++ASD    +S++ M++D  KI+ LSD   +   GD GDT+ F +FI +N+ LYKI +GY +S  +AAHFTR+ LA+ +RT   Y V +LL G D    P LH++D  G+   +  A HG+GS    S+L R +N  + +E+A  L+  C+ EIQ+R + N  NF+V ++D +G+  +E +  G
Sbjct:    4 ETILGIKGPDFVMLASDTMQAKSLVFMKDDQSKIHRLSDFNMMATVGDGGDTIQFTDFISKNLHLYKISHGYHLSAKSAAHFTRKTLADYIRTNTRYQVAMLLAGYDAVEGPDLHYIDSYGAAQSINHAGHGWGSMFCGSILQRYWNSKLSQEDAYSLMKKCVLEIQRRLIINQRNFEVYVVDSKGMRKMEAINPG 199          
BLAST of Proteasome subunit beta vs. Ensembl Fly
Match: Prosbeta4R1 (gene:FBgn0031442 transcript:FBtr0077697)

HSP 1 Score: 145.591 bits (366), Expect = 4.918e-43
Identity = 69/193 (35.75%), Postives = 117/193 (60.62%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDV 644
            E ++G++  +FI++ASD    +S + + +++ K + +SD   +   GD GD + F++FIL+N+ LYKI NGY+++   A HF RR L+  L++   + V+LL+GG D +  P LH++DYLG+ V V +  HG        +L+  Y P+M  + A  ++  C+ E+ KRFV NL N  + LI + GI+ +  +
Sbjct:    2 ETILGVKGTDFIILASDTMRNKSAMWLDDEVRKTHRISDYCMMSTAGDGGDCLKFSDFILRNMDLYKITNGYDLTVRGAVHFIRRHLSAYLKSDCTFQVSLLVGGYDLTSGPELHYIDYLGNSVPVRYGGHGAAMNFCTPILEEFYKPDMDTQAAYDVIKKCVIELYKRFVINLRNIDLFLISKNGITKMNSI 194          
BLAST of Proteasome subunit beta vs. Ensembl Zebrafish
Match: psmb2 (proteasome 20S subunit beta 2 [Source:ZFIN;Acc:ZDB-GENE-040718-353])

HSP 1 Score: 233.417 bits (594), Expect = 1.431e-77
Identity = 105/197 (53.30%), Postives = 152/197 (77.16%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVGK 656
            E LIGI+  +F+L+A+D     SII M++D DK+++LS+K+ L   G++GDTV FAE+I +NVQLYK+RNGYE+SP AAA+FTR+ LA+ LR+R  YHVNLLL G D++  P L++MDYL ++   PFA HGYG+++TLS+LDR Y P++ +EEA+ LL  C++E+ KRF+ NL +F V+LID++GI  +E + VG+
Sbjct:    2 EYLIGIQGPDFVLVAADNVAASSIIQMKHDYDKMFKLSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPAAAANFTRKNLADYLRSRTPYHVNLLLAGYDETDGPGLYYMDYLSALAKAPFAAHGYGAFLTLSILDRYYRPDLTREEAVDLLKKCLEELNKRFILNLPSFTVRLIDKDGIHDMEKLPVGR 198          
BLAST of Proteasome subunit beta vs. Ensembl Zebrafish
Match: psmb2 (proteasome 20S subunit beta 2 [Source:ZFIN;Acc:ZDB-GENE-040718-353])

HSP 1 Score: 202.986 bits (515), Expect = 4.561e-66
Identity = 89/164 (54.27%), Postives = 129/164 (78.66%), Query Frame = 3
Query:  165 IYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVGK 656
            +++LS+K+ L   G++GDTV FAE+I +NVQLYK+RNGYE+SP AAA+FTR+ LA+ LR+R  YHVNLLL G D++  P L++MDYL ++   PFA HGYG+++TLS+LDR Y P++ +EEA+ LL  C++E+ KRF+ NL +F V+LID++GI  +E + VG+
Sbjct:    1 MFKLSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPAAAANFTRKNLADYLRSRTPYHVNLLLAGYDETDGPGLYYMDYLSALAKAPFAAHGYGAFLTLSILDRYYRPDLTREEAVDLLKKCLEELNKRFILNLPSFTVRLIDKDGIHDMEKLPVGR 164          
BLAST of Proteasome subunit beta vs. Ensembl Zebrafish
Match: psmb1 (proteasome 20S subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-040618-2])

HSP 1 Score: 59.3066 bits (142), Expect = 3.076e-10
Identity = 51/196 (26.02%), Postives = 88/196 (44.90%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRN--AYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYN-PNM--------CKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGI 626
            ++ +   +F ++ASD            D  K Y+L+D   LG  G  GD ++  + I   +++YK  N   M+  A A      L+  L  R    Y+V  ++GG+D+ G  +++  D +GS     +   G  S +   +LD +    NM         +E+A+ L+ D      +R VY     KV ++ +EGI
Sbjct:   36 VLAVAGEDFAIVASDTRLSEGYSIHSRDSPKCYKLTDTTVLGCSGFHGDCLTLTKIIEARLKMYKHSNNKSMTSGAIAAM----LSTILYGRRFFPYYVYNIIGGLDEEGRGAVYSFDPVGSYQRDTYKAGGSASAMLQPLLDNQIGFKNMENVEHVPLTQEKAVQLVKDVFISAAERDVYTGDALKVCIVSKEGI 227          
BLAST of Proteasome subunit beta vs. Ensembl Zebrafish
Match: psmb10 (proteasome 20S subunit beta 10 [Source:ZFIN;Acc:ZDB-GENE-040718-278])

HSP 1 Score: 55.4546 bits (132), Expect = 1.084e-8
Identity = 40/161 (24.84%), Postives = 75/161 (46.58%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCI 554
            + G+ F + +++ +D      ++    +  KI+ ++  +     G + D     + +  NV+L+ +  G    P   A  TR+      R +     +L++GG+D +G   L+ +   GS   +PF   G G+   +SV + +Y PNM  EEA  L+ D I
Sbjct:   45 IAGLVFKDGVILGADTRATDDMVVADKNCMKIHYIAPNIYCCGAGVAADAEVTTQMMSSNVELHSLSTG---RPPLVAMVTRQLKQMLFRYQGHIGSSLIVGGVDVNGA-QLYSVYPHGSYDKLPFLTMGSGAASAISVFEDRYKPNMELEEAKQLVRDAI 201          
BLAST of Proteasome subunit beta vs. Ensembl Zebrafish
Match: psmb10 (proteasome 20S subunit beta 10 [Source:ZFIN;Acc:ZDB-GENE-040718-278])

HSP 1 Score: 55.4546 bits (132), Expect = 1.084e-8
Identity = 40/161 (24.84%), Postives = 75/161 (46.58%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCI 554
            + G+ F + +++ +D      ++    +  KI+ ++  +     G + D     + +  NV+L+ +  G    P   A  TR+      R +     +L++GG+D +G   L+ +   GS   +PF   G G+   +SV + +Y PNM  EEA  L+ D I
Sbjct:   45 IAGLVFKDGVILGADTRATDDMVVADKNCMKIHYIAPNIYCCGAGVAADAEVTTQMMSSNVELHSLSTG---RPPLVAMVTRQLKQMLFRYQGHIGSSLIVGGVDVNGA-QLYSVYPHGSYDKLPFLTMGSGAASAISVFEDRYKPNMELEEAKQLVRDAI 201          
BLAST of Proteasome subunit beta vs. Ensembl Xenopus
Match: septin4 (septin 4 [Source:Xenbase;Acc:XB-GENE-983580])

HSP 1 Score: 225.713 bits (574), Expect = 1.698e-74
Identity = 102/189 (53.97%), Postives = 147/189 (77.78%), Query Frame = 3
Query:   78 GIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDV 644
            GI+ N+F+L+A+D     SII M++D+DK++++S+K+ L   G++GDTV FAE+I +NVQLYK+RNGYE+SP AAA+FTRR LA+ LR+R  YHVNLLL G D+   PSL++MDYL ++    FA HGYG+Y+TLS+LDR Y P++ +E+A+ LL  CI E+QKRF+ +L +F V++ID++GI  LE +
Sbjct:    6 GIQGNDFVLVAADTVCANSIIKMKHDVDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADYLRSRTPYHVNLLLAGYDEHDGPSLYYMDYLAALAKTRFAAHGYGAYLTLSILDRYYKPDLTREDAVELLKKCIAELQKRFILSLPSFTVRVIDKDGIHDLETI 194          
BLAST of Proteasome subunit beta vs. Ensembl Xenopus
Match: rapgef3 (Rap guanine nucleotide exchange factor 3 [Source:Xenbase;Acc:XB-GENE-5955480])

HSP 1 Score: 63.929 bits (154), Expect = 1.622e-11
Identity = 43/161 (26.71%), Postives = 80/161 (49.69%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCI 554
            + GI F + +++ +D      +I    +  KI+ ++  +     G + DT    + I  N++L+ +  G  +S  A A+   +Q+    R +      L+LGG+D +G P L+ +   GS   +P+   G GS   ++V + +Y P+M +EEA  L+ D I
Sbjct:   46 IAGIVFKDGVILGADTRATEGMIVADKNCSKIHYIAPNVYCCGAGTAADTEMTTQMISSNMELHSLSTG-RLSRVATANRMLKQML--FRYQGYIGAALVLGGVDCTG-PHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDRYKPDMEEEEAKQLVRDAI 202          
BLAST of Proteasome subunit beta vs. Ensembl Xenopus
Match: rapgef3 (Rap guanine nucleotide exchange factor 3 [Source:Xenbase;Acc:XB-GENE-5955480])

HSP 1 Score: 63.5438 bits (153), Expect = 2.008e-11
Identity = 43/161 (26.71%), Postives = 80/161 (49.69%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCI 554
            + GI F + +++ +D      +I    +  KI+ ++  +     G + DT    + I  N++L+ +  G  +S  A A+   +Q+    R +      L+LGG+D +G P L+ +   GS   +P+   G GS   ++V + +Y P+M +EEA  L+ D I
Sbjct:   46 IAGIVFKDGVILGADTRATEGMIVADKNCSKIHYIAPNVYCCGAGTAADTEMTTQMISSNMELHSLSTG-RLSRVATANRMLKQML--FRYQGYIGAALVLGGVDCTG-PHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDRYKPDMEEEEAKQLVRDAI 202          
BLAST of Proteasome subunit beta vs. Ensembl Xenopus
Match: ttc38 (tetratricopeptide repeat domain 38 [Source:Xenbase;Acc:XB-GENE-5833263])

HSP 1 Score: 54.6842 bits (130), Expect = 1.477e-8
Identity = 43/189 (22.75%), Postives = 85/189 (44.97%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVL----DRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGI 626
            ++G++F+  +++A+D  G    +A   +I +I ++++   LG  GD  D     + I  +     +R        A + +  +    + R      + L L   D S    L ++D LG   + P    G+G+Y+   +L    +RK    + KEEA  L+  C+K +  R   + + F++  + E G+
Sbjct:    9 VLGVKFDGGVIIAADMLGSYGSLARFRNISRIMKVNESTILGASGDYADYQYLKQVIRPDELALPLRCHPGPLCQAPSLYCEQTEGLAPRRLPIAPIVLSLPLTDASSHSFLGYVDKLGVAFEAPTIATGFGAYLAQPLLREVTERKAT--LSKEEARALIERCMKVLYYRDARSYNRFEIATVTESGV 195          
BLAST of Proteasome subunit beta vs. Ensembl Xenopus
Match: psmb1 (proteasome subunit beta 1 [Source:NCBI gene;Acc:394589])

HSP 1 Score: 52.7582 bits (125), Expect = 7.926e-8
Identity = 46/197 (23.35%), Postives = 87/197 (44.16%), Query Frame = 3
Query:   69 CLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRN--AYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYN-PNMCK--------EEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGI 626
             ++ +  ++F L+ASD            +  K Y+L+D   +G  G   D ++  + I   +++YK  N   M+  A A      L+  L +R    Y+V  ++GG+D+ G  +++  D +GS     +   G  S +   +LD +    NM          E+A+ L+ D      +R VY      + ++ ++GI
Sbjct:   16 TVLALAGDDFALVASDTRLSEGYSIHSRNTPKCYKLTDNTVIGCTGFHADCLTLTKIIEARLKMYKHSNNKTMTSGAIAAM----LSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDAYKAGGSASAMLQPLLDNQIGYKNMQNVEQLPLTLEKALKLIKDVFISAAERDVYTGDALHISIVTKDGI 208          
BLAST of Proteasome subunit beta vs. Ensembl Mouse
Match: Psmb2 (proteasome (prosome, macropain) subunit, beta type 2 [Source:MGI Symbol;Acc:MGI:1347045])

HSP 1 Score: 216.468 bits (550), Expect = 7.123e-71
Identity = 103/197 (52.28%), Postives = 150/197 (76.14%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVGK 656
            E LIGI+  +++L+ASD     +I+ M++D DK++++S+K+ L   G++GDTV FAE+I +NVQLYK+RNGYE+SP AAA+FTRR LA+ LR+R  YHVNLLL G D+   P+L++MDYL ++   PFA HGYG+++TLS+LDR Y P + +E A+ LL  C++E+QKRF+ NL  F V++ID++GI  LE++A  K
Sbjct:    2 EYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRVIDKDGIHNLENIAFPK 198          
BLAST of Proteasome subunit beta vs. Ensembl Mouse
Match: Psmb4 (proteasome (prosome, macropain) subunit, beta type 4 [Source:MGI Symbol;Acc:MGI:1098257])

HSP 1 Score: 62.3882 bits (150), Expect = 3.570e-11
Identity = 44/189 (23.28%), Postives = 88/189 (46.56%), Query Frame = 3
Query:   69 CLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNV-QLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDR--KYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGI 626
             ++G++F+  +++A+D  G    +A   +I +I  ++D   LG  GD  D     + + Q V     + +G+  SP A   +  R +       N     +++GG    G   L ++D LG   + P    GYG+Y+   +L    +  P + + EA  L+  C++ +  R   + + F++  + E+G+
Sbjct:   55 SVLGVKFDGGVVIAADMLGSYGSLARFRNISRIMRVNDSTMLGASGDYADFQYLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGY-ADGESFLGYVDMLGVAYEAPSLATGYGAYLAQPLLREVLEKQPVLSQTEARELVERCMRVLYYRDARSYNRFQIATVTEKGV 242          
BLAST of Proteasome subunit beta vs. Ensembl Mouse
Match: Psmb7 (proteasome (prosome, macropain) subunit, beta type 7 [Source:MGI Symbol;Acc:MGI:107637])

HSP 1 Score: 58.9214 bits (141), Expect = 7.664e-10
Identity = 45/193 (23.32%), Postives = 89/193 (46.11%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAV 650
            + G+ + + I++ +D      ++    +  KI+ +S  +     G + DT    + I  N++L+ +  G       A    ++ L    R +      L+LGG+D +G P L+ +   GS   +P+   G GS   ++V + K+ P+M +EEA  L+ + I       + + SN  + +I +  + FL   +V
Sbjct:   46 IAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTANRMLKQML---FRYQGYIGAALVLGGVDVTG-PHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKKLVSEAIAAGIFNDLGSGSNIDLCVISKSKLDFLRPFSV 234          
BLAST of Proteasome subunit beta vs. Ensembl Mouse
Match: Psmb1 (proteasome (prosome, macropain) subunit, beta type 1 [Source:MGI Symbol;Acc:MGI:104884])

HSP 1 Score: 58.151 bits (139), Expect = 1.004e-9
Identity = 51/196 (26.02%), Postives = 88/196 (44.90%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRN--AYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYN-PNMCKEE--------AIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGI 626
            ++ I   +F ++ASD            D  K Y+L+DK  +G  G  GD ++  + I   +++YK  N   M+  A A      L+  L +R    Y+V  ++GG+D+ G  +++  D +GS     F   G  S +   +LD +    NM   E        A+ L+ D      +R VY     ++ ++ +EGI
Sbjct:   39 VLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAM----LSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVGFKNMQNVEHVPLTLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGI 230          
BLAST of Proteasome subunit beta vs. Ensembl Mouse
Match: Psmb1 (proteasome (prosome, macropain) subunit, beta type 1 [Source:MGI Symbol;Acc:MGI:104884])

HSP 1 Score: 53.5286 bits (127), Expect = 2.561e-8
Identity = 43/156 (27.56%), Postives = 72/156 (46.15%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRN--AYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAI 533
            ++ I   +F ++ASD            D  K Y+L+DK  +G  G  GD ++  + I   +++YK  N   M+  A A      L+  L +R    Y+V  ++GG+D+ G  +++  D +GS     F   G  S +   +LD   N  MC   A+
Sbjct:   39 VLAIAGEDFSIVASDTRLSEGFSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAM----LSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLD---NQVMCLSRAL 187          
BLAST of Proteasome subunit beta vs. UniProt/SwissProt
Match: sp|Q9R1P3|PSB2_MOUSE (Proteasome subunit beta type-2 OS=Mus musculus OX=10090 GN=Psmb2 PE=1 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 4.982e-70
Identity = 103/197 (52.28%), Postives = 150/197 (76.14%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVGK 656
            E LIGI+  +++L+ASD     +I+ M++D DK++++S+K+ L   G++GDTV FAE+I +NVQLYK+RNGYE+SP AAA+FTRR LA+ LR+R  YHVNLLL G D+   P+L++MDYL ++   PFA HGYG+++TLS+LDR Y P + +E A+ LL  C++E+QKRF+ NL  F V++ID++GI  LE++A  K
Sbjct:    2 EYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRVIDKDGIHNLENIAFPK 198          
BLAST of Proteasome subunit beta vs. UniProt/SwissProt
Match: sp|P40307|PSB2_RAT (Proteasome subunit beta type-2 OS=Rattus norvegicus OX=10116 GN=Psmb2 PE=1 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 1.636e-69
Identity = 102/197 (51.78%), Postives = 149/197 (75.63%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVGK 656
            E LIGI+  +++L+ASD     +I+ M++D DK++++S+K+ L   G++GDTV FAE+I +NVQLYK+RNGYE+SP AAA+FTRR LA+ LR+R  YHVNLLL G D+   P+L++MDYL ++   PFA HGYG+++TLS+LDR Y P + +E A+ LL  C++E+QKRF+ NL  F V++ID++GI  LE++   K
Sbjct:    2 EYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRVIDKDGIHNLENITFTK 198          
BLAST of Proteasome subunit beta vs. UniProt/SwissProt
Match: sp|P49721|PSB2_HUMAN (Proteasome subunit beta type-2 OS=Homo sapiens OX=9606 GN=PSMB2 PE=1 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 1.563e-68
Identity = 101/197 (51.27%), Postives = 149/197 (75.63%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVGK 656
            E LIGI+  +++L+ASD     +I+ M++D DK++++S+K+ L   G++GDTV FAE+I +NVQLYK+RNGYE+SP AAA+FTRR LA+ LR+R  YHVNLLL G D+   P+L++MDYL ++   PFA HGYG+++TLS+LDR Y P + +E A+ LL  C++E+QKRF+ NL  F V++ID+ GI  L++++  K
Sbjct:    2 EYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPK 198          
BLAST of Proteasome subunit beta vs. UniProt/SwissProt
Match: sp|Q5E9K0|PSB2_BOVIN (Proteasome subunit beta type-2 OS=Bos taurus OX=9913 GN=PSMB2 PE=1 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 1.563e-68
Identity = 101/197 (51.27%), Postives = 149/197 (75.63%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVGK 656
            E LIGI+  +++L+ASD     +I+ M++D DK++++S+K+ L   G++GDTV FAE+I +NVQLYK+RNGYE+SP AAA+FTRR LA+ LR+R  YHVNLLL G D+   P+L++MDYL ++   PFA HGYG+++TLS+LDR Y P + +E+A+ LL  C++E+QKRF+ NL  F V++ID  GI  L++++  K
Sbjct:    2 EYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADYLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISREKAVELLRKCLEELQKRFILNLPTFSVRIIDRNGIHDLDNISFPK 198          
BLAST of Proteasome subunit beta vs. UniProt/SwissProt
Match: sp|P22141|PSB4_YEAST (Proteasome subunit beta type-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRE1 PE=1 SV=2)

HSP 1 Score: 171.4 bits (433), Expect = 2.117e-52
Identity = 78/193 (40.41%), Postives = 124/193 (64.25%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGID-KSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLED 641
            + ++GIR  + +++AS     R I  +++  DK  +LS    +   G++GDTV FAE+I  N+QLY IR  YE+SP A + F R++LA+S+R+R  Y VN+L+GG D K   P L+ +DYLG+ V++P+  HGY  + T S+LD  Y P+M  EE + LL  C++E++KR   +     VK++D++GI  ++D
Sbjct:    2 DIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDD 194          
BLAST of Proteasome subunit beta vs. TrEMBL
Match: A0A1W4WMT1 (Proteasome subunit beta OS=Agrilus planipennis OX=224129 GN=LOC108734379 PE=3 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 1.785e-78
Identity = 108/195 (55.38%), Postives = 149/195 (76.41%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAV 650
            EC+IGI+F +F ++A+D    +SII M+ND +K+++LSDKL + I G+ GDT  FAE+I +N+QLYK+RNGYE+SPNAAA FTRR LAE+LRTRNAYHVNLLL G D    P+L+FMDYL SI +V +A HGYG + +LSV+DR Y  NM +E+A  L+  C++E+ +R + NL NFKV+++D+ GI+ L D+  
Sbjct:    2 ECIIGIKFKDFAIVAADMTTAQSIIVMKNDENKLHKLSDKLVMAITGEQGDTTQFAEYIAKNIQLYKMRNGYELSPNAAATFTRRNLAEALRTRNAYHVNLLLAGYDDQTGPALYFMDYLASIAEVKYAAHGYGGFFSLSVMDRYYLSNMNREDAYELMKKCVREVHQRLIINLPNFKVQIVDKNGITNLPDITA 196          
BLAST of Proteasome subunit beta vs. TrEMBL
Match: A2IAA2 (Proteasome subunit beta OS=Xenopsylla cheopis OX=163159 PE=2 SV=1)

HSP 1 Score: 239.58 bits (610), Expect = 1.261e-76
Identity = 105/190 (55.26%), Postives = 149/190 (78.42%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFL 635
            ECL+GIRF+ FI++A+D    +SI+ M+N+ +KIYE++D++ +GI G+SGDT  FAE+I +N+QLYK+RNGY +S  +AA+FTRR LA++LR+RNAYHVN+L+GG DK G P L+FMDYLG+ V +P+A HGYG + +LS++DR Y  +M +EEA  ++  CI EI KR + NL NFKV ++DE GI +L
Sbjct:    2 ECLLGIRFDKFIMIAADMTNAQSIVVMKNEENKIYEMTDRIVMGINGESGDTTQFAEYIAKNIQLYKMRNGYSVSTVSAANFTRRNLADALRSRNAYHVNMLIGGHDKEGGPQLYFMDYLGACVSLPYACHGYGGFFSLSIMDRYYRSDMSQEEAYAIIKRCISEIHKRLIINLPNFKVVVVDENGIKYL 191          
BLAST of Proteasome subunit beta vs. TrEMBL
Match: R7THR9 (Proteasome subunit beta OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_176004 PE=3 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 2.924e-76
Identity = 99/193 (51.30%), Postives = 152/193 (78.76%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDV 644
            ECLIGI+  +F+ +A+D    RSI+ M++D DK+Y++SD++ + + G+SGDTV FAE+I +N+QLYK+RNGYE+SP+AAA+FTR+ +A+ LR+R  Y VNLL+ G D+   PSL FMDYL S+V+VP+ +HGYGSY++L +LD+ Y  ++ +EE + LL  C++EI+KRF+ NL  FK+K++D++G+  L+D+
Sbjct:    2 ECLIGIKGKDFVAIATDAKSARSIVQMKHDTDKVYKMSDRVVMAVSGESGDTVQFAEYIAKNIQLYKMRNGYELSPHAAANFTRKNMADFLRSRTPYMVNLLMAGFDEEKGPSLFFMDYLASLVEVPYGIHGYGSYLSLGILDKFYREDLNREEVLELLRKCVQEIEKRFIVNLGTFKIKIVDKDGVHVLDDI 194          
BLAST of Proteasome subunit beta vs. TrEMBL
Match: A0A1I8GCK1 (Proteasome subunit beta OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig015617g1 PE=3 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 3.563e-76
Identity = 111/194 (57.22%), Postives = 155/194 (79.90%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKS-GVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDV 644
            ECLIGI+FN+++L+A+D NGGRSII+M++D+DK++ LS++LA+ + G+SGDT  FAEFI QNVQLYKIR+GYE+SP AAA+FTRR  A+SLR+R+ Y VN+LL G D + G P L+++DYLGS++ +PF+V GYG Y++LSVLDR Y P+M + + I LL   I EIQKR V +LS F+V  +D  G++ L+D+
Sbjct:    2 ECLIGIQFNDYVLLAADCNGGRSIISMKDDVDKMFRLSERLAIIVSGESGDTNKFAEFIEQNVQLYKIRHGYELSPYAAANFTRRNQAQSLRSRSPYFVNMLLAGYDANKGQPELYYLDYLGSLMKLPFSVIGYGGYMSLSVLDRHYRPDMAEADGIRLLRTVISEIQKRLVISLSKFRVHRVDRNGVTQLDDI 195          
BLAST of Proteasome subunit beta vs. TrEMBL
Match: A0A0R3WX87 (Proteasome subunit beta OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS5363 PE=3 SV=1)

HSP 1 Score: 237.269 bits (604), Expect = 8.606e-76
Identity = 109/193 (56.48%), Postives = 148/193 (76.68%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDV 644
            ECLIGI FN+F ++A+D     S++ +++D DK+++LS    + ICG+SGDTV FAEFI QN+QLY+IRNGYE++P AAA FTRR LAE+LRTRN Y+VNLLL G D    P +++MDYL S+VDVP+AVHG+GS+VTL+VLD +Y+P M  + A+ LL  CI E+QKRFV N   F VK+++++GI  L D+
Sbjct:    2 ECLIGIAFNDFAIVAADARVNHSVVTLKDDADKMFKLSKHCLMSICGESGDTVQFAEFIQQNMQLYEIRNGYELTPYAAASFTRRNLAEALRTRNPYNVNLLLAGYDSCAGPKIYYMDYLASMVDVPYAVHGHGSFVTLAVLDSQYDPAMKIDHALILLKSCITELQKRFVINYGRFIVKVVNKDGIENLPDL 194          
BLAST of Proteasome subunit beta vs. Ensembl Cavefish
Match: psmb2 (proteasome 20S subunit beta 2 [Source:NCBI gene;Acc:103046353])

HSP 1 Score: 229.95 bits (585), Expect = 2.312e-76
Identity = 103/196 (52.55%), Postives = 152/196 (77.55%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVG 653
            E L+GI+  +F+L+A+D     SII M++D DK+++LS+K+ L   G++GDTV FAE+I +NVQLYK+RNGYE+SP AAA+FTR+ LA+ LR+R  YHVNLLL G D+S  P L++MD+L ++   PFA HGYG+++TLS+LDR Y P++ ++EA+ LL  C++E++KRF+ NL +F V+LID++GI  LE + +G
Sbjct:    2 EYLLGIQGQDFVLVAADNVAASSIIQMKHDYDKMFKLSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPAAAANFTRKNLADYLRSRTPYHVNLLLAGYDESDGPGLYYMDHLSALAKAPFAAHGYGAFLTLSILDRYYRPDLTRDEAVELLKKCVEELKKRFILNLPSFTVRLIDKDGIHDLEKLPLG 197          
BLAST of Proteasome subunit beta vs. Ensembl Cavefish
Match: psmb4 (proteasome 20S subunit beta 4 [Source:NCBI gene;Acc:103028437])

HSP 1 Score: 61.2326 bits (147), Expect = 6.962e-11
Identity = 43/192 (22.40%), Postives = 90/192 (46.88%), Query Frame = 3
Query:   69 CLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNV-QLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDR--KYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFL 635
             ++G++F   +++A+D  G    +A   +I ++ +++D   LG  GD  D     + I Q V     + +G+  SP A   +  R +       N     +++GG   +G   L ++D LG   + P    G+G+Y+   ++    +    + K+EA  L+  C++ +  R   + +  ++ ++ EEG+  L
Sbjct:   49 SVLGVKFTGGVIIAADMLGSYGSLARFRNISRLMKVNDNTILGASGDYADYQYLKQIIEQMVIDEELLGDGHSYSPKAIHSWLTRVMYNRRSRMNPLWNTVVIGGF-YNGESFLGYVDKLGVAYEAPTVATGFGAYLAQPLMREVVENKAEITKDEARALIERCLRVLYYRDARSYNRHEIAIVTEEGVEIL 239          
BLAST of Proteasome subunit beta vs. Ensembl Cavefish
Match: psmb10 (proteasome subunit beta type-7-like [Source:NCBI gene;Acc:103034426])

HSP 1 Score: 60.8474 bits (146), Expect = 1.109e-10
Identity = 47/188 (25.00%), Postives = 89/188 (47.34%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFL 635
            + GI F + +++ +D      ++    +  KI+ ++ K+     G + D     + +  N++L+ +  G    P      TR+      R +     +L++GG+D +G P L+ +   GS   +PF   G G+   +SV + ++ PNM  EEA  L+ D I       + + SN  + +I E+G+ FL
Sbjct:   47 IAGIIFKDGVILGADTRATDDMVVADKNCIKIHYIAPKIYCCGAGVAADAEVTTQMMSSNIELHSLSTG---RPPLVVTVTRQLKQMLFRYQGHIGSSLIVGGVDVNG-PQLYSVYPHGSYDKLPFLTMGSGAASAVSVFEDRFKPNMELEEAKQLVRDAIVAGIFCDLGSGSNVDLCVITEKGVDFL 230          
BLAST of Proteasome subunit beta vs. Ensembl Cavefish
Match: psmb13a (proteasome subunit beta type-7-like [Source:NCBI gene;Acc:103024985])

HSP 1 Score: 58.9214 bits (141), Expect = 6.019e-10
Identity = 42/188 (22.34%), Postives = 87/188 (46.28%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFL 635
            + G+ + + +++ +D     S +       KI+ ++  +     G + DT    + +  N+ ++ + +G       AA+  +  L    R R     NL+LGG+D +G   ++ +   GS+  VPF   G G    + VL+ ++ P++  EEA  L+ D I       + + +N  + +I  EG+ ++
Sbjct:   46 IAGVVYKDGVVLGADTRATSSEVVADKMCAKIHYIAPNIYCCGAGTAADTEKTTDMLSSNLTIFSLNSGRNPRVVMAANIIQDML---FRYRGGIGANLILGGVDCTG-SHIYNVGPFGSMTKVPFIAMGSGDLAAMGVLEDRFKPSLELEEAKFLVRDAIHAGIMSDLGSGNNIDICVITREGVDYI 229          
BLAST of Proteasome subunit beta vs. Ensembl Cavefish
Match: psmb1 (proteasome 20S subunit beta 1 [Source:NCBI gene;Acc:103036260])

HSP 1 Score: 56.6102 bits (135), Expect = 2.666e-9
Identity = 50/196 (25.51%), Postives = 87/196 (44.39%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRN--AYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYN-PNM--------CKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGI 626
            ++ +   +F L+ASD            D  K Y+L+D   +G  G  GD ++  + I   +++YK  N   M+  A A      L+  L  R    Y+V  ++GG+D+ G  +++  D +GS     +   G  S +   +LD +    NM          E+A+ L+ D      +R VY     K+ ++ +EGI
Sbjct:   39 VLAVAGEDFALVASDTRLSEGYSIHSRDSPKCYKLTDTTVIGCSGFHGDCLTLTKIIDARLKMYKHANNKSMTSGAIAAM----LSTILYGRRFFPYYVYNIIGGLDEEGRGAVYSFDPVGSYQRDSYKAGGSASAMLQPLLDNQIGFKNMENVQQLPLTLEKAVQLVKDVFISAAERDVYTGDALKICIVTKEGI 230          
BLAST of Proteasome subunit beta vs. Ensembl Sea Lamprey
Match: psmb2 (proteasome 20S subunit beta 2 [Source:ZFIN;Acc:ZDB-GENE-040718-353])

HSP 1 Score: 199.904 bits (507), Expect = 2.288e-65
Identity = 88/164 (53.66%), Postives = 126/164 (76.83%), Query Frame = 3
Query:  153 DIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDV 644
            D +K++ LSD++ L   G+SGDTV FAE++ +NVQLYK+RNGYE+SP AAA+FTRR LA+ LR+R  YHVNLLL G ++S  PSL +MDYL S+V VPFA HGYG+ +T+++LDR Y+P++ +EEA+ +L  C +E+ KRF+ NL  F V+++D+ G+  L  +
Sbjct:    1 DQEKMFRLSDRILLLCTGESGDTVQFAEYVQKNVQLYKMRNGYELSPTAAANFTRRNLADYLRSRTPYHVNLLLAGYEESEGPSLFYMDYLSSMVRVPFAAHGYGAALTITILDRHYHPDLTREEAVEILQKCAQEMHKRFLVNLPAFTVRIVDQGGVHDLPTI 164          
BLAST of Proteasome subunit beta vs. Ensembl Sea Lamprey
Match: psmb4 (proteasome 20S subunit beta 4 [Source:ZFIN;Acc:ZDB-GENE-050417-333])

HSP 1 Score: 77.7962 bits (190), Expect = 1.099e-17
Identity = 52/194 (26.80%), Postives = 100/194 (51.55%), Query Frame = 3
Query:   69 CLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNV---QLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVL--DRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFL 635
             ++GI+FN  +L+A+D  G    +A   +I ++  ++DK  LG  GD  D     + + Q V   Q+  + +G+  +P A   +  R +       N     +++GG  K G   L ++D LG   + P    G+G+Y+ L +L  +++ NP+M ++EA+ L+  C+K +  R   + + F++ ++ +EG   L
Sbjct:   18 SVLGIKFNGGVLVAADMLGSYGSLARFRNISRLMAVNDKTLLGASGDYADFQYLKDVLEQMVIDDQV--LEDGHYYTPKAIHSWLTRVMYNRRSKFNPLWNTIVVGGYHK-GESFLGYVDKLGVAYESPVVATGFGAYLALPLLRDEQEKNPDMSQQEAMELMERCLKILYYRDARSYNKFEIAVVTKEGSKVL 208          
BLAST of Proteasome subunit beta vs. Ensembl Sea Lamprey
Match: psmb7 (proteasome 20S subunit beta 7 [Source:ZFIN;Acc:ZDB-GENE-001208-4])

HSP 1 Score: 69.707 bits (169), Expect = 1.876e-14
Identity = 54/215 (25.12%), Postives = 100/215 (46.51%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVGK*SCNDKNCLFVSQ*IFRFKK 716
            + GI F + +++ +D       I    + +KI+ L+  +     G + DT    + I  N++L+ +  G +     A    ++ L    R +     +L+LGG+D +G P L+ +   GS   +P+   G GS   ++V + ++ PNM +EEA  L+ D I       + + SN  + +I +E + +L    V     N K    V Q  +R+K+
Sbjct:   46 IAGIIFKDGVVLGADTRATEDTIVADKNCEKIHYLAPNMYCCGAGTAADTEMTTQLISSNLELHSLSTGRQGRVVTANRMLKQML---FRYQGHIGASLVLGGVDITG-PQLYSIHPHGSTDKLPYVTMGSGSLAAMAVFEDRFKPNMEEEEAKQLVRDAIAAGIFNDLGSGSNIDLCVITKEKVDYLRPYEV----ANKKG---VRQNSYRYKR 249          
BLAST of Proteasome subunit beta vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009464.1 (pep scaffold:Pmarinus_7.0:GL476605:530828:534431:-1 gene:ENSPMAG00000008555.1 transcript:ENSPMAT00000009464.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.3654 bits (111), Expect = 9.454e-7
Identity = 39/172 (22.67%), Postives = 74/172 (43.02%), Query Frame = 3
Query:   75 IGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNL--LLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYN 584
            +  +F + +++A D             + K+ E++  L   + G + D + +   + +  ++Y++RN   +S  AA+      LA  +       +++  ++ G DK G P L+++D  G  +       G GS     VLD  Y  ++ KEEA  L    I     R  Y+
Sbjct:   74 LAFKFQHGVIVAVDSRATAGSYIASQTVKKVIEINPYLLGTMAGGAADCMYWERVLAKQCRIYELRNKERISVAAASKL----LANMVYQYKGMGLSMGTMICGWDKKG-PGLYYVDDEGMRLPGSMFAVGSGSPYAFGVLDSGYREDLTKEEAYDLGRRAIASATHRDAYS 240          
BLAST of Proteasome subunit beta vs. Ensembl Yeast
Match: PRE1 (Beta 4 subunit of the 20S proteasome; localizes to the nucleus throughout the cell cycle [Source:SGD;Acc:S000000814])

HSP 1 Score: 171.4 bits (433), Expect = 3.049e-54
Identity = 78/193 (40.41%), Postives = 124/193 (64.25%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGID-KSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLED 641
            + ++GIR  + +++AS     R I  +++  DK  +LS    +   G++GDTV FAE+I  N+QLY IR  YE+SP A + F R++LA+S+R+R  Y VN+L+GG D K   P L+ +DYLG+ V++P+  HGY  + T S+LD  Y P+M  EE + LL  C++E++KR   +     VK++D++GI  ++D
Sbjct:    2 DIILGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANIQLYSIREDYELSPQAVSSFVRQELAKSIRSRRPYQVNVLIGGYDKKKNKPELYQIDYLGTKVELPYGAHGYSGFYTFSLLDHHYRPDMTTEEGLDLLKLCVQELEKRMPMDFKGVIVKIVDKDGIRQVDD 194          
BLAST of Proteasome subunit beta vs. Ensembl Yeast
Match: PUP1 (Beta 2 subunit of the 20S proteasome; endopeptidase with trypsin-like activity that cleaves after basic residues; synthesized as a proprotein before being proteolytically processed for assembly into 20S particle; human homolog is subunit Z [Source:SGD;Acc:S000005683])

HSP 1 Score: 62.7734 bits (151), Expect = 2.856e-12
Identity = 42/163 (25.77%), Postives = 81/163 (49.69%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVH-GYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIK 557
            ++G++FNN +++A+D    +  I    +  K++ +S K+     G + DT +  + I  N++L+ +    E    +A    ++ L +      AY   L++ G+D +G  S  F  +     DV + +  G GS   ++VL+  +  ++ KEEAI L  D I+
Sbjct:   32 IVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGSNIELHSLYTSREPRVVSALQMLKQHLFKYQGHIGAY---LIVAGVDPTG--SHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLASDAIQ 189          
BLAST of Proteasome subunit beta vs. Ensembl Yeast
Match: PRE3 (Beta 1 subunit of the 20S proteasome; responsible for cleavage after acidic residues in peptides [Source:SGD;Acc:S000003538])

HSP 1 Score: 53.5286 bits (127), Expect = 3.490e-9
Identity = 33/166 (19.88%), Postives = 74/166 (44.58%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQK 569
            ++ + F + +++ +D              DK+  + DK+     G + DT + A+ +  +++LY  + G   +  AA+ F  ++L      ++     +++ G D      ++ +   GS+  +P+A+ G GS       D+ +  NM KEE +  +   + +  K
Sbjct:   22 IMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPSTETAASVF--KELC--YENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIK 183          
BLAST of Proteasome subunit beta vs. Ensembl Yeast
Match: PUP3 (Beta 3 subunit of the 20S proteasome; involved in ubiquitin-dependent catabolism; human homolog is subunit C10 [Source:SGD;Acc:S000000896])

HSP 1 Score: 45.8246 bits (107), Expect = 1.378e-6
Identity = 38/154 (24.68%), Postives = 64/154 (41.56%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGID-KSGVPSLHFMDYLGSIVDVP-FAVHGYGSYVTLSVLDRKYNPNMCKEE 527
            ++ +   + + +A D   G   + + N  +KI+     + LGI G + D  +  E       LYK++    + P          L E  R    Y V  ++ GI+ KSG P +   D +G I +   F V G  S     + +  Y PN+  E+
Sbjct:   12 VVAMTGKDCVAIACDLRLGSQSLGVSNKFEKIFHYG-HVFLGITGLATDVTTLNEMFRYKTNLYKLKEERAIEPETFTQLVSSSLYE--RRFGPYFVGPVVAGINSKSGKPFIAGFDLIGCIDEAKDFIVSGTASDQLFGMCESLYEPNLEPED 162          
BLAST of Proteasome subunit beta vs. Ensembl Nematostella
Match: EDO32854 (Proteasome subunit beta type [Source:UniProtKB/TrEMBL;Acc:A7STW4])

HSP 1 Score: 221.861 bits (564), Expect = 1.252e-73
Identity = 101/187 (54.01%), Postives = 142/187 (75.94%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGI 626
            E LIGI+ + F+L+A+D   GRSI+ M++D DK+ +LSD L + + G+SGDT  FAE+I +NVQLYK+RNGY+++P+AAA+FTRR LAE LR+R  Y VNLLL G   +  P+L+ MDYL ++  VPFA HGYGS+  LS++DR + PNM K++A+ LL  C  E+QKRF+ NL NF V+++D++GI
Sbjct:    2 EFLIGIQGDGFVLVAADCASGRSIVRMKDDYDKMTKLSDNLLMLVTGESGDTAQFAEYIEKNVQLYKMRNGYDLTPHAAANFTRRTLAEYLRSRTPYMVNLLLAGHSSNEGPALYHMDYLAALSKVPFAAHGYGSFFVLSIMDRYFKPNMTKDQALELLERCTNEVQKRFIVNLPNFTVRVVDKDGI 188          
BLAST of Proteasome subunit beta vs. Ensembl Nematostella
Match: EDO40407 (Proteasome subunit beta type [Source:UniProtKB/TrEMBL;Acc:A7S7D6])

HSP 1 Score: 74.7146 bits (182), Expect = 4.321e-16
Identity = 52/193 (26.94%), Postives = 96/193 (49.74%), Query Frame = 3
Query:   69 CLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNV-QLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKY--NPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLE 638
             ++GI+FN  +LMA+D  G    +A   +I ++  +++   +G  GD  D       + Q V     + +G+  +P +   +  R +       +     +++GGI+K G   L F+D +G   + P    G+G+Y+   +L   Y  NPNM +EEA  LL +C+K +  R   +L+ F++ +I ++G    E
Sbjct:   53 SVLGIKFNGGVLMAADTLGSYGSLARYRNISRLMRVNENTIIGAAGDYADFQYIKSVLEQKVIDDACLADGHGYTPKSIFSWLTRTMYYRRTKFDPLWNQIIVGGIEK-GESFLGFVDKIGIAYEAPTLASGFGAYLAQPLLRDAYEKNPNMSEEEARKLLVECLKVLFYRDGRSLNRFEIAVITKDGTKVEE 244          
BLAST of Proteasome subunit beta vs. Ensembl Nematostella
Match: EDO34100 (Proteasome subunit beta type [Source:UniProtKB/TrEMBL;Acc:A7SQB6])

HSP 1 Score: 66.2402 bits (160), Expect = 3.505e-13
Identity = 49/194 (25.26%), Postives = 91/194 (46.91%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLE--DVA 647
            + GI F + +++ +D       I    +  KI+ ++  +     G + DT    + I   +QL+ +  G +     +    +++L    R +      L+LGG+D SG P LH +   GS   +P+   G GS   ++V + +Y P+M  EEA  L+ D I       + + SN  + +I ++G+ ++   DVA
Sbjct:   19 IAGIVFKDGVILGADTRATEDTIVADKNCSKIHYIAPNIYCCGAGTAADTEYVTDLISSQIQLHSLNTGRQARIVTSLRMLKQRL---FRYQGYISAALVLGGVDFSG-PHLHTVYPHGSTDSLPYVTMGSGSLAAMAVFESRYRPDMELEEAKQLVRDGIAAGIFNDLGSGSNVDLCVITKDGVDYIRPYDVA 208          
BLAST of Proteasome subunit beta vs. Ensembl Nematostella
Match: EDO34642 (Proteasome subunit beta type [Source:UniProtKB/TrEMBL;Acc:A7SNR2])

HSP 1 Score: 54.299 bits (129), Expect = 6.062e-9
Identity = 45/196 (22.96%), Postives = 83/196 (42.35%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRK----------YNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGIS 629
            ++ I   +F ++ASD    +       D  K+Y+L+    LG  G  GD ++  + I   +Q+Y+  +G  MS  A A      L    R    Y+   +L G+D  G   +   D +GS     +   G  S +   +LD +          + P + +++A+ L+ D      +R +Y      + ++  EG+S
Sbjct:   28 VLAISGEDFAVIASDTRLSQGFQIHTRDSPKVYKLTGSTVLGCSGFHGDCLTLTKHISARLQMYEHDHGKAMSCTAIAQMLSTMLY--YRRFFPYYTYNILAGLDSEGKGCVFSFDPVGSYEREVYRAGGSASALLQPLLDNQIGFKNQEGVPHTP-LTRDKAVALVKDVFTSAAERDIYTGDAVIINVVSSEGVS 220          
BLAST of Proteasome subunit beta vs. Ensembl Nematostella
Match: EDO42974 (Proteasome subunit beta type [Source:UniProtKB/TrEMBL;Acc:A7S085])

HSP 1 Score: 46.2098 bits (108), Expect = 2.561e-6
Identity = 35/150 (23.33%), Postives = 68/150 (45.33%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGID-KSGVPSLHFMDYLGSIVDVP-FAVHGYGSYVTLSVLDRKYNPNM 515
            +I +   N + +A+D   G     +  D  KI+++ +KL +G+ G + D  + +  +   + LY++R G  + P          L E  R    Y V  ++ G+D K+  P +  MD +G  ++   F V G  S     + +  + P++
Sbjct:   11 IIAMVGKNCVAIAADRRLGIQAQTVSCDFQKIFQMGEKLFVGLPGLATDVQTISSRLKFRLNLYELREGRPIKPKTFLSMVSNLLYE--RRFGPYFVEPVIAGLDPKTNEPFISSMDLIGCPMETKDFVVSGTCSEQMYGMCESLWVPDL 158          
BLAST of Proteasome subunit beta vs. Ensembl Medaka
Match: psmb2 (proteasome 20S subunit beta 2 [Source:NCBI gene;Acc:101166972])

HSP 1 Score: 231.106 bits (588), Expect = 8.235e-77
Identity = 105/196 (53.57%), Postives = 150/196 (76.53%), Query Frame = 3
Query:   66 ECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVG 653
            E LIGI+  +F+L+A+D     SII M++D DK+++LS+K+ L   G++GDTV FAE+I +NVQLYK+RNGYE+SP+AAA+FTR+ LA+ LR+R  YHVNLLL G D +  P L +MDYL S+   PFA HGYG+++TLS+LDR Y P++ +EEA+ +L  C++E+ KRF+ NL +F V+LID++GI  +E + VG
Sbjct:    2 EYLIGIQGPDFVLVAADNVAASSIIQMKHDYDKMFKLSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPSAAANFTRKNLADYLRSRTPYHVNLLLAGYDDADGPGLFYMDYLSSLAKAPFAAHGYGAFLTLSILDRDYKPDLTREEAMNILRKCVEELNKRFILNLHSFNVRLIDKDGIHDMEKLTVG 197          
BLAST of Proteasome subunit beta vs. Ensembl Medaka
Match: psmb4 (proteasome 20S subunit beta 4 [Source:NCBI gene;Acc:101169953])

HSP 1 Score: 60.8474 bits (146), Expect = 1.019e-10
Identity = 43/192 (22.40%), Postives = 91/192 (47.40%), Query Frame = 3
Query:   69 CLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNV-QLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDR--KYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFL 635
             ++G++F   +++A+D  G    +A   +I ++ +++D   LG  GD  D     + I Q V     + +G+  SP A   +  R +       N     ++LGG   +G   L ++D LG   + P    G+G+Y+   ++    +   ++ K+EA  L+  C+K +  R   + +  ++ ++ E+G+  +
Sbjct:   50 SVLGVKFAGGVIIAADMLGSYGSLARFRNISRLMKVNDNTILGASGDYADYQYLKQVIEQMVIDEELLGDGHSYSPKAIHSWLTRVMYNRRSKMNPLWNTVVLGGF-YNGESFLGYVDKLGVAYEAPTVATGFGAYLAQPLMREVVENKADITKQEARDLIERCLKVLYYRDARSYNRHEIAIVTEQGVEII 240          
BLAST of Proteasome subunit beta vs. Ensembl Medaka
Match: psmb1 (proteasome 20S subunit beta 1 [Source:NCBI gene;Acc:101158593])

HSP 1 Score: 58.5362 bits (140), Expect = 5.807e-10
Identity = 49/196 (25.00%), Postives = 89/196 (45.41%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRN--AYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYN-PNM--------CKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGI 626
            ++ +   +F ++ASD            D  K Y+L+D   LG  G  GD ++  + I   +++YK  N   M+  A A      L+  L +R    Y+V  ++GG+D+ G  +++  D +GS     +   G  S +   +LD +    NM         K++A+ L+ D      +R VY     ++ ++ +EGI
Sbjct:   36 VLAVAGEDFAIVASDTRLSEGYSIHSRDSPKCYKLTDTTVLGCSGFHGDCLTLTKIIDARLKMYKHSNNKTMTSGAIAAM----LSTILYSRRFFPYYVYNIIGGLDEQGKGAVYSFDPVGSYQRDTYKAGGSASAMLQPLLDNQIGFKNMEGVEHVPLTKDKAVQLVKDVFVSAAERDVYTGDALRICIVTKEGI 227          
BLAST of Proteasome subunit beta vs. Ensembl Medaka
Match: psmb8 (proteasome 20S subunit beta 8 [Source:NCBI gene;Acc:100049532])

HSP 1 Score: 51.6026 bits (122), Expect = 1.784e-7
Identity = 43/185 (23.24%), Postives = 82/185 (44.32%), Query Frame = 3
Query:   75 IGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRN-AYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGI 626
            +  +F + +++A D           ND++K+ E++  L   + G + D   +   + +  +LY++RN + +S  AA+      +   L  R     V  ++ G DK G P L+++D  G+ +       G G+     V+D  Y  +M  EEA  L    I     R  Y+  +  +  + E+G+
Sbjct:   75 LAFKFRHGVIVAVDSRASAGNYLASNDVNKVIEINPYLLGTMSGSAADCQYWERLLAKECRLYRLRNNHRISVAAASKLLCNMM---LGYRGMGLSVGSMICGWDKEG-PGLYYVDDNGTRLSGRMFSTGCGNSYAYGVVDSGYKEDMTVEEAYELGCRGIAHATHRDAYSGGSVNMYHMREDGL 255          
BLAST of Proteasome subunit beta vs. Ensembl Medaka
Match: psmb8 (proteasome 20S subunit beta 8 [Source:NCBI gene;Acc:100049532])

HSP 1 Score: 51.2174 bits (121), Expect = 2.465e-7
Identity = 43/184 (23.37%), Postives = 81/184 (44.02%), Query Frame = 3
Query:   75 IGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRN-AYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEG 623
            +  +F + +++A D           ND++K+ E++  L   + G + D   +   + +  +LY++RN + +S  AA+      +   L  R     V  ++ G DK G P L+++D  G+ +       G G+     V+D  Y  +M  EEA  L    I     R  Y+  +  +  + E+G
Sbjct:   75 LAFKFRHGVIVAVDSRASAGNYLASNDVNKVIEINPYLLGTMSGSAADCQYWERLLAKECRLYRLRNNHRISVAAASKLLCNMM---LGYRGMGLSVGSMICGWDKEG-PGLYYVDDNGTRLSGRMFSTGCGNSYAYGVVDSGYKEDMTVEEAYELGCRGIAHATHRDAYSGGSVNMYHMREDG 254          
BLAST of Proteasome subunit beta vs. Planmine SMEST
Match: SMESG000075365.1 (SMESG000075365.1)

HSP 1 Score: 405.216 bits (1040), Expect = 1.201e-145
Identity = 197/199 (98.99%), Postives = 197/199 (98.99%), Query Frame = 3
Query:   60 MTECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVGK 656
            M ECLIGIRFNNFILMA DGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVGK
Sbjct:    1 MAECLIGIRFNNFILMACDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVGK 199          
BLAST of Proteasome subunit beta vs. Planmine SMEST
Match: SMESG000075368.1 (SMESG000075368.1)

HSP 1 Score: 381.719 bits (979), Expect = 2.514e-136
Identity = 180/199 (90.45%), Postives = 195/199 (97.99%), Query Frame = 3
Query:   60 MTECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVGK 656
            MTECLIGIRFNNFILMASDGNGGRSI+ MRND+DKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSP+AAAHFTRRQL ++LRTRNAYHVNLLLGG+DK+GVPSL+FMDYLGSIV+VPFA+HGYGSYV+LSVLDRKYNPNM K+EA+ LLHDCIKEIQKRFVYNLSNFKVKLID++GISFLEDVAVGK
Sbjct:    1 MTECLIGIRFNNFILMASDGNGGRSIVCMRNDVDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPSAAAHFTRRQLVDTLRTRNAYHVNLLLGGMDKTGVPSLYFMDYLGSIVNVPFAIHGYGSYVSLSVLDRKYNPNMSKDEAVKLLHDCIKEIQKRFVYNLSNFKVKLIDDQGISFLEDVAVGK 199          
BLAST of Proteasome subunit beta vs. Planmine SMEST
Match: SMESG000075365.1 (SMESG000075365.1)

HSP 1 Score: 375.941 bits (964), Expect = 2.262e-134
Identity = 183/184 (99.46%), Postives = 183/184 (99.46%), Query Frame = 3
Query:  105 MASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVGK 656
            MA DGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVGK
Sbjct:    1 MACDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVGK 184          
BLAST of Proteasome subunit beta vs. Planmine SMEST
Match: SMESG000075368.1 (SMESG000075368.1)

HSP 1 Score: 350.517 bits (898), Expect = 2.755e-124
Identity = 165/184 (89.67%), Postives = 180/184 (97.83%), Query Frame = 3
Query:  105 MASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVGK 656
            MASDGNGGRSI+ MRND+DKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSP+AAAHFTRRQL ++LRTRNAYHVNLLLGG+DK+GVPSL+FMDYLGSIV+VPFA+HGYGSYV+LSVLDRKYNPNM K+EA+ LLHDCIKEIQKRFVYNLSNFKVKLID++GISFLEDVAVGK
Sbjct:    1 MASDGNGGRSIVCMRNDVDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPSAAAHFTRRQLVDTLRTRNAYHVNLLLGGMDKTGVPSLYFMDYLGSIVNVPFAIHGYGSYVSLSVLDRKYNPNMSKDEAVKLLHDCIKEIQKRFVYNLSNFKVKLIDDQGISFLEDVAVGK 184          
BLAST of Proteasome subunit beta vs. Planmine SMEST
Match: SMESG000004962.1 (SMESG000004962.1)

HSP 1 Score: 69.707 bits (169), Expect = 4.513e-14
Identity = 50/185 (27.03%), Postives = 89/185 (48.11%), Query Frame = 3
Query:   72 LIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGDSGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESL-RTRNAYHVNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNPNMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEG 623
            ++G+RF + +++ +D       I    +  KI+ ++D +     G + DT      I   V+L++++N     P  A     R L + L R +      L+LGG+D  G P L  +   GS   +P+   G GS   +S L+  Y PN+ +EEA+ L+   I++     + + SN  + +I +EG
Sbjct:    8 IVGVRFADGVVLGADTRATEGNIVAEKNCQKIHYIADNIYCCGAGTAADTEFVTRIISSKVELHRLQNDPLRKPRVA--MATRMLKQYLFRYQGYVGAALILGGVDFEG-PKLLSIHPHGSSDALPYVTMGSGSLAAVSELESLYRPNLTREEAMELVRRAIRKGIDHDMGSGSNVDLCIITKEG 189          
The following BLAST results are available for this feature:
BLAST of Proteasome subunit beta vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PSMB23.255e-6951.27proteasome 20S subunit beta 2 [Source:HGNC Symbol;... [more]
PSMB22.971e-2048.15proteasome 20S subunit beta 2 [Source:HGNC Symbol;... [more]
PSMB43.470e-1022.75proteasome 20S subunit beta 4 [Source:HGNC Symbol;... [more]
PSMB18.415e-1026.02proteasome 20S subunit beta 1 [Source:HGNC Symbol;... [more]
PSMB101.119e-923.60proteasome 20S subunit beta 10 [Source:HGNC Symbol... [more]
back to top
BLAST of Proteasome subunit beta vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pbs-42.364e-4036.60Proteasome subunit beta type-2 [Source:UniProtKB/... [more]
pbs-23.942e-1022.84Proteasome subunit beta [Source:UniProtKB/TrEMBL;... [more]
pbs-31.842e-724.68Proteasome subunit beta type-3 [Source:UniProtKB/... [more]
back to top
BLAST of Proteasome subunit beta vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prosbeta41.770e-6244.90gene:FBgn0032596 transcript:FBtr0335142[more]
Prosbeta41.770e-6244.90gene:FBgn0032596 transcript:FBtr0080936[more]
Prosbeta4R23.224e-5139.29gene:FBgn0031443 transcript:FBtr0077699[more]
Prosbeta4R23.224e-5139.29gene:FBgn0031443 transcript:FBtr0332513[more]
Prosbeta4R14.918e-4335.75gene:FBgn0031442 transcript:FBtr0077697[more]
back to top
BLAST of Proteasome subunit beta vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmb21.431e-7753.30proteasome 20S subunit beta 2 [Source:ZFIN;Acc:ZDB... [more]
psmb24.561e-6654.27proteasome 20S subunit beta 2 [Source:ZFIN;Acc:ZDB... [more]
psmb13.076e-1026.02proteasome 20S subunit beta 1 [Source:ZFIN;Acc:ZDB... [more]
psmb101.084e-824.84proteasome 20S subunit beta 10 [Source:ZFIN;Acc:ZD... [more]
psmb101.084e-824.84proteasome 20S subunit beta 10 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Proteasome subunit beta vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
septin41.698e-7453.97septin 4 [Source:Xenbase;Acc:XB-GENE-983580][more]
rapgef31.622e-1126.71Rap guanine nucleotide exchange factor 3 [Source:X... [more]
rapgef32.008e-1126.71Rap guanine nucleotide exchange factor 3 [Source:X... [more]
ttc381.477e-822.75tetratricopeptide repeat domain 38 [Source:Xenbase... [more]
psmb17.926e-823.35proteasome subunit beta 1 [Source:NCBI gene;Acc:39... [more]
back to top
BLAST of Proteasome subunit beta vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Psmb27.123e-7152.28proteasome (prosome, macropain) subunit, beta type... [more]
Psmb43.570e-1123.28proteasome (prosome, macropain) subunit, beta type... [more]
Psmb77.664e-1023.32proteasome (prosome, macropain) subunit, beta type... [more]
Psmb11.004e-926.02proteasome (prosome, macropain) subunit, beta type... [more]
Psmb12.561e-827.56proteasome (prosome, macropain) subunit, beta type... [more]
back to top
BLAST of Proteasome subunit beta vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9R1P3|PSB2_MOUSE4.982e-7052.28Proteasome subunit beta type-2 OS=Mus musculus OX=... [more]
sp|P40307|PSB2_RAT1.636e-6951.78Proteasome subunit beta type-2 OS=Rattus norvegicu... [more]
sp|P49721|PSB2_HUMAN1.563e-6851.27Proteasome subunit beta type-2 OS=Homo sapiens OX=... [more]
sp|Q5E9K0|PSB2_BOVIN1.563e-6851.27Proteasome subunit beta type-2 OS=Bos taurus OX=99... [more]
sp|P22141|PSB4_YEAST2.117e-5240.41Proteasome subunit beta type-4 OS=Saccharomyces ce... [more]
back to top
BLAST of Proteasome subunit beta vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1W4WMT11.785e-7855.38Proteasome subunit beta OS=Agrilus planipennis OX=... [more]
A2IAA21.261e-7655.26Proteasome subunit beta OS=Xenopsylla cheopis OX=1... [more]
R7THR92.924e-7651.30Proteasome subunit beta OS=Capitella teleta OX=283... [more]
A0A1I8GCK13.563e-7657.22Proteasome subunit beta OS=Macrostomum lignano OX=... [more]
A0A0R3WX878.606e-7656.48Proteasome subunit beta OS=Hydatigena taeniaeformi... [more]
back to top
BLAST of Proteasome subunit beta vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmb22.312e-7652.55proteasome 20S subunit beta 2 [Source:NCBI gene;Ac... [more]
psmb46.962e-1122.40proteasome 20S subunit beta 4 [Source:NCBI gene;Ac... [more]
psmb101.109e-1025.00proteasome subunit beta type-7-like [Source:NCBI g... [more]
psmb13a6.019e-1022.34proteasome subunit beta type-7-like [Source:NCBI g... [more]
psmb12.666e-925.51proteasome 20S subunit beta 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Proteasome subunit beta vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
psmb22.288e-6553.66proteasome 20S subunit beta 2 [Source:ZFIN;Acc:ZDB... [more]
psmb41.099e-1726.80proteasome 20S subunit beta 4 [Source:ZFIN;Acc:ZDB... [more]
psmb71.876e-1425.12proteasome 20S subunit beta 7 [Source:ZFIN;Acc:ZDB... [more]
ENSPMAT00000009464.19.454e-722.67pep scaffold:Pmarinus_7.0:GL476605:530828:534431:-... [more]
back to top
BLAST of Proteasome subunit beta vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
PRE13.049e-5440.41Beta 4 subunit of the 20S proteasome; localizes to... [more]
PUP12.856e-1225.77Beta 2 subunit of the 20S proteasome; endopeptidas... [more]
PRE33.490e-919.88Beta 1 subunit of the 20S proteasome; responsible ... [more]
PUP31.378e-624.68Beta 3 subunit of the 20S proteasome; involved in ... [more]
back to top
BLAST of Proteasome subunit beta vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO328541.252e-7354.01Proteasome subunit beta type [Source:UniProtKB/Tr... [more]
EDO404074.321e-1626.94Proteasome subunit beta type [Source:UniProtKB/Tr... [more]
EDO341003.505e-1325.26Proteasome subunit beta type [Source:UniProtKB/Tr... [more]
EDO346426.062e-922.96Proteasome subunit beta type [Source:UniProtKB/Tr... [more]
EDO429742.561e-623.33Proteasome subunit beta type [Source:UniProtKB/Tr... [more]
back to top
BLAST of Proteasome subunit beta vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
psmb28.235e-7753.57proteasome 20S subunit beta 2 [Source:NCBI gene;Ac... [more]
psmb41.019e-1022.40proteasome 20S subunit beta 4 [Source:NCBI gene;Ac... [more]
psmb15.807e-1025.00proteasome 20S subunit beta 1 [Source:NCBI gene;Ac... [more]
psmb81.784e-723.24proteasome 20S subunit beta 8 [Source:NCBI gene;Ac... [more]
psmb82.465e-723.37proteasome 20S subunit beta 8 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Proteasome subunit beta vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000075365.11.201e-14598.99SMESG000075365.1[more]
SMESG000075368.12.514e-13690.45SMESG000075368.1[more]
SMESG000075365.12.262e-13499.46SMESG000075365.1[more]
SMESG000075368.12.755e-12489.67SMESG000075368.1[more]
SMESG000004962.14.513e-1427.03SMESG000004962.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021541 ID=SMED30021541|Name=Proteasome subunit beta|organism=Schmidtea mediterranea sexual|type=transcript|length=719bp
CAATAATCTGGCTATTTGACGTTATTTTTAAAAAAAGCTAAATACTAAAG
TTATTAATAATGACGGAATGTCTGATCGGTATTCGATTTAATAATTTTAT
TTTAATGGCAAGTGATGGAAATGGAGGCAGATCAATCATAGCCATGAGAA
ATGATATTGATAAAATTTATGAGCTATCTGACAAATTAGCACTAGGAATT
TGTGGGGATTCAGGAGATACAGTTAGTTTTGCAGAATTTATTTTGCAAAA
TGTGCAATTGTACAAAATTAGAAATGGTTACGAAATGTCTCCAAACGCAG
CTGCTCATTTTACTCGCCGACAATTAGCTGAAAGTTTGAGAACAAGAAAT
GCATATCATGTCAACTTACTTCTTGGTGGAATTGATAAATCTGGAGTTCC
ATCACTACATTTTATGGATTATTTAGGATCAATTGTAGATGTTCCATTTG
CTGTTCATGGGTATGGCAGCTATGTAACTTTGTCGGTATTAGATCGAAAA
TATAATCCAAATATGTGCAAAGAAGAAGCCATTGGATTGCTGCATGATTG
TATTAAGGAGATTCAGAAAAGATTTGTTTACAATCTGAGCAACTTCAAGG
TAAAGCTGATTGATGAGGAAGGAATCAGTTTTTTGGAGGACGTTGCAGTT
GGGAAATAAAGTTGTAATGATAAAAATTGTTTATTTGTTTCACAATAAAT
TTTTCGTTTCAAAAAAAAA
back to top

protein sequence of SMED30021541-orf-1

>SMED30021541-orf-1 ID=SMED30021541-orf-1|Name=SMED30021541-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=200bp
MTECLIGIRFNNFILMASDGNGGRSIIAMRNDIDKIYELSDKLALGICGD
SGDTVSFAEFILQNVQLYKIRNGYEMSPNAAAHFTRRQLAESLRTRNAYH
VNLLLGGIDKSGVPSLHFMDYLGSIVDVPFAVHGYGSYVTLSVLDRKYNP
NMCKEEAIGLLHDCIKEIQKRFVYNLSNFKVKLIDEEGISFLEDVAVGK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR035206Proteasome_beta2
IPR001353Proteasome_sua/b
IPR029055Ntn_hydrolases_N
IPR016050Proteasome_bsu_CS
IPR023333Proteasome_suB-type
Vocabulary: molecular function
TermDefinition
GO:0004298threonine-type endopeptidase activity
GO:0004175endopeptidase activity
GO:0008233peptidase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0005839proteasome core complex
GO:0000502proteasome complex
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0051603proteolysis involved in cellular protein catabolic process
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001353Proteasome, subunit alpha/betaPFAMPF00227Proteasomecoord: 4..183
e-value: 5.0E-40
score: 137.0
IPR029055Nucleophile aminohydrolases, N-terminalGENE3DG3DSA:3.60.20.10coord: 2..198
e-value: 2.1E-48
score: 166.5
IPR029055Nucleophile aminohydrolases, N-terminalSUPERFAMILYSSF56235N-terminal nucleophile aminohydrolases (Ntn hydrolases)coord: 4..195
NoneNo IPR availablePANTHERPTHR11599PROTEASOME SUBUNIT ALPHA/BETAcoord: 3..192
IPR035206Proteasome subunit beta 2PANTHERPTHR11599:SF6PROTEASOME SUBUNIT BETA TYPE-2coord: 3..192
IPR035206Proteasome subunit beta 2CDDcd03758proteasome_beta_type_2coord: 3..194
e-value: 9.60106E-98
score: 279.855
IPR016050Proteasome beta-type subunit, conserved sitePROSITEPS00854PROTEASOME_BETA_1coord: 6..53
IPR023333Proteasome B-type subunitPROSITEPS51476PROTEASOME_BETA_2coord: 2..184
score: 36.948