Splicing factor 3A subunit 1

Overview
NameSplicing factor 3A subunit 1
Smed IDSMED30021536
Length (bp)2266
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Splicing factor 3A subunit 1 (SMED30021536) t-SNE clustered cells

Violin plots show distribution of expression levels for Splicing factor 3A subunit 1 (SMED30021536) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Splicing factor 3A subunit 1 (SMED30021536) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Splicing factor 3A subunit 1 (SMED30021536) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021536

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30021536SMESG000072847.1 SmedASXL_019086SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30021536SMESG000072847.1 SmedASXL_019086SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30021536SMESG000072847.1 dd_Smed_v4_1001_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021536SMESG000072847.1 dd_Smed_v4_1001_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30021536SMESG000072847.1 dd_Smed_v4_1001_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021536SMESG000072847.1 dd_Smed_v4_1001_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021536SMESG000072847.1 dd_Smed_v4_1001_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Human
Match: SF3A1 (splicing factor 3a subunit 1 [Source:HGNC Symbol;Acc:HGNC:10765])

HSP 1 Score: 330.102 bits (845), Expect = 8.229e-101
Identity = 170/281 (60.50%), Postives = 210/281 (74.73%), Query Frame = 2
Query:   74 PKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMK---------LAQDT-PKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQ 886
            P  G+I PPP+VRNIVD+TA FVARNGP+FEAR++ NE NN KFNFLN  DPY+ YY  +V +  EG  +  SA  ++P  M+         L Q    + IQE   PKE P EFEFI DPPSI++ +LD+V+LTAQFVARNGRQFLTQLM +EQRNY FDFLRPQH++F+YFTKLVEQ+TKIL+PP  +  KL KE+++P   +    YRV W ++Q R+RKKE E ++KERVAY QIDWHDFVVVE VD+QPNE GNFPPPT PEE+GAR + +ER E+
Sbjct:   38 PVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSA--AIPKVMQQQQQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVLDQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEK 316          

HSP 2 Score: 107.457 bits (267), Expect = 2.646e-23
Identity = 52/122 (42.62%), Postives = 80/122 (65.57%), Query Frame = 2
Query: 1151 VLIKTYDPKAKSK---RQTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGIEETVIGRKVGEEDAKKG-EKYIWDGHAAT 1504
            ++ K YDPKA          + +L+SP+   +KI  S+  +H+ +GLL+P W E RDR+ + K  +D  +  G +++ +LK +AERRTDIFG+EET IG+K+GEE+ +K  EK  WDGH+ +
Sbjct:  388 IVRKDYDPKASKPLPPAPAPDEYLVSPI-TGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGS 508          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Celegans
Match: prp-21 (Pre-RNA processing 21; Yeast PRP (Splicing factor) related [Source:UniProtKB/TrEMBL;Acc:G5ECL3])

HSP 1 Score: 254.988 bits (650), Expect = 1.203e-74
Identity = 125/268 (46.64%), Postives = 175/268 (65.30%), Query Frame = 2
Query:   80 FGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMKLAQDTPKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGE 883
             G+I PPPD+R IVD+TA F A+NG DFE +++  EA N KFNFL+  DPY+ YY + V    EG VE+     +V   +K A+         F P   P  +EF  DP +IN+ +LD++RL A FVARNGRQFLTQLM RE RNY FDFL+P H  F+YFTKLV+Q+ K+L+P  +++ +L  ++ + +  +++  YRV+W+++Q   + +E    +KER AY  IDWHDFVVV+ VD+QP +    PP   P++VGAR + E R E
Sbjct:   25 IGLIYPPPDIRTIVDKTARFAAKNGVDFENKIREKEAKNPKFNFLSITDPYHAYYKKMVYDFSEGRVEAPKVPQAVKEHVKKAE---------FVPSAPPPAYEFSADPSTINAYDLDLIRLVALFVARNGRQFLTQLMTREARNYQFDFLKPAHCNFTYFTKLVDQYQKVLVPSTNVVAQLQDDATNKKRLIEDINYRVSWEKHQKGLKDREEAEAEKERQAYASIDWHDFVVVQTVDFQPGDTSQLPPLCTPKDVGARILLEARNE 283          

HSP 2 Score: 80.1073 bits (196), Expect = 2.953e-15
Identity = 47/130 (36.15%), Postives = 81/130 (62.31%), Query Frame = 2
Query: 1139 KPEEVLIKTYDPK--AKSKRQTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGI--EETVIGRKVGEED-AKKGE-KYIWDGHAATQE 1510
            K ++V+++ YDPK     K +  E ++ISPL   ++I + +  +H+    ++  ++E RDR+   +  E+     G ++  NL   AERRTDIFG+  E+T+IG+K+GEED +++G+ K IWDG   T++
Sbjct:  323 KQKDVIVRDYDPKRNVTQKPKAVENWIISPL-TGERIPSDKLAEHVRYNTVDSQYKEDRDRHIGERSTEEPVLALGADISRNLGNFAERRTDIFGVGGEQTMIGKKLGEEDNSQQGQNKLIWDGTEETRD 451          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Fly
Match: Sf3a1 (gene:FBgn0266917 transcript:FBtr0083374)

HSP 1 Score: 397.897 bits (1021), Expect = 4.950e-127
Identity = 228/494 (46.15%), Postives = 315/494 (63.77%), Query Frame = 2
Query:  104 DVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISA-----KVSVPTAMKLAQD--TPKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKES----KSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAE-----ERGEQVVNRWIED-NKTQXXXXXXXXXXXXXXXXKTGVHGEKENXXXXXXXXXXXXXXXXXIXXXXXXXXXXXXTTFKQPVSDAARTNLIKP--EEVLIKTYDPKAKSKRQ----TDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGI--EETVIGRKVGEEDAKKGEKYIWDGHAATQE 1510
            +VRNIVD+TA FVARNGP+FEAR++ NE  N KFNFLN  DPY+ YY  +V +  EG    I+A     +++V +A +  Q     + +++ F PKE P EFEFI DPPSI++L+LDIV+LTAQFVARNGRQFLT LM+REQRN+ FDFLRPQH++F YFTKL+EQ+TK+L+PP D++ KL  ES     S    ++  KYR  W R+Q  QR++E E  ++ERVAY QIDWHDFVVVE VDYQP E GNFPPPT P+EVGAR + E     E G+  +    +D   +Q     +   +    E + G+  + +N     +      +                 TT  QP    +   ++ P  ++V++K YDPKA   +Q    TDE +LISP+   +KI  S+ ++H+ +GLL+P W E RD++T  K+ +D  F +G  ++ +LK +AERRTDIFG+  EETVIG+K+GEE+ KK ++  WDGH ++ E
Sbjct:   34 EVRNIVDKTASFVARNGPEFEARIRQNELGNPKFNFLNGGDPYHAYYRHKVNEFREGNDAGITALASMKQLAVTSAAQQRQQELLKQVVEQQFVPKEPPPEFEFIADPPSISALDLDIVKLTAQFVARNGRQFLTNLMSREQRNFQFDFLRPQHSLFQYFTKLLEQYTKVLIPPKDLLGKLRSESAPGRSSMNQVLEQVKYRANWQRHQEAQRRREEEKIERERVAYAQIDWHDFVVVETVDYQPFESGNFPPPTNPDEVGARVLMEERLMDEEGDTEMQIESDDEGDSQANNLLDSGLKLSQMENRVGI--QMKNVSSYGQPTGPKRDNTQVQDMDEASSDEDTPTTKLQP----SVAPMLPPTHDKVVVKKYDPKATQPKQAPMPTDE-YLISPI-TGEKIPASKVSEHMRIGLLDPRWVEQRDKHTVEKINQDNVFAAGTAIEASLKQLAERRTDIFGVGDEETVIGKKLGEEETKKDDRVTWDGHTSSVE 519          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Fly
Match: scaf6 (gene:FBgn0261872 transcript:FBtr0301554)

HSP 1 Score: 53.9138 bits (128), Expect = 6.378e-8
Identity = 31/58 (53.45%), Postives = 38/58 (65.52%), Query Frame = 2
Query:   89 IIPPPD--VRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRV 256
            + PP D  +RNI+D+ AEFVARNGP+FEA  K  + NN KF FL   +  N YY  RV
Sbjct:    3 VQPPRDASLRNIIDKLAEFVARNGPEFEAITKQKQQNNPKFEFLYGGEFAN-YYQFRV 59          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Fly
Match: scaf6 (gene:FBgn0261872 transcript:FBtr0345067)

HSP 1 Score: 54.299 bits (129), Expect = 1.164e-7
Identity = 31/58 (53.45%), Postives = 38/58 (65.52%), Query Frame = 2
Query:   89 IIPPPD--VRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRV 256
            + PP D  +RNI+D+ AEFVARNGP+FEA  K  + NN KF FL   +  N YY  RV
Sbjct:    3 VQPPRDASLRNIIDKLAEFVARNGPEFEAITKQKQQNNPKFEFLYGGEFAN-YYQFRV 59          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Fly
Match: scaf6 (gene:FBgn0261872 transcript:FBtr0091474)

HSP 1 Score: 52.7582 bits (125), Expect = 1.112e-6
Identity = 31/58 (53.45%), Postives = 38/58 (65.52%), Query Frame = 2
Query:   89 IIPPPD--VRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRV 256
            + PP D  +RNI+D+ AEFVARNGP+FEA  K  + NN KF FL   +  N YY  RV
Sbjct:    3 VQPPRDASLRNIIDKLAEFVARNGPEFEAITKQKQQNNPKFEFLYGGEFAN-YYQFRV 59          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Zebrafish
Match: sf3a1 (splicing factor 3a, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030616-156])

HSP 1 Score: 327.791 bits (839), Expect = 2.724e-100
Identity = 169/276 (61.23%), Postives = 211/276 (76.45%), Query Frame = 2
Query:   74 PKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMKLAQDTPKAIQ-----EVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQ 886
            P  G+I PPP+VRNIVD+TA FVARNGP+FEAR++ NE NN KFNFLN  DPY+ YY  +V +  EG  +  SA  +VP  M+  Q  P+ +Q     E   PKE P EFEFI DPPSI++ +LD+V+LTAQFVARNGRQFLTQLM +EQRNY FDFLRPQH++F+YFTKLVEQ+TK+L+PP  ++ KL KE+++P   +   +YRV W ++Q R+RKKE E  +KERVAY QIDWHDFVVVE VD+QPNE GNFPPPT PEE+GAR + +ER E+
Sbjct:   29 PIVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPSDPYHAYYRHKVNEFKEGKAQEPSA--AVPKVMQHPQQLPQKVQAQVIHETVVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKVLIPPKGLLLKLKKEAENPREVLDQVRYRVEWAKFQERERKKEEEEREKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEK 302          

HSP 2 Score: 108.227 bits (269), Expect = 9.445e-24
Identity = 53/122 (43.44%), Postives = 82/122 (67.21%), Query Frame = 2
Query: 1151 VLIKTYDPKAK---SKRQTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGIEETVIGRKVGEEDAKKG-EKYIWDGHAAT 1504
            ++ K YDPKA    +   T + +LISP+   +KI  S+  +H+ +GLL+P W E RDR+ + +  E+  +  G +++ +LK +AERRTDIFG+EET IG+K+GEE+ +K  EK  WDGH+ +
Sbjct:  375 IIRKDYDPKASKPLAPVATPDEYLISPI-TGEKIPASKMQEHMRIGLLDPRWLEQRDRSIRERQIEEEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGS 495          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Zebrafish
Match: sf3a1 (splicing factor 3a, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030616-156])

HSP 1 Score: 327.791 bits (839), Expect = 2.724e-100
Identity = 169/276 (61.23%), Postives = 211/276 (76.45%), Query Frame = 2
Query:   74 PKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMKLAQDTPKAIQ-----EVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQ 886
            P  G+I PPP+VRNIVD+TA FVARNGP+FEAR++ NE NN KFNFLN  DPY+ YY  +V +  EG  +  SA  +VP  M+  Q  P+ +Q     E   PKE P EFEFI DPPSI++ +LD+V+LTAQFVARNGRQFLTQLM +EQRNY FDFLRPQH++F+YFTKLVEQ+TK+L+PP  ++ KL KE+++P   +   +YRV W ++Q R+RKKE E  +KERVAY QIDWHDFVVVE VD+QPNE GNFPPPT PEE+GAR + +ER E+
Sbjct:   29 PIVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPSDPYHAYYRHKVNEFKEGKAQEPSA--AVPKVMQHPQQLPQKVQAQVIHETVVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKVLIPPKGLLLKLKKEAENPREVLDQVRYRVEWAKFQERERKKEEEEREKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEK 302          

HSP 2 Score: 108.227 bits (269), Expect = 9.445e-24
Identity = 53/122 (43.44%), Postives = 82/122 (67.21%), Query Frame = 2
Query: 1151 VLIKTYDPKAK---SKRQTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGIEETVIGRKVGEEDAKKG-EKYIWDGHAAT 1504
            ++ K YDPKA    +   T + +LISP+   +KI  S+  +H+ +GLL+P W E RDR+ + +  E+  +  G +++ +LK +AERRTDIFG+EET IG+K+GEE+ +K  EK  WDGH+ +
Sbjct:  375 IIRKDYDPKASKPLAPVATPDEYLISPI-TGEKIPASKMQEHMRIGLLDPRWLEQRDRSIRERQIEEEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGS 495          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Zebrafish
Match: sf3a1 (splicing factor 3a, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030616-156])

HSP 1 Score: 327.791 bits (839), Expect = 2.724e-100
Identity = 169/276 (61.23%), Postives = 211/276 (76.45%), Query Frame = 2
Query:   74 PKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMKLAQDTPKAIQ-----EVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQ 886
            P  G+I PPP+VRNIVD+TA FVARNGP+FEAR++ NE NN KFNFLN  DPY+ YY  +V +  EG  +  SA  +VP  M+  Q  P+ +Q     E   PKE P EFEFI DPPSI++ +LD+V+LTAQFVARNGRQFLTQLM +EQRNY FDFLRPQH++F+YFTKLVEQ+TK+L+PP  ++ KL KE+++P   +   +YRV W ++Q R+RKKE E  +KERVAY QIDWHDFVVVE VD+QPNE GNFPPPT PEE+GAR + +ER E+
Sbjct:   29 PIVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPSDPYHAYYRHKVNEFKEGKAQEPSA--AVPKVMQHPQQLPQKVQAQVIHETVVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKVLIPPKGLLLKLKKEAENPREVLDQVRYRVEWAKFQERERKKEEEEREKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEK 302          

HSP 2 Score: 108.227 bits (269), Expect = 9.445e-24
Identity = 53/122 (43.44%), Postives = 82/122 (67.21%), Query Frame = 2
Query: 1151 VLIKTYDPKAK---SKRQTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGIEETVIGRKVGEEDAKKG-EKYIWDGHAAT 1504
            ++ K YDPKA    +   T + +LISP+   +KI  S+  +H+ +GLL+P W E RDR+ + +  E+  +  G +++ +LK +AERRTDIFG+EET IG+K+GEE+ +K  EK  WDGH+ +
Sbjct:  375 IIRKDYDPKASKPLAPVATPDEYLISPI-TGEKIPASKMQEHMRIGLLDPRWLEQRDRSIRERQIEEEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGS 495          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Zebrafish
Match: sf3a1 (splicing factor 3a, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030616-156])

HSP 1 Score: 171.014 bits (432), Expect = 6.378e-49
Identity = 86/145 (59.31%), Postives = 105/145 (72.41%), Query Frame = 2
Query:   74 PKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMKLAQDTPKAIQ-----EVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQL 493
            P  G+I PPP+VRNIVD+TA FVARNGP+FEAR++ NE NN KFNFLN  DPY+ YY  +V +  EG  +  SA  +VP  M+  Q  P+ +Q     E   PKE P EFEFI DPPSI++ +LD+V+LTAQFVARNGRQFLTQL
Sbjct:   29 PIVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPSDPYHAYYRHKVNEFKEGKAQEPSA--AVPKVMQHPQQLPQKVQAQVIHETVVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQL 171          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Zebrafish
Match: sfswap (splicing factor SWAP [Source:ZFIN;Acc:ZDB-GENE-040426-931])

HSP 1 Score: 50.8322 bits (120), Expect = 3.385e-6
Identity = 29/76 (38.16%), Postives = 40/76 (52.63%), Query Frame = 2
Query:   68 VAPKFGVIIPP-------PDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEG 274
            VAP  G++IPP            I++RTA FV + G  FE  +K  +A NS+F+FL      NPYY   ++   EG
Sbjct:  177 VAPP-GLLIPPDVELPATTKTHAIIERTANFVCKQGAQFEIVLKAKQAGNSQFDFLRFDHYLNPYYKHILRAMKEG 251          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Xenopus
Match: gpx7 (glutathione peroxidase 7 [Source:Xenbase;Acc:XB-GENE-940915])

HSP 1 Score: 328.561 bits (841), Expect = 2.603e-101
Identity = 164/279 (58.78%), Postives = 211/279 (75.63%), Query Frame = 2
Query:   74 PKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMKLAQDT--------PKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQ 886
            P  G+I PPP+VRNIVD+TA FVARNGP+FEAR++ NE NN KFNFLN  DPY+ YY  +V +  EG  +  SA  ++P  M+  Q           + +QE   PKE P EFE++ DPPSI++ +LD+V+LTAQFVARNGRQFLTQLM +EQRNY FDFLRPQH++F+YFTKLVEQ+TKIL+PP  ++ KL KE+++P   +   +YRV W ++Q R++KKE E +++ERVAY QIDWHDFVVVE VD+QPNE GNFPPPT PEE+GAR + +ER E+
Sbjct:   33 PVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVNEFKEGKAQEPSA--AIPKVMQQQQSVQQLPQKVQAQVVQETIVPKEPPPEFEYVADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLLVKLKKEAENPTEVLDQVRYRVEWAKFQEREKKKEEEEKERERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEK 309          

HSP 2 Score: 105.916 bits (263), Expect = 5.504e-23
Identity = 52/122 (42.62%), Postives = 79/122 (64.75%), Query Frame = 2
Query: 1151 VLIKTYDPKAKSK---RQTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGIEETVIGRKVGEEDAKKG-EKYIWDGHAAT 1504
            ++ K YDPKA          + +L+SP+   +KI  S+  +H+ +GLL+P W E RDR  + K  +D  +  G +++ +LK +AERRTDIFG+EET IG+K+GEE+ +K  EK  WDGH+ +
Sbjct:  382 IVRKDYDPKASKPLPPAPAPDEYLVSPIT-GEKIPASKMQEHMRIGLLDPRWLEQRDRAIREKQGDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGS 502          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Xenopus
Match: gpx7 (glutathione peroxidase 7 [Source:Xenbase;Acc:XB-GENE-940915])

HSP 1 Score: 329.331 bits (843), Expect = 8.529e-101
Identity = 164/279 (58.78%), Postives = 211/279 (75.63%), Query Frame = 2
Query:   74 PKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMKLAQDT--------PKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQ 886
            P  G+I PPP+VRNIVD+TA FVARNGP+FEAR++ NE NN KFNFLN  DPY+ YY  +V +  EG  +  SA  ++P  M+  Q           + +QE   PKE P EFE++ DPPSI++ +LD+V+LTAQFVARNGRQFLTQLM +EQRNY FDFLRPQH++F+YFTKLVEQ+TKIL+PP  ++ KL KE+++P   +   +YRV W ++Q R++KKE E +++ERVAY QIDWHDFVVVE VD+QPNE GNFPPPT PEE+GAR + +ER E+
Sbjct:   33 PVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVNEFKEGKAQEPSA--AIPKVMQQQQSVQQLPQKVQAQVVQETIVPKEPPPEFEYVADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLLVKLKKEAENPTEVLDQVRYRVEWAKFQEREKKKEEEEKERERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEK 309          

HSP 2 Score: 105.531 bits (262), Expect = 8.414e-23
Identity = 52/122 (42.62%), Postives = 79/122 (64.75%), Query Frame = 2
Query: 1151 VLIKTYDPKAKSK---RQTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGIEETVIGRKVGEEDAKKG-EKYIWDGHAAT 1504
            ++ K YDPKA          + +L+SP+   +KI  S+  +H+ +GLL+P W E RDR  + K  +D  +  G +++ +LK +AERRTDIFG+EET IG+K+GEE+ +K  EK  WDGH+ +
Sbjct:  382 IVRKDYDPKASKPLPPAPAPDEYLVSPI-TGEKIPASKMQEHMRIGLLDPRWLEQRDRAIREKQGDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGS 502          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Xenopus
Match: gpx7 (glutathione peroxidase 7 [Source:Xenbase;Acc:XB-GENE-940915])

HSP 1 Score: 329.331 bits (843), Expect = 1.392e-100
Identity = 164/279 (58.78%), Postives = 211/279 (75.63%), Query Frame = 2
Query:   74 PKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMKLAQDT--------PKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQ 886
            P  G+I PPP+VRNIVD+TA FVARNGP+FEAR++ NE NN KFNFLN  DPY+ YY  +V +  EG  +  SA  ++P  M+  Q           + +QE   PKE P EFE++ DPPSI++ +LD+V+LTAQFVARNGRQFLTQLM +EQRNY FDFLRPQH++F+YFTKLVEQ+TKIL+PP  ++ KL KE+++P   +   +YRV W ++Q R++KKE E +++ERVAY QIDWHDFVVVE VD+QPNE GNFPPPT PEE+GAR + +ER E+
Sbjct:   33 PVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVNEFKEGKAQEPSA--AIPKVMQQQQSVQQLPQKVQAQVVQETIVPKEPPPEFEYVADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLLVKLKKEAENPTEVLDQVRYRVEWAKFQEREKKKEEEEKERERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEK 309          

HSP 2 Score: 105.916 bits (263), Expect = 7.424e-23
Identity = 52/122 (42.62%), Postives = 79/122 (64.75%), Query Frame = 2
Query: 1151 VLIKTYDPKAKSK---RQTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGIEETVIGRKVGEEDAKKG-EKYIWDGHAAT 1504
            ++ K YDPKA          + +L+SP+   +KI  S+  +H+ +GLL+P W E RDR  + K  +D  +  G +++ +LK +AERRTDIFG+EET IG+K+GEE+ +K  EK  WDGH+ +
Sbjct:  382 IVRKDYDPKASKPLPPAPAPDEYLVSPI-TGEKIPASKMQEHMRIGLLDPRWLEQRDRAIREKQGDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGS 502          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Xenopus
Match: gpx7 (glutathione peroxidase 7 [Source:Xenbase;Acc:XB-GENE-940915])

HSP 1 Score: 328.946 bits (842), Expect = 1.403e-100
Identity = 164/279 (58.78%), Postives = 211/279 (75.63%), Query Frame = 2
Query:   74 PKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMKLAQDT--------PKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQ 886
            P  G+I PPP+VRNIVD+TA FVARNGP+FEAR++ NE NN KFNFLN  DPY+ YY  +V +  EG  +  SA  ++P  M+  Q           + +QE   PKE P EFE++ DPPSI++ +LD+V+LTAQFVARNGRQFLTQLM +EQRNY FDFLRPQH++F+YFTKLVEQ+TKIL+PP  ++ KL KE+++P   +   +YRV W ++Q R++KKE E +++ERVAY QIDWHDFVVVE VD+QPNE GNFPPPT PEE+GAR + +ER E+
Sbjct:   32 PVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVNEFKEGKAQEPSA--AIPKVMQQQQSVQQLPQKVQAQVVQETIVPKEPPPEFEYVADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLLVKLKKEAENPTEVLDQVRYRVEWAKFQEREKKKEEEEKERERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEK 308          

HSP 2 Score: 105.916 bits (263), Expect = 7.969e-23
Identity = 52/122 (42.62%), Postives = 79/122 (64.75%), Query Frame = 2
Query: 1151 VLIKTYDPKAKSK---RQTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGIEETVIGRKVGEEDAKKG-EKYIWDGHAAT 1504
            ++ K YDPKA          + +L+SP+   +KI  S+  +H+ +GLL+P W E RDR  + K  +D  +  G +++ +LK +AERRTDIFG+EET IG+K+GEE+ +K  EK  WDGH+ +
Sbjct:  381 IVRKDYDPKASKPLPPAPAPDEYLVSPI-TGEKIPASKMQEHMRIGLLDPRWLEQRDRAIREKQGDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGS 501          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Mouse
Match: Sf3a1 (splicing factor 3a, subunit 1 [Source:MGI Symbol;Acc:MGI:1914715])

HSP 1 Score: 329.717 bits (844), Expect = 6.868e-101
Identity = 170/287 (59.23%), Postives = 211/287 (73.52%), Query Frame = 2
Query:   56 EPEHVAPKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMKLAQDT----------PKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQ 886
            +P    P  G+I PPP+VRNIVD+TA FVARNGP+FEAR++ NE NN KFNFLN  DPY+ YY  +V +  EG  +  SA  ++P  M+  Q             + IQE   PKE P EFEFI DPPSI++ +LD+V+LTAQFVARNGRQFLTQLM +EQRNY FDFLRPQH++F+YFTKLVEQ+TKIL+PP  +  KL KE+++P   +    YRV W ++Q R+RKKE E ++KERVAY QIDWHDFVVVE VD+QPNE GNFPPPT PEE+GAR + +ER E+
Sbjct:   32 DPTPSKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSA--AIPKVMQQQQQATQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVLDQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEK 316          

HSP 2 Score: 107.071 bits (266), Expect = 2.476e-23
Identity = 54/123 (43.90%), Postives = 81/123 (65.85%), Query Frame = 2
Query: 1151 VLIKTYDPKAKSKR----QTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGIEETVIGRKVGEEDAKKG-EKYIWDGHAAT 1504
            ++ K YDPKA          DE +L+SP+   +KI  S+  +H+ +GLL+P W E RDR+ + K  +D  +  G +++ +LK +AERRTDIFG+EET IG+K+GEE+ +K  EK  WDGH+ +
Sbjct:  386 IVRKDYDPKASKPLPPAPAPDE-YLVSPI-TGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGS 506          
BLAST of Splicing factor 3A subunit 1 vs. UniProt/SwissProt
Match: sp|Q15459|SF3A1_HUMAN (Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 3.952e-100
Identity = 170/281 (60.50%), Postives = 210/281 (74.73%), Query Frame = 2
Query:   74 PKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMK---------LAQDT-PKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQ 886
            P  G+I PPP+VRNIVD+TA FVARNGP+FEAR++ NE NN KFNFLN  DPY+ YY  +V +  EG  +  SA  ++P  M+         L Q    + IQE   PKE P EFEFI DPPSI++ +LD+V+LTAQFVARNGRQFLTQLM +EQRNY FDFLRPQH++F+YFTKLVEQ+TKIL+PP  +  KL KE+++P   +    YRV W ++Q R+RKKE E ++KERVAY QIDWHDFVVVE VD+QPNE GNFPPPT PEE+GAR + +ER E+
Sbjct:   38 PVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSA--AIPKVMQQQQQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVLDQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEK 316          

HSP 2 Score: 107.457 bits (267), Expect = 1.271e-22
Identity = 52/122 (42.62%), Postives = 80/122 (65.57%), Query Frame = 2
Query: 1151 VLIKTYDPKAKSK---RQTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGIEETVIGRKVGEEDAKKG-EKYIWDGHAAT 1504
            ++ K YDPKA          + +L+SP+   +KI  S+  +H+ +GLL+P W E RDR+ + K  +D  +  G +++ +LK +AERRTDIFG+EET IG+K+GEE+ +K  EK  WDGH+ +
Sbjct:  388 IVRKDYDPKASKPLPPAPAPDEYLVSPI-TGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGS 508          
BLAST of Splicing factor 3A subunit 1 vs. UniProt/SwissProt
Match: sp|Q8K4Z5|SF3A1_MOUSE (Splicing factor 3A subunit 1 OS=Mus musculus OX=10090 GN=Sf3a1 PE=1 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 4.804e-100
Identity = 170/287 (59.23%), Postives = 211/287 (73.52%), Query Frame = 2
Query:   56 EPEHVAPKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMKLAQDT----------PKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQ 886
            +P    P  G+I PPP+VRNIVD+TA FVARNGP+FEAR++ NE NN KFNFLN  DPY+ YY  +V +  EG  +  SA  ++P  M+  Q             + IQE   PKE P EFEFI DPPSI++ +LD+V+LTAQFVARNGRQFLTQLM +EQRNY FDFLRPQH++F+YFTKLVEQ+TKIL+PP  +  KL KE+++P   +    YRV W ++Q R+RKKE E ++KERVAY QIDWHDFVVVE VD+QPNE GNFPPPT PEE+GAR + +ER E+
Sbjct:   32 DPTPSKPVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSA--AIPKVMQQQQQATQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFSKLKKEAENPREVLDQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEK 316          

HSP 2 Score: 107.071 bits (266), Expect = 1.732e-22
Identity = 54/123 (43.90%), Postives = 81/123 (65.85%), Query Frame = 2
Query: 1151 VLIKTYDPKAKSKR----QTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGIEETVIGRKVGEEDAKKG-EKYIWDGHAAT 1504
            ++ K YDPKA          DE +L+SP+   +KI  S+  +H+ +GLL+P W E RDR+ + K  +D  +  G +++ +LK +AERRTDIFG+EET IG+K+GEE+ +K  EK  WDGH+ +
Sbjct:  386 IVRKDYDPKASKPLPPAPAPDE-YLVSPI-TGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGS 506          
BLAST of Splicing factor 3A subunit 1 vs. UniProt/SwissProt
Match: sp|A2VDN6|SF3A1_BOVIN (Splicing factor 3A subunit 1 OS=Bos taurus OX=9913 GN=SF3A1 PE=2 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 8.462e-100
Identity = 169/281 (60.14%), Postives = 209/281 (74.38%), Query Frame = 2
Query:   74 PKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMKLAQDT----------PKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQ 886
            P  G+I PPP+VRNIVD+TA FVARNGP+FEAR++ NE NN KFNFLN  DPY+ YY  +V +  EG  +  SA  ++P  M+  Q             + IQE   PKE P EFEFI DPPSI++ +LD+V+LTAQFVARNGRQFLTQLM +EQRNY FDFLRPQH++F+YFTKLVEQ+TKIL+PP  +  KL KE+++P   +    YRV W ++Q R+RKKE E ++KERVAY QIDWHDFVVVE VD+QPNE GNFPPPT PEE+GAR + +ER E+
Sbjct:   38 PVVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVSEFKEGKAQEPSA--AIPKVMQQQQQASQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLFTKLKKEAENPREVLDQVCYRVEWAKFQERERKKEEEEKEKERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEK 316          

HSP 2 Score: 107.071 bits (266), Expect = 1.435e-22
Identity = 54/123 (43.90%), Postives = 81/123 (65.85%), Query Frame = 2
Query: 1151 VLIKTYDPKAKSKR----QTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGIEETVIGRKVGEEDAKKG-EKYIWDGHAAT 1504
            ++ K YDPKA          DE +L+SP+   +KI  S+  +H+ +GLL+P W E RDR+ + K  +D  +  G +++ +LK +AERRTDIFG+EET IG+K+GEE+ +K  EK  WDGH+ +
Sbjct:  388 IVRKDYDPKASKPLPPAPAPDE-YLVSPI-TGEKIPASKMQEHMRIGLLDPRWLEQRDRSIREKQSDDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGS 508          
BLAST of Splicing factor 3A subunit 1 vs. UniProt/SwissProt
Match: sp|Q8RXF1|SF3A1_ARATH (Probable splicing factor 3A subunit 1 OS=Arabidopsis thaliana OX=3702 GN=At1g14650 PE=1 SV=2)

HSP 1 Score: 204.142 bits (518), Expect = 2.496e-54
Identity = 117/279 (41.94%), Postives = 171/279 (61.29%), Query Frame = 2
Query:   80 FGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRV-------KQCIEGTVES---ISAKVSVPTAMKL-AQDTPKAIQEVF----EPKETPAEFEFIVD-PPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIA 868
             G+I PPPD+R IV++TA+FV++NG +FE R+ ++   N+KFNFL S DPY+ +Y  ++       K   +GT +S      ++    A +  A DT   +Q  F    +P E P   ++ V  P  I   ELDI++LTAQFVARNG+ FLT L NRE  N  F F++P H+MF++FT LV+ ++++L+PP D+ EKL K +      ++ C +R+ WDR Q +Q+KKE + ++ ERV    IDWHDFVVVE +D+   E    PPP   +EV  R+ A
Sbjct:   59 IGIIHPPPDIRTIVEKTAQFVSKNGLEFEKRIIVSNEKNAKFNFLKSSDPYHAFYQHKLTEYRAQNKDGAQGTDDSDGTTDPQLDTGAADESEAGDTQPDLQAQFRIPSKPLEAPEPEKYTVRLPEGITGEELDIIKLTAQFVARNGKSFLTGLSNRENNNPQFHFMKPTHSMFTFFTSLVDAYSEVLMPPKDLKEKLRKSAADLTTVLERCLHRLEWDRSQEQQKKKEEDEKELERVQMAMIDWHDFVVVESIDFADEEDEELPPPMTLDEVIRRSKA 337          
BLAST of Splicing factor 3A subunit 1 vs. UniProt/SwissProt
Match: sp|O13900|SA114_SCHPO (Pre-mRNA-splicing factor sap114 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sap114 PE=1 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 1.224e-47
Identity = 93/240 (38.75%), Postives = 149/240 (62.08%), Query Frame = 2
Query:   83 GVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMKLAQDTPKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEK-LNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDY 799
            GVI+PPP +R I+D++A +VARNGP FE +++ NE  N+KF FL++ DPY+PYY  ++ +  EG ++S +  +S      LA+   K I+        P+ + F    PSI+SL+LD++RLTA++ A  G  FL  L  +E  N  FDFL+P + ++ YF ++V+Q+T ++  P    E+ L +  + P   +   + RV W  +   Q+KK+ E  +KE++ Y QIDW+DFVVVE++ +
Sbjct:   33 GVILPPPAIREIIDKSASYVARNGPAFEEKIRQNEQANTKFAFLHANDPYHPYYQHKLTEAREGKLKSHATGLSTQKTSTLARPIQKPIEATI---PAPSPYLFSEPLPSISSLDLDVLRLTARYAAVRGSSFLVSLSQKEWNNTQFDFLKPNNALYPYFMRIVQQYTSLIREPISSPEQELRENVRDPYSLLSKIQPRVRWQSHMESQKKKQKEEAEKEKLEYAQIDWNDFVVVEVIQF 269          
BLAST of Splicing factor 3A subunit 1 vs. TrEMBL
Match: A0A1Y1NJN2 (Uncharacterized protein OS=Photinus pyralis OX=7054 GN=PPYR_04528 PE=4 SV=1)

HSP 1 Score: 416.387 bits (1069), Expect = 5.917e-131
Identity = 231/494 (46.76%), Postives = 321/494 (64.98%), Query Frame = 2
Query:   68 VAPKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISA-------KVSV-PTAMKLAQDTPKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQVVNRWIEDNKTQXXXXXXXXXXXXXXXXKTGVHGEKENXXXXXXXXXXXXXXXXXIXXXXXXXXXXXXTTFKQPVSDAARTNLIKPEEVLIKTYDPKAKSK---RQTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGI--EETVIGRKVGEEDAKKGEKYIWDGHAATQE 1510
            + P  G+I PPP+VRNIVD+TA FVARNGP+FEAR++ NE  N KFNFLN+ DPY+ YY  +V    EG  +   A       K++V  +A +  Q+  K++++ F PKE P +FEFI DPPSI++L+LDIV+LTAQFVARNGRQFLTQLMNREQRN+ FDFLRPQH++F YFTKL+EQ+TK+L+PP  + ++L  + KS +  M+N KYR  W +YQ  QR +E E  ++ERVAY QIDWHDFVVVE VDYQ  E+GNFPPPT PEEVGAR + +ER E+  +  ++    +E+     +E      ++TG H + +N   ++E+            +      P   T+ + P+       ++K        YDPK   K       + +LISP+   +KI  S+  +H+ +GLL+P W E RD++  +K+ +DT + +G  +D +LK +AERRTDIFG+  EET IG+K+GEED +K EK  WDGH ++ E
Sbjct:   32 INPIVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNELGNPKFNFLNTGDPYHAYYQHKVNDFREGKTQDTPAALPGAIAKLTVSASAQQKQQEILKSVEQPFIPKEPPTDFEFIADPPSISALDLDIVKLTAQFVARNGRQFLTQLMNREQRNFQFDFLRPQHSLFQYFTKLLEQYTKVLIPPKGMQQRLRDDCKSAQGVMENSKYRAEWHKYQEAQRAREEEILERERVAYAQIDWHDFVVVETVDYQQFEIGNFPPPTTPEEVGARLLIQERIEEGEDIEMQLESDEEDATTRNDEGLSHMVDRTG-HRKDDNRVQDMEE-----------ESSDEDGEPRHGTSMQPPLPPIPDKVIVK-------KYDPKQAHKPVRPVGGDDYLISPI-TGEKIPASKVQEHMRIGLLDPRWVEQRDKHVTDKMSQDTVYAAGSAIDASLKQLAERRTDIFGVGDEETAIGKKIGEEDVRKDEKVTWDGHTSSVE 505          
BLAST of Splicing factor 3A subunit 1 vs. TrEMBL
Match: A0A1W4VUG4 (splicing factor 3A subunit 1 OS=Drosophila ficusphila OX=30025 GN=LOC108097611 PE=4 SV=1)

HSP 1 Score: 413.305 bits (1061), Expect = 1.944e-129
Identity = 236/505 (46.73%), Postives = 322/505 (63.76%), Query Frame = 2
Query:   71 APKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISA-----KVSVPTAMKLAQD--TPKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKES----KSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEER---GEQVVNRWIE---DNKTQXXXXXXXXXXXXXXXXKTGVHGEKENXXXXXXXXXXXXXXXXXIXXXXXXXXXXXXTTFKQPVSDAARTNLIKP--EEVLIKTYDPKAKSKR----QTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGI--EETVIGRKVGEEDAKKGEKYIWDGHAATQE 1510
             P  G+I PPP+VRNIVD+TA FVARNGP+FEAR++ NE  N KFNFLN  DPY+ YY  +V +  EG    I+A     +++V +A +  Q     + +++ F PKE P EFEFI DPPSI++L+LDIV+LTAQFVARNGRQFLT LM+REQRN+ FDFLRPQH++F YFTKL+EQ+TK+L+PP D++ KL  ES     S    + + KYR  W R+Q  QR++E E  ++ERVAY QIDWHDFVVVE VDYQP E GNFPPPT P+EVGAR + EER    E      IE   +  +Q    ++   +    E + G+  + +N     +      +                 TT  QP    A   ++ P  ++V++K YDPKA   +     TDE +LISP+   +KI  S+ ++H+ +GLL+P W E RD++T  K+ +D  F +G  ++ +LK +AERRTDIFG+  EETVIG+K+GEE+ KK ++  WDGH ++ E
Sbjct:   23 GPIVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNELGNPKFNFLNGGDPYHAYYRHKVNEFREGNDAGITALTGMKQLAVTSAAQQRQQELLKQVVEQQFVPKEPPPEFEFIADPPSISALDLDIVKLTAQFVARNGRQFLTNLMSREQRNFQFDFLRPQHSLFQYFTKLLEQYTKVLIPPKDLLGKLRAESAPGRSSMNQVLDHVKYRANWQRHQEAQRRREEEKIERERVAYAQIDWHDFVVVETVDYQPFESGNFPPPTNPDEVGARVLMEERLMDEEGDTEMQIESDDEGDSQVTSHHDSGLKLSQMENRVGI--QMKNVSSYGQPTGAKRDNTQVQDMDEASSDEDTPTTKLQP----AVAPMLPPTHDKVVVKKYDPKATQPKPAPMPTDE-YLISPI-TGEKIPASKVSEHMRIGLLDPRWVEQRDKHTVEKINQDNVFAAGTAIEASLKQLAERRTDIFGVGDEETVIGKKLGEEETKKDDRVTWDGHTSSVE 519          
BLAST of Splicing factor 3A subunit 1 vs. TrEMBL
Match: B4PM97 (Uncharacterized protein OS=Drosophila yakuba OX=7245 GN=Dyak\GE26116 PE=4 SV=1)

HSP 1 Score: 402.134 bits (1032), Expect = 3.255e-125
Identity = 232/494 (46.96%), Postives = 317/494 (64.17%), Query Frame = 2
Query:  104 DVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISA-----KVSVPTAMKLAQD--TPKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESK----SPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEER---GEQVVNRWIEDNK---TQXXXXXXXXXXXXXXXXKTGVHGEKENXXXXXXXXXXXXXXXXXIXXXXXXXXXXXXTTFKQPVSDAARTNLIKP--EEVLIKTYDPKAKSKRQ----TDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGI--EETVIGRKVGEEDAKKGEKYIWDGHAATQE 1510
            +VRNIVD+TA FVARNGP+FEAR++ NE  N KFNFLN  DPY+ YY  +V +  EG    I+A     +++V +A +  Q     + +++ F PKE P EFEFI DPPSI++L+LDIV+LTAQFVARNGRQFLT LM+REQRN+ FDFLRPQH++F YFTKL+EQ+TK+L+PP D++ KL  ES     S    +++ KYR  W R+Q  QR++E E  ++ERVAY QIDWHDFVVVE VDYQP E GNFPPPT P+EVGAR + EER    E      IE ++   +Q     E   +    E + G+  + +N     +      +                 TT  QP    A   ++ P  ++V++K YDPKA   +Q    TDE +LISP+   +KI  S+ ++H+ +GLL+P W E RD++T  K+ +D  F +G  ++ +LK +AERRTDIFG+  EETVIG+K+GEE+ KK ++  WDGH ++ E
Sbjct:   34 EVRNIVDKTASFVARNGPEFEARIRQNELGNPKFNFLNGGDPYHAYYRHKVNEFREGNDAGITAIANMKQLAVTSAAQQRQQELLKQVVEQQFVPKEPPPEFEFIADPPSISALDLDIVKLTAQFVARNGRQFLTNLMSREQRNFQFDFLRPQHSLFQYFTKLLEQYTKVLIPPKDLLGKLRTESAPGRGSMNQVLEHVKYRANWQRHQEAQRRREEEKIERERVAYAQIDWHDFVVVETVDYQPFESGNFPPPTNPDEVGARVLMEERLMDEEGDTEMQIESDEEGDSQVNSLLESGLKLSQMENRVGI--QMKNVSSYGQPTGAKRDNTQVQDMDEASSDEDTPTTKLQP----AVAPMLPPTHDKVVVKKYDPKATQPKQAPMPTDE-YLISPI-TGEKIPASKVSEHMRIGLLDPRWVEQRDKHTVEKINQDNVFAAGTAIEASLKQLAERRTDIFGVGDEETVIGKKLGEEETKKDDRVTWDGHTSSVE 519          
BLAST of Splicing factor 3A subunit 1 vs. TrEMBL
Match: E9IJM9 (Uncharacterized protein (Fragment) OS=Solenopsis invicta OX=13686 GN=SINV_06548 PE=4 SV=1)

HSP 1 Score: 400.979 bits (1029), Expect = 6.268e-125
Identity = 233/491 (47.45%), Postives = 317/491 (64.56%), Query Frame = 2
Query:   74 PKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEG-----TVESISAKVSVPTAMKLAQDTPKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQVVNRWIEDNKTQXXXXXXXXXXXXXXXXKTGVHGEKENXXXXXXXXXXXXXXXXXIXXXXXXXXXXXXTTFKQPVSDAARTNLIKPEEVLIKTYDPKAKSKRQT-----DEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGI--EETVIGRKVGEEDAKKGEKYIWDGHAATQE 1510
            P  G+I PPP+VRNIVD+TA FVARNGP+FE+R++ NE  N KFNFLN  DPY+ YY  +VK+  EG     TV S   K    TA +  Q+  K +++ F PK+ P EFEFI DPPSI++L+LDIV+LTAQFVARNGRQFLT LMNREQRN+ FDFLRPQH++F YFTKL+EQ+TK+L+PP D++ +L  E+ + +  ++  KYR  + +YQ  QR+KE E  ++ERVAY QIDWHDFVVVE VDYQ  EVGNFP PT P+EVGAR + +ER E       ED + Q + + ++E +   + EKT    +        ED    D+            P    T+ + P       N++     + K YDPK  + + +     DE +LISP+   ++I  S+  +H+ +GLL+P W E RD++  +KL ++T F  G  ++ +LK +AERRTDIFG+  EET IG+K+GEED KK +K  WDGH ++ E
Sbjct:   26 PIVGIIYPPPEVRNIVDKTASFVARNGPEFESRIRQNELGNPKFNFLNFGDPYHAYYQHKVKEFKEGKGQEPTVGSAPGKTVNLTAHQKQQEILKQVEQPFVPKDPPTEFEFIADPPSISALDLDIVKLTAQFVARNGRQFLTNLMNREQRNFQFDFLRPQHSLFQYFTKLLEQYTKVLIPPKDLLPRLKDEALNMDKILEQVKYRAEYLKYQEAQRRKEEEELERERVAYAQIDWHDFVVVETVDYQQFEVGNFPAPTTPDEVGARVLMQERIEDG-----EDVEMQIDSDADDETQTRTDGEKTDRAKDNNQVQDMEEDSSDEDDVSPPGDTHKSKEPKPRETSMQPPPLPPTPGNVV-----VKKGYDPKQHAPKTSRPAAPDE-YLISPI-TGERIPASKVQEHMRIGLLDPRWVEQRDKHL-DKLAQETVFAPGTAIEASLKQLAERRTDIFGVGDEETAIGKKIGEEDKKKDDKVTWDGHTSSVE 503          
BLAST of Splicing factor 3A subunit 1 vs. TrEMBL
Match: B3NZA3 (GG16800 OS=Drosophila erecta OX=7220 GN=Dere\GG16800 PE=4 SV=1)

HSP 1 Score: 400.593 bits (1028), Expect = 1.419e-124
Identity = 227/492 (46.14%), Postives = 319/492 (64.84%), Query Frame = 2
Query:  104 DVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISA-----KVSVPTAMKLAQD--TPKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKES----KSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEER-GEQVVNRWIE---DNKTQXXXXXXXXXXXXXXXXKTGVHGEKENXXXXXXXXXXXXXXXXXIXXXXXXXXXXXXTTFKQPVSDAARTNLIKP--EEVLIKTYDPKAKSKRQ----TDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGI--EETVIGRKVGEEDAKKGEKYIWDGHAATQE 1510
            +VRNIVD+TA FVARNGP+FEAR++ NE  N KFNFLN  DPY+ YY  +V +  EG    I+A     +++V +A +  Q     + +++ F PKE P EFEFI DPPSI++L+LDIV+LTAQFVARNGRQFLT LM+REQRN+ FDFLRPQH++F YFTKL+EQ+TK+L+PP D++ KL  ES     S    + + KYR  W R+Q  QR++E E  ++ERVAY QIDWHDFVVVE VDYQP E GNFPPPT P+EVGAR + EER  ++V +  ++   D++      +  +   ++ + +  V  + +N     +      +                 TT  QP    A   ++ P  ++V++K YDPKA   +Q    TDE +LISP+   +KI  S+ ++H+ +GLL+P W E RD++T  K+ +D  F +G  ++ +LK +AERRTDIFG+  EETVIG+K+GEE+ +K ++  WDGH ++ E
Sbjct:   34 EVRNIVDKTASFVARNGPEFEARIRQNELGNPKFNFLNGGDPYHAYYRHKVNEFREGNDAGITAIANMKQLAVTSAAQQRQQELLKQVVEQQFVPKEPPPEFEFIADPPSISALDLDIVKLTAQFVARNGRQFLTNLMSREQRNFQFDFLRPQHSLFQYFTKLLEQYTKVLIPPKDLLGKLRTESAPGRSSMNQVLDHVKYRANWQRHQEAQRRREEEKIERERVAYAQIDWHDFVVVETVDYQPFESGNFPPPTNPDEVGARVLMEERLMDEVADTEMQIESDDEGDSHVNSLLDSGLKLSQMENRVGIQMKNVSSYGQPAGAKRDNNQVQDMDEASSDEDTPTTKLQP----AVAPMLPPTHDKVVVKKYDPKASQPKQAPMPTDE-YLISPI-TGEKIPASKVSEHMRIGLLDPRWVEQRDKHTVEKINQDNVFAAGTAIEASLKQLAERRTDIFGVGDEETVIGKKLGEEETRKDDRVTWDGHTSSVE 519          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Cavefish
Match: sf3a1 (splicing factor 3a subunit 1 [Source:NCBI gene;Acc:103044926])

HSP 1 Score: 328.176 bits (840), Expect = 1.990e-100
Identity = 168/296 (56.76%), Postives = 212/296 (71.62%), Query Frame = 2
Query:   32 HILKMTITEPEHVAPKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMKLAQDT-----------PKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQ 886
            H L     E     P  G+I PPP+VRNIVD+TA FVARNGP+FEAR++ NE NN KFNFLN  DPY+ YY  +V +  EG  +  SA  +VP  M+                 + I E   PKE P EFEFI DPPSI++ +LD+V+LTAQFVARNGRQFLTQLM +EQRNY FDFLRPQH++F+YFTKLVEQ+TK+L+PP  +++KL +E+++P   +   +YRV W ++Q R+RKKE E  ++ERVAY QIDWHDFVVVE VD+QPNE GNFPPPT PEE+GAR + +ER E+
Sbjct:   17 HTLHKEKDETPATKPIVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVNEFKEGKGQEPSA--AVPKVMQQQSLQQSQQQLPQKVQAQVIHETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKVLIPPKGLLQKLKREAENPREVLDQVRYRVEWAKFQERERKKEEEERERERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEK 310          

HSP 2 Score: 110.923 bits (276), Expect = 1.149e-24
Identity = 54/122 (44.26%), Postives = 83/122 (68.03%), Query Frame = 2
Query: 1151 VLIKTYDPKAKSKR---QTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGIEETVIGRKVGEEDAKKG-EKYIWDGHAAT 1504
            ++ K YDPKA   +   QT + +LISP+   +KI  S+  +H+ +GLL+P W E RDR+ + +  E+  +  G +++ +LK +AERRTDIFG+EET IG+K+GEE+ +K  EK  WDGH+ +
Sbjct:  383 IIRKDYDPKASKPQAPVQTTDEYLISPI-TGEKILASKMQEHMRIGLLDPRWLEQRDRSIRERQIEEEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGS 503          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Cavefish
Match: sf3a1 (splicing factor 3a subunit 1 [Source:NCBI gene;Acc:103044926])

HSP 1 Score: 326.635 bits (836), Expect = 6.821e-100
Identity = 165/282 (58.51%), Postives = 209/282 (74.11%), Query Frame = 2
Query:   74 PKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMKLAQDT-----------PKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQ 886
            P  G+I PPP+VRNIVD+TA FVARNGP+FEAR++ NE NN KFNFLN  DPY+ YY  +V +  EG  +  SA  +VP  M+                 + I E   PKE P EFEFI DPPSI++ +LD+V+LTAQFVARNGRQFLTQLM +EQRNY FDFLRPQH++F+YFTKLVEQ+TK+L+PP  +++KL +E+++P   +   +YRV W ++Q R+RKKE E  ++ERVAY QIDWHDFVVVE VD+QPNE GNFPPPT PEE+GAR + +ER E+
Sbjct:   27 PIVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVNEFKEGKGQEPSA--AVPKVMQQQSLQQSQQQLPQKVQAQVIHETIVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKVLIPPKGLLQKLKREAENPREVLDQVRYRVEWAKFQERERKKEEEERERERVAYAQIDWHDFVVVETVDFQPNEQGNFPPPTTPEELGARILIQERYEK 306          

HSP 2 Score: 110.923 bits (276), Expect = 1.074e-24
Identity = 54/122 (44.26%), Postives = 83/122 (68.03%), Query Frame = 2
Query: 1151 VLIKTYDPKAKSKR---QTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGIEETVIGRKVGEEDAKKG-EKYIWDGHAAT 1504
            ++ K YDPKA   +   QT + +LISP+   +KI  S+  +H+ +GLL+P W E RDR+ + +  E+  +  G +++ +LK +AERRTDIFG+EET IG+K+GEE+ +K  EK  WDGH+ +
Sbjct:  379 IIRKDYDPKASKPQAPVQTTDEYLISPI-TGEKILASKMQEHMRIGLLDPRWLEQRDRSIRERQIEEEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGS 499          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Cavefish
Match: ENSAMXT00000051422.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:35461191:35465166:-1 gene:ENSAMXG00000032672.1 transcript:ENSAMXT00000051422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 8.631e-7
Identity = 24/52 (46.15%), Postives = 34/52 (65.38%), Query Frame = -2
Query: 2107 DEVVKIIFNKPPLNVFSIGIKEEYPKISDKVITFLLPFSTTHLCELSF*TLV 2262
            D  +K+IF++  L  F +  + EYP +SDK + FL+PF TT+LCE  F  LV
Sbjct:  580 DSALKLIFSQKSLVNFWLHARSEYPDLSDKAVRFLMPFPTTYLCETGFSMLV 631          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Cavefish
Match: ENSAMXT00000044261.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000070.1:2279767:2281653:1 gene:ENSAMXG00000037161.1 transcript:ENSAMXT00000044261.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 1.514e-6
Identity = 24/52 (46.15%), Postives = 33/52 (63.46%), Query Frame = -2
Query: 2107 DEVVKIIFNKPPLNVFSIGIKEEYPKISDKVITFLLPFSTTHLCELSF*TLV 2262
            D  +K IF++  L  F +  + EYP +SDK + FL+PF TT+LCE  F  LV
Sbjct:  537 DSALKFIFSQKSLVNFWLHARSEYPDLSDKAVRFLMPFPTTYLCETGFSMLV 588          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Sea Lamprey
Match: sf3a1 (splicing factor 3a, subunit 1 [Source:ZFIN;Acc:ZDB-GENE-030616-156])

HSP 1 Score: 326.25 bits (835), Expect = 1.165e-102
Identity = 162/276 (58.70%), Postives = 210/276 (76.09%), Query Frame = 2
Query:   74 PKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMK----LAQDT-PKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQ 886
            P  G+I PPP+VRNIVD+TA FVARNGP+FEAR++ NE NN KFNFL + DPY+ YY  +V +  EG  +  SA  +VP  M+    ++Q    + +QE   PKE P +FEF+ D PSI+  +LD+V+LTAQFVARNGR FLTQLM +EQRNY FDFLRPQH++F YFTKLVEQ+TKIL+PP  +++KL KE+++P+  +   KYRV W ++Q R+R+KE E  ++ERVAY Q+DWHDFVVVE VD+QPNE GN PPPT PEE+GAR +A+ER E+
Sbjct:   35 PAVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLTTTDPYHAYYRHKVTEFREGRGQEPSA--AVPKIMQQQLLISQKVQAQVMQETIVPKEAPPDFEFMADAPSISYFDLDVVKLTAQFVARNGRSFLTQLMAKEQRNYTFDFLRPQHSLFHYFTKLVEQYTKILIPPKGLLQKLKKEAENPKDILDQVKYRVEWAKFQERERRKEEEERERERVAYAQVDWHDFVVVETVDFQPNEQGNLPPPTTPEELGARILAQERYEK 308          

HSP 2 Score: 102.834 bits (255), Expect = 5.113e-23
Identity = 49/124 (39.52%), Postives = 82/124 (66.13%), Query Frame = 2
Query: 1151 VLIKTYDPKAKSKRQT-----DEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGIEETVIGRKVGEEDAKKGE-KYIWDGHAAT 1504
            ++ K YDPK  + R T      + FL+SP+   ++I  S+  +H+ +GLL+P W + ++R+ + +  ++  +  G +++ +LK +AERRTDIFG+EET IG+K+GEE+ +K E K  WDGH A+
Sbjct:  381 IIRKDYDPKGAAVRPTAPAPTQDEFLVSPI-TGERIPASKMQEHMRIGLLDPRWIQEQERSIRERQNQEEVYAHGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEDKVTWDGHTAS 503          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001822.1 (pep scaffold:Pmarinus_7.0:GL491554:236:5412:-1 gene:ENSPMAG00000001655.1 transcript:ENSPMAT00000001822.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 9.785e-8
Identity = 28/61 (45.90%), Postives = 38/61 (62.30%), Query Frame = 2
Query:   92 IPPPDVR------NIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRV 256
            +PPP VR      NI+D+ A+FVARNGP+FE   K  + +N KF FL   + +N YY  +V
Sbjct:    1 VPPPRVRADQEQRNIIDKLAQFVARNGPEFEKMTKQKQRDNPKFAFLFRGEYFN-YYQYKV 60          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Sea Lamprey
Match: sfswap (splicing factor SWAP [Source:ZFIN;Acc:ZDB-GENE-040426-931])

HSP 1 Score: 48.1358 bits (113), Expect = 6.197e-6
Identity = 28/78 (35.90%), Postives = 40/78 (51.28%), Query Frame = 2
Query:   59 PEHVAPKFGVIIPPP-DVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESI 289
            PE +    G+ +P       IV+RTA FV + G  FE  +K  +A NS+F+FL      NPYY   +K+  +G    I
Sbjct:  161 PEELKLPSGMEVPATFKTHAIVERTAGFVCKQGTQFEIMLKKKQARNSQFDFLRFDHYLNPYYKHILKRMKDGKYTHI 238          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Sea Lamprey
Match: sfswap (splicing factor SWAP [Source:ZFIN;Acc:ZDB-GENE-040426-931])

HSP 1 Score: 47.7506 bits (112), Expect = 7.863e-6
Identity = 28/78 (35.90%), Postives = 40/78 (51.28%), Query Frame = 2
Query:   59 PEHVAPKFGVIIPPP-DVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESI 289
            PE +    G+ +P       IV+RTA FV + G  FE  +K  +A NS+F+FL      NPYY   +K+  +G    I
Sbjct:  161 PEELKLPSGMEVPATFKTHAIVERTAGFVCKQGTQFEIMLKKKQARNSQFDFLRFDHYLNPYYKHILKRMKDGKYTHI 238          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Nematostella
Match: EDO49841 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RES3])

HSP 1 Score: 309.301 bits (791), Expect = 4.428e-94
Identity = 152/278 (54.68%), Postives = 201/278 (72.30%), Query Frame = 2
Query:   74 PKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIE--GTVESISAK----VSVPTAMKLAQDTPKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQV 889
            P  G+I PPP+VRNIVD+TA FVARNGP+FE+R++ NE NN KFNFLN  DPY  Y+  +VK   E  G V   S+     +S P  +   Q     I ++  PKE P E+EF+ DPPSI++L+LDIV+LTAQFVARNGRQFLT LM REQRNY FDFLRPQH++F+YFTKLVEQ+TK+L+PP +I EKL ++   P   +   KYRV W ++Q ++++K  +  +KERVA+  +DWHDFVVVE V+++ +E GN PPP   E++GAR +A+ER E+V
Sbjct:   27 PTIGIIYPPPEVRNIVDKTASFVARNGPEFESRIRQNEINNPKFNFLNQGDPYYAYFLHKVKDFKENLGKVPEPSSAPGPGISKPKPLMQQQ---VLISDLNIPKEPPPEYEFMADPPSISALDLDIVKLTAQFVARNGRQFLTNLMQREQRNYQFDFLRPQHSLFNYFTKLVEQYTKVLIPPANIKEKLKEDIHDPHKVLDRVKYRVEWVKHQEKEKQKLEDEREKERVAFASVDWHDFVVVETVEFKDDETGNLPPPVTQEQLGARILAQERYEKV 301          

HSP 2 Score: 100.523 bits (249), Expect = 7.503e-22
Identity = 63/163 (38.65%), Postives = 93/163 (57.06%), Query Frame = 2
Query: 1160 KTYDPKAKSKRQTD---EVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGI--EETVIGRKVGEEDAKKGEKYIWDGHAATQEPYISRQSDLTAGRGDDKKDSAA----------DIDRIGPQA 1603
            + YDPKA   +      E +LISP+   +++      +H+ + LL+P W+E RD+   +K Q++  F  G  +  +LK +AERRTDIFG   EET+IGRK+GEE+ K+ EK  WDGH A+     SR++   AG   D++  A           D +RIGP+A
Sbjct:  368 RDYDPKAAKPQAPPLPPEKYLISPI-TGERVPAEAMAEHMKINLLDPRWKEQRDKAIMDKKQQEEVFAEGIAIGSSLKQLAERRTDIFGAGDEETIIGRKIGEEEDKRPEKVTWDGHTASMA-STSRRAQ--AGVTLDQQIEAIHKSKGLAPSDDRERIGPRA 526          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Nematostella
Match: EDO28442 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6G4])

HSP 1 Score: 227.254 bits (578), Expect = 1.137e-69
Identity = 102/174 (58.62%), Postives = 138/174 (79.31%), Query Frame = 2
Query:  365 PKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQ 886
            PKE P E+EF+ DPPSI++L+LDIV+LTAQFVAR+GRQFLT LM REQRNY FDFLRPQH++F+YFTKLVEQ+TK+L+PP +I EKL ++   P   +   KYRV W ++Q ++++K  +  +KERVA+  +DWHDFVVVE V+++ +E GN PPP   E++GAR +A+ER E+
Sbjct:   13 PKEPPPEYEFMADPPSISALDLDIVKLTAQFVARDGRQFLTNLMQREQRNYQFDFLRPQHSLFNYFTKLVEQYTKVLIPPANIKEKLKEDIHDPHKVLDRVKYRVEWVKHQEKEKQKLEDEREKERVAFASVDWHDFVVVETVEFKDDETGNLPPPVTQEQLGARILAQERYEK 186          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Nematostella
Match: EDO48222 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKB9])

HSP 1 Score: 54.299 bits (129), Expect = 1.849e-7
Identity = 29/58 (50.00%), Postives = 36/58 (62.07%), Query Frame = 2
Query:   92 IPPPD---VRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRV 256
             PPPD   ++NI+D+ A FVARNG  FE   K  + NN KF+FL S   Y+ YY  RV
Sbjct:   11 FPPPDDQELKNIIDKLANFVARNGSKFEDMTKEKQKNNPKFSFLYSGQNYHNYYRWRV 68          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Medaka
Match: sf3a1 (splicing factor 3a subunit 1 [Source:NCBI gene;Acc:101157948])

HSP 1 Score: 330.102 bits (845), Expect = 1.560e-101
Identity = 169/278 (60.79%), Postives = 212/278 (76.26%), Query Frame = 2
Query:   74 PKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKV------SVPTAMKLAQDT-PKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQ 886
            P  G+I PPP+VRNIVD+TA FVARNGP+FEAR++ NE NN KFNFLN  DPY+ YY  +V +  EG  +  SA V      ++  + +L Q    + IQE   PKE P EFEFI DPPSI++ +LD+V+LTAQFVARNGRQFLTQLM +EQRNY FDFLRPQH++F+YFTKLVEQ+TKIL+PP  ++ KL +E+++P+  M   +YRV W +YQ R+RKKE E  +KERVAY QIDWHDFVVVE VD+QPNE G+FPPPT PEE+GAR + +ER E+
Sbjct:   29 PIVGIIYPPPEVRNIVDKTASFVARNGPEFEARIRQNEINNPKFNFLNPNDPYHAYYRHKVNEFKEGKAQEPSAAVPKVMQQAMQQSQQLPQKVQSQVIQETVVPKEPPPEFEFIADPPSISAFDLDVVKLTAQFVARNGRQFLTQLMQKEQRNYQFDFLRPQHSLFNYFTKLVEQYTKILIPPKGLLAKLKREAENPKEVMDQVRYRVEWAKYQERERKKEEEEREKERVAYAQIDWHDFVVVETVDFQPNEQGHFPPPTTPEELGARILIQERYEK 306          

HSP 2 Score: 110.153 bits (274), Expect = 1.737e-24
Identity = 56/123 (45.53%), Postives = 83/123 (67.48%), Query Frame = 2
Query: 1151 VLIKTYDPKAK----SKRQTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGIEETVIGRKVGEEDAKKG-EKYIWDGHAAT 1504
            ++ K YDPKA     S    DE +LISP+   +KI  S+  +H+ +GLL+P W E RDR+ +++  ED  +  G +++ +LK +AERRTDIFG+EET IG+K+GEE+ +K  EK  WDGH+ +
Sbjct:  379 IIRKDYDPKASKPMPSVAAPDE-YLISPI-TGEKIPASKMQEHMRIGLLDPRWLEQRDRSIRDRQTEDEVYAPGLDIESSLKQLAERRTDIFGVEETAIGKKIGEEEIQKPEEKVTWDGHSGS 499          
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Medaka
Match: sfswap (splicing factor SWAP [Source:NCBI gene;Acc:101155209])

HSP 1 Score: 56.6102 bits (135), Expect = 9.818e-8
Identity = 25/54 (46.30%), Postives = 37/54 (68.52%), Query Frame = 2
Query:   83 GVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYY 244
             ++ PPPD++ ++D+ AE+VARNG  FEA V+    N+ +F+FL S   YN YY
Sbjct:  450 AIVPPPPDIQPVIDKLAEYVARNGVKFEASVRAK--NDPRFDFLQSWHQYNIYY 501          

HSP 2 Score: 50.0618 bits (118), Expect = 9.659e-6
Identity = 34/78 (43.59%), Postives = 44/78 (56.41%), Query Frame = 2
Query:   68 VAPKFGVIIPPPDV--------RNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPY-NPYYNQRVKQCIEG 274
            VAP  G+ IPP DV         NI++RTA FV + G  FE  +K  +A NS+F+FL   D Y NPYY   +K   +G
Sbjct:  178 VAPP-GLDIPP-DVELPATVKTHNIIERTANFVCQQGAQFEIVLKAKQAGNSQFDFLR-FDHYLNPYYKHILKAMKDG 252          
BLAST of Splicing factor 3A subunit 1 vs. Planmine SMEST
Match: SMESG000072847.1 (SMESG000072847.1)

HSP 1 Score: 984.941 bits (2545), Expect = 0.000e+0
Identity = 582/584 (99.66%), Postives = 582/584 (99.66%), Query Frame = 2
Query:   44 MTITEPEHVAPKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMKLAQDTPKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGEQVVNRWIEDNKTQXXXXXXXXXXXXXXXXKTGVHGEKENXXXXXXXXXXXXXXXXXIXXXXXXXXXXXXTTFKQPVSDAARTNLIKPEEVLIKTYDPKAKSKRQTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGIEETVIGRKVGEEDAKKGEKYIWDGHAATQEPYISRQSDLTAGRGDDKKDSAADIDRIGPQAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIATEPNESPDQDNQGQPIE 1795
            MTITEPEHVAPKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMKLAQDTPKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERG QVVNRWIEDNKTQEEEENEEEEEEEIEEEKTGVHGEKENDDMEVEDMEVSDEEEDSIPAPPPPMPPGPATTFKQPVSDAARTNLIKPEEVLIKTYDPKAKSKRQTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGIEETVIGRKVGEEDAKKGEKYIWDGHAATQEPYISRQSDLTAGRGDDKKDSAADIDRIGPQAVPQVVP PTITIIVNTPIISQAVAQIAPPPPPPPPPMAMVPLPAQIATEPNESPDQDNQGQPIE
Sbjct:    1 MTITEPEHVAPKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEANNSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMKLAQDTPKAIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQLMNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKSPEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMVDYQPNEVGNFPPPTIPEEVGARAIAEERGVQVVNRWIEDNKTQEEEENEEEEEEEIEEEKTGVHGEKENDDMEVEDMEVSDEEEDSIPAPPPPMPPGPATTFKQPVSDAARTNLIKPEEVLIKTYDPKAKSKRQTDEVFLISPLGDNKKITTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMAERRTDIFGIEETVIGRKVGEEDAKKGEKYIWDGHAATQEPYISRQSDLTAGRGDDKKDSAADIDRIGPQAVPQVVPAPTITIIVNTPIISQAVAQIAPPPPPPPPPMAMVPLPAQIATEPNESPDQDNQGQPIE 584          
BLAST of Splicing factor 3A subunit 1 vs. Planmine SMEST
Match: SMESG000073188.1 (SMESG000073188.1)

HSP 1 Score: 46.9802 bits (110), Expect = 2.700e-6
Identity = 24/53 (45.28%), Postives = 32/53 (60.38%), Query Frame = -2
Query: 2107 SDEVVKIIFNKPPLNVFSIGIKEEYPKISDKVITFLLPFSTTHLCELSF*TLV 2265
            +D  +K+ F K     F I ++EEYP +S   IT LL F+T+ LCEL F TL 
Sbjct:   16 TDRSLKMEFTKMSNEYFWIFVQEEYPSLSKTAITILLQFATSFLCELGFSTLT 68          
BLAST of Splicing factor 3A subunit 1 vs. Planmine SMEST
Match: SMESG000028317.1 (SMESG000028317.1)

HSP 1 Score: 50.447 bits (119), Expect = 5.863e-6
Identity = 22/52 (42.31%), Postives = 35/52 (67.31%), Query Frame = -2
Query: 2107 DEVVKIIFNKPPLNVFSIGIKEEYPKISDKVITFLLPFSTTHLCELSF*TLV 2262
            D  +K++F +  L+ F + I+ EYP IS+ V+  LLPF++T+LCE  F  L+
Sbjct: 1090 DRTLKLMFQEKDLDEFWLSIQNEYPTISNYVMNTLLPFASTYLCEAGFSALL 1141          
The following BLAST results are available for this feature:
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SF3A18.229e-10160.50splicing factor 3a subunit 1 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
prp-211.203e-7446.64Pre-RNA processing 21; Yeast PRP (Splicing factor)... [more]
back to top
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Sf3a14.950e-12746.15gene:FBgn0266917 transcript:FBtr0083374[more]
scaf66.378e-853.45gene:FBgn0261872 transcript:FBtr0301554[more]
scaf61.164e-753.45gene:FBgn0261872 transcript:FBtr0345067[more]
scaf61.112e-653.45gene:FBgn0261872 transcript:FBtr0091474[more]
back to top
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sf3a12.724e-10061.23splicing factor 3a, subunit 1 [Source:ZFIN;Acc:ZDB... [more]
sf3a12.724e-10061.23splicing factor 3a, subunit 1 [Source:ZFIN;Acc:ZDB... [more]
sf3a12.724e-10061.23splicing factor 3a, subunit 1 [Source:ZFIN;Acc:ZDB... [more]
sf3a16.378e-4959.31splicing factor 3a, subunit 1 [Source:ZFIN;Acc:ZDB... [more]
sfswap3.385e-638.16splicing factor SWAP [Source:ZFIN;Acc:ZDB-GENE-040... [more]
back to top
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gpx72.603e-10158.78glutathione peroxidase 7 [Source:Xenbase;Acc:XB-GE... [more]
gpx78.529e-10158.78glutathione peroxidase 7 [Source:Xenbase;Acc:XB-GE... [more]
gpx71.392e-10058.78glutathione peroxidase 7 [Source:Xenbase;Acc:XB-GE... [more]
gpx71.403e-10058.78glutathione peroxidase 7 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Sf3a16.868e-10159.23splicing factor 3a, subunit 1 [Source:MGI Symbol;A... [more]
back to top
BLAST of Splicing factor 3A subunit 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q15459|SF3A1_HUMAN3.952e-10060.50Splicing factor 3A subunit 1 OS=Homo sapiens OX=96... [more]
sp|Q8K4Z5|SF3A1_MOUSE4.804e-10059.23Splicing factor 3A subunit 1 OS=Mus musculus OX=10... [more]
sp|A2VDN6|SF3A1_BOVIN8.462e-10060.14Splicing factor 3A subunit 1 OS=Bos taurus OX=9913... [more]
sp|Q8RXF1|SF3A1_ARATH2.496e-5441.94Probable splicing factor 3A subunit 1 OS=Arabidops... [more]
sp|O13900|SA114_SCHPO1.224e-4738.75Pre-mRNA-splicing factor sap114 OS=Schizosaccharom... [more]
back to top
BLAST of Splicing factor 3A subunit 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Y1NJN25.917e-13146.76Uncharacterized protein OS=Photinus pyralis OX=705... [more]
A0A1W4VUG41.944e-12946.73splicing factor 3A subunit 1 OS=Drosophila ficusph... [more]
B4PM973.255e-12546.96Uncharacterized protein OS=Drosophila yakuba OX=72... [more]
E9IJM96.268e-12547.45Uncharacterized protein (Fragment) OS=Solenopsis i... [more]
B3NZA31.419e-12446.14GG16800 OS=Drosophila erecta OX=7220 GN=Dere\GG168... [more]
back to top
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sf3a11.990e-10056.76splicing factor 3a subunit 1 [Source:NCBI gene;Acc... [more]
sf3a16.821e-10058.51splicing factor 3a subunit 1 [Source:NCBI gene;Acc... [more]
ENSAMXT00000051422.18.631e-746.15pep primary_assembly:Astyanax_mexicanus-2.0:15:354... [more]
ENSAMXT00000044261.11.514e-646.15pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
sf3a11.165e-10258.70splicing factor 3a, subunit 1 [Source:ZFIN;Acc:ZDB... [more]
ENSPMAT00000001822.19.785e-845.90pep scaffold:Pmarinus_7.0:GL491554:236:5412:-1 gen... [more]
sfswap6.197e-635.90splicing factor SWAP [Source:ZFIN;Acc:ZDB-GENE-040... [more]
sfswap7.863e-635.90splicing factor SWAP [Source:ZFIN;Acc:ZDB-GENE-040... [more]
back to top
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO498414.428e-9454.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO284421.137e-6958.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482221.849e-750.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Splicing factor 3A subunit 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sf3a11.560e-10160.79splicing factor 3a subunit 1 [Source:NCBI gene;Acc... [more]
sfswap9.818e-846.30splicing factor SWAP [Source:NCBI gene;Acc:1011552... [more]
back to top
BLAST of Splicing factor 3A subunit 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000072847.10.000e+099.66SMESG000072847.1[more]
SMESG000073188.12.700e-645.28SMESG000073188.1[more]
SMESG000028317.15.863e-642.31SMESG000028317.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021536 ID=SMED30021536|Name=Splicing factor 3A subunit 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2266bp
AATTTTTTGAACATTTTTGATTTATGATCGCCATATTTTAAAAATGACCA
TAACTGAGCCAGAGCATGTTGCACCAAAATTTGGTGTCATTATACCACCA
CCAGATGTCAGAAATATTGTTGATCGAACAGCAGAATTTGTGGCTCGAAA
TGGACCTGATTTTGAAGCAAGAGTTAAAATAAATGAAGCTAATAATTCAA
AATTCAACTTTCTTAATTCTCTTGATCCTTACAATCCTTATTATAATCAA
AGAGTTAAGCAATGCATTGAGGGTACAGTGGAATCTATTTCTGCTAAGGT
TTCTGTTCCTACAGCCATGAAACTGGCTCAAGACACACCTAAAGCTATCC
AAGAAGTTTTTGAGCCTAAAGAAACGCCTGCAGAATTTGAATTTATAGTT
GACCCTCCGAGTATTAATAGCTTGGAGCTTGATATCGTTAGACTTACAGC
TCAATTTGTGGCACGTAATGGAAGACAATTTTTAACCCAGCTCATGAATC
GTGAGCAACGTAATTATTTATTTGATTTCTTGCGTCCTCAGCACAATATG
TTCAGTTATTTTACTAAACTTGTCGAGCAGTTTACGAAAATTTTGTTACC
TCCAAATGATATAATTGAAAAACTGAACAAGGAATCTAAAAGCCCAGAAA
TATTCATGAAAAATTGTAAATATCGTGTAGCTTGGGATCGTTACCAGGCA
AGGCAGCGTAAAAAAGAAATGGAGGCTGAAGACAAAGAAAGAGTTGCTTA
TGGACAAATTGATTGGCATGATTTTGTTGTAGTGGAGATGGTAGATTATC
AACCTAACGAAGTCGGAAACTTTCCTCCGCCTACAATTCCTGAAGAGGTT
GGAGCAAGAGCTATAGCTGAAGAAAGAGGAGAACAAGTAGTTAATAGGTG
GATTGAAGATAACAAAACACAAGAAGAAGAAGAAAATGAGGAGGAAGAAG
AGGAAGAAATTGAAGAAGAGAAAACTGGTGTTCACGGTGAAAAGGAAAAC
GATGATATGGAAGTTGAAGACATGGAAGTTAGTGATGAAGAGGAAGATTC
AATCCCTGCTCCTCCTCCACCGATGCCGCCAGGTCCAGCAACAACATTCA
AGCAGCCTGTTAGTGATGCAGCTAGAACAAATCTCATCAAACCAGAAGAA
GTGCTCATCAAAACTTATGATCCGAAAGCGAAATCTAAAAGACAAACTGA
TGAAGTGTTCCTGATCTCTCCACTCGGTGACAACAAGAAGATCACAACGA
GTCAGGCCAATCAGCATATCCATGTCGGTCTGCTGAACCCGTCATGGCGA
GAACATCGCGACCGGAACACCAAGAACAAATTGCAAGAGGACACTCCGTT
CACGTCAGGCCCGAATGTCGATTACAATTTGAAAATGATGGCGGAGCGCC
GAACGGACATTTTCGGTATTGAGGAAACGGTAATCGGGCGGAAGGTGGGC
GAGGAGGACGCTAAGAAAGGTGAGAAATATATCTGGGACGGTCACGCCGC
TACACAGGAGCCCTACATTTCCCGGCAATCGGACTTGACAGCGGGCCGTG
GCGACGACAAGAAGGACTCGGCAGCGGATATCGATCGGATCGGGCCACAG
GCGGTGCCGCAGGTCGTTCCGCCCCCCACGATCACAATCATTGTCAACAC
TCCGATCATCTCACAAGCAGTAGCACAGATCGCACCTCCACCGCCGCCTC
CTCCCCCACCAATGGCGATGGTGCCGCTACCAGCACAGATCGCTACCGAG
CCCAATGAATCACCGGATCAAGATAACCAAGGCCAGCCAATTGAGAAGCG
ATTGAAATTAAATTAATTGATTCTTGATTTGCGTTGAAATTAAATTATTC
TTTTGTTATTCGGTGGTTATATAGATTTGTCCTGTATCGATTTTATCATT
TTGATTGGGGGGCCACTCGAAACGCATTTCACTTTGGAATAATGTTATAT
TTGTCCTTTCATTTACTGTAATTTATTCAATCATCTAGATTAGTGCTCCG
CAACGGCACACTAAATCCTTTCTAGAAATCTGTGGCACACCACAATGGAA
AAAATAATAAAAGAATATGAGTGTACAAAAATTATCAACTAGAGTTGAAA
AACTTAAACTAGAGTTCAAAAACTTAGTTCACAAAGGTGCGTTGTAGAAA
ACGGAAGCAGAAATGTGATAACTTTGTCTGAAATCTTAGGATATTCCTCT
TTGATTCCAATCGAAAACACATTCAATGGAGGTTTGTTGAATATGATTTT
TACCACCTCGTCAGAG
back to top

protein sequence of SMED30021536-orf-1

>SMED30021536-orf-1 ID=SMED30021536-orf-1|Name=SMED30021536-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=591bp
MTITEPEHVAPKFGVIIPPPDVRNIVDRTAEFVARNGPDFEARVKINEAN
NSKFNFLNSLDPYNPYYNQRVKQCIEGTVESISAKVSVPTAMKLAQDTPK
AIQEVFEPKETPAEFEFIVDPPSINSLELDIVRLTAQFVARNGRQFLTQL
MNREQRNYLFDFLRPQHNMFSYFTKLVEQFTKILLPPNDIIEKLNKESKS
PEIFMKNCKYRVAWDRYQARQRKKEMEAEDKERVAYGQIDWHDFVVVEMV
DYQPNEVGNFPPPTIPEEVGARAIAEERGEQVVNRWIEDNKTQEEEENEE
EEEEEIEEEKTGVHGEKENDDMEVEDMEVSDEEEDSIPAPPPPMPPGPAT
TFKQPVSDAARTNLIKPEEVLIKTYDPKAKSKRQTDEVFLISPLGDNKKI
TTSQANQHIHVGLLNPSWREHRDRNTKNKLQEDTPFTSGPNVDYNLKMMA
ERRTDIFGIEETVIGRKVGEEDAKKGEKYIWDGHAATQEPYISRQSDLTA
GRGDDKKDSAADIDRIGPQAVPQVVPPPTITIIVNTPIISQAVAQIAPPP
PPPPPPMAMVPLPAQIATEPNESPDQDNQGQPIEKRLKLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000061Surp
IPR022030SF3A1
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
Vocabulary: biological process
TermDefinition
GO:0006396RNA processing