mutS protein homolog 5

Overview
NamemutS protein homolog 5
Smed IDSMED30021525
Length (bp)2473
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of mutS protein homolog 5 (SMED30021525) t-SNE clustered cells

Violin plots show distribution of expression levels for mutS protein homolog 5 (SMED30021525) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021525

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30021525h1SMcG0014221 SmedASXL_001708SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30021525h1SMcG0014221 SmedASXL_011517SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30021525h1SMcG0014221 dd_Smed_v4_30393_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021525h1SMcG0014221 SMED_28701_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30021525h1SMcG0014221 SMED_28701_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of mutS protein homolog 5 vs. Ensembl Human
Match: MSH5 (mutS homolog 5 [Source:HGNC Symbol;Acc:HGNC:7328])

HSP 1 Score: 388.267 bits (996), Expect = 1.062e-121
Identity = 234/620 (37.74%), Postives = 355/620 (57.26%), Query Frame = 3
Query:  447 SMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXX-XXPGMEYLFSMNNAVYYKNYTTKNL--------------ETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSG-EIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRL--FSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            +MT  EK +F+ SIIP +    VR+ GGLLKF+ ++R+GVELE     +P+L  + +     + ID+++   L IF   SHPS +K  V    KEGLS+F +LN CH K    +L  W  RP  D+  +  RLD + FF   QN D+ Q+L R L  + N+  IL RMK S   + DW VL +++   + + +   ++ + +++ + I  +F+D L+ IAS I K++D EG   + RF V   +DP +DEKK +   LP  L+ +A +EL+  ++ I  C ++Y+P +G+LL+IP   +  E     I G++++F     ++Y++  TK L              ET +M+ LQ  +L    +L   LDL   LD LL+LA AAR  G +RP +      ++I+NGRHPL E+ +  F+PNST      G++ +I+G N SGKS+YLKQ+G++  +A +GSFVPA +  +   +A+ TR+ S ES   GLSTFM+DLNQ++     A A S +LIDEFGKG     G++L+ A LR  +A+   CPHIFV T+F  L    L+   P VQ+      ED +  L++ YQ+ +G  + SHA   A    + D ++ R  EV
Sbjct:  158 AMTATEKILFLSSIIPFDCLLTVRALGGLLKFLGRRRIGVELEDYNVSVPILGFKKFMLTHLVNIDQDTYSVLQIFKSESHPSVYK--VASGLKEGLSLFGILNRCHCKWGEKLLRLWFTRPTHDLGELSSRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKVSDWQVLYKTVYSALGLRDACRSLPQSIQLFRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRFTVLPNIDPEIDEKKRRLMGLPSFLTEVARKELENLDSRIPSCSVIYIPLIGFLLSIPRLPSMVEASDFEINGLDFMFLSEEKLHYRSARTKELDALLGDLHCEIRDQETLLMYQLQCQVLARAAVLTRVLDLASRLDVLLALASAARDYGYSRPRYSPQVLGVRIQNGRHPLMELCARTFVPNSTECGGDKGRVKVITGPNSSGKSIYLKQVGLITFMALVGSFVPAEEAEIGAVDAIFTRIHSCESISLGLSTFMIDLNQVAKAVNNATAQSLVLIDEFGKGTNTVDGLALLAAVLRHWLARGPTCPHIFVATNFLSLVQLQLLPQGPLVQYLTMETCEDGN-DLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEV 774          
BLAST of mutS protein homolog 5 vs. Ensembl Human
Match: MSH5 (mutS homolog 5 [Source:HGNC Symbol;Acc:HGNC:7328])

HSP 1 Score: 388.267 bits (996), Expect = 1.062e-121
Identity = 234/620 (37.74%), Postives = 355/620 (57.26%), Query Frame = 3
Query:  447 SMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXX-XXPGMEYLFSMNNAVYYKNYTTKNL--------------ETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSG-EIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRL--FSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            +MT  EK +F+ SIIP +    VR+ GGLLKF+ ++R+GVELE     +P+L  + +     + ID+++   L IF   SHPS +K  V    KEGLS+F +LN CH K    +L  W  RP  D+  +  RLD + FF   QN D+ Q+L R L  + N+  IL RMK S   + DW VL +++   + + +   ++ + +++ + I  +F+D L+ IAS I K++D EG   + RF V   +DP +DEKK +   LP  L+ +A +EL+  ++ I  C ++Y+P +G+LL+IP   +  E     I G++++F     ++Y++  TK L              ET +M+ LQ  +L    +L   LDL   LD LL+LA AAR  G +RP +      ++I+NGRHPL E+ +  F+PNST      G++ +I+G N SGKS+YLKQ+G++  +A +GSFVPA +  +   +A+ TR+ S ES   GLSTFM+DLNQ++     A A S +LIDEFGKG     G++L+ A LR  +A+   CPHIFV T+F  L    L+   P VQ+      ED +  L++ YQ+ +G  + SHA   A    + D ++ R  EV
Sbjct:  158 AMTATEKILFLSSIIPFDCLLTVRALGGLLKFLGRRRIGVELEDYNVSVPILGFKKFMLTHLVNIDQDTYSVLQIFKSESHPSVYK--VASGLKEGLSLFGILNRCHCKWGEKLLRLWFTRPTHDLGELSSRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKVSDWQVLYKTVYSALGLRDACRSLPQSIQLFRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRFTVLPNIDPEIDEKKRRLMGLPSFLTEVARKELENLDSRIPSCSVIYIPLIGFLLSIPRLPSMVEASDFEINGLDFMFLSEEKLHYRSARTKELDALLGDLHCEIRDQETLLMYQLQCQVLARAAVLTRVLDLASRLDVLLALASAARDYGYSRPRYSPQVLGVRIQNGRHPLMELCARTFVPNSTECGGDKGRVKVITGPNSSGKSIYLKQVGLITFMALVGSFVPAEEAEIGAVDAIFTRIHSCESISLGLSTFMIDLNQVAKAVNNATAQSLVLIDEFGKGTNTVDGLALLAAVLRHWLARGPTCPHIFVATNFLSLVQLQLLPQGPLVQYLTMETCEDGN-DLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEV 774          
BLAST of mutS protein homolog 5 vs. Ensembl Human
Match: MSH5 (mutS homolog 5 [Source:HGNC Symbol;Acc:HGNC:7328])

HSP 1 Score: 388.267 bits (996), Expect = 1.062e-121
Identity = 234/620 (37.74%), Postives = 355/620 (57.26%), Query Frame = 3
Query:  447 SMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXX-XXPGMEYLFSMNNAVYYKNYTTKNL--------------ETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSG-EIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRL--FSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            +MT  EK +F+ SIIP +    VR+ GGLLKF+ ++R+GVELE     +P+L  + +     + ID+++   L IF   SHPS +K  V    KEGLS+F +LN CH K    +L  W  RP  D+  +  RLD + FF   QN D+ Q+L R L  + N+  IL RMK S   + DW VL +++   + + +   ++ + +++ + I  +F+D L+ IAS I K++D EG   + RF V   +DP +DEKK +   LP  L+ +A +EL+  ++ I  C ++Y+P +G+LL+IP   +  E     I G++++F     ++Y++  TK L              ET +M+ LQ  +L    +L   LDL   LD LL+LA AAR  G +RP +      ++I+NGRHPL E+ +  F+PNST      G++ +I+G N SGKS+YLKQ+G++  +A +GSFVPA +  +   +A+ TR+ S ES   GLSTFM+DLNQ++     A A S +LIDEFGKG     G++L+ A LR  +A+   CPHIFV T+F  L    L+   P VQ+      ED +  L++ YQ+ +G  + SHA   A    + D ++ R  EV
Sbjct:  158 AMTATEKILFLSSIIPFDCLLTVRALGGLLKFLGRRRIGVELEDYNVSVPILGFKKFMLTHLVNIDQDTYSVLQIFKSESHPSVYK--VASGLKEGLSLFGILNRCHCKWGEKLLRLWFTRPTHDLGELSSRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKVSDWQVLYKTVYSALGLRDACRSLPQSIQLFRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRFTVLPNIDPEIDEKKRRLMGLPSFLTEVARKELENLDSRIPSCSVIYIPLIGFLLSIPRLPSMVEASDFEINGLDFMFLSEEKLHYRSARTKELDALLGDLHCEIRDQETLLMYQLQCQVLARAAVLTRVLDLASRLDVLLALASAARDYGYSRPRYSPQVLGVRIQNGRHPLMELCARTFVPNSTECGGDKGRVKVITGPNSSGKSIYLKQVGLITFMALVGSFVPAEEAEIGAVDAIFTRIHSCESISLGLSTFMIDLNQVAKAVNNATAQSLVLIDEFGKGTNTVDGLALLAAVLRHWLARGPTCPHIFVATNFLSLVQLQLLPQGPLVQYLTMETCEDGN-DLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEV 774          
BLAST of mutS protein homolog 5 vs. Ensembl Human
Match: MSH5 (mutS homolog 5 [Source:HGNC Symbol;Acc:HGNC:7328])

HSP 1 Score: 388.267 bits (996), Expect = 1.062e-121
Identity = 234/620 (37.74%), Postives = 355/620 (57.26%), Query Frame = 3
Query:  447 SMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXX-XXPGMEYLFSMNNAVYYKNYTTKNL--------------ETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSG-EIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRL--FSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            +MT  EK +F+ SIIP +    VR+ GGLLKF+ ++R+GVELE     +P+L  + +     + ID+++   L IF   SHPS +K  V    KEGLS+F +LN CH K    +L  W  RP  D+  +  RLD + FF   QN D+ Q+L R L  + N+  IL RMK S   + DW VL +++   + + +   ++ + +++ + I  +F+D L+ IAS I K++D EG   + RF V   +DP +DEKK +   LP  L+ +A +EL+  ++ I  C ++Y+P +G+LL+IP   +  E     I G++++F     ++Y++  TK L              ET +M+ LQ  +L    +L   LDL   LD LL+LA AAR  G +RP +      ++I+NGRHPL E+ +  F+PNST      G++ +I+G N SGKS+YLKQ+G++  +A +GSFVPA +  +   +A+ TR+ S ES   GLSTFM+DLNQ++     A A S +LIDEFGKG     G++L+ A LR  +A+   CPHIFV T+F  L    L+   P VQ+      ED +  L++ YQ+ +G  + SHA   A    + D ++ R  EV
Sbjct:  158 AMTATEKILFLSSIIPFDCLLTVRALGGLLKFLGRRRIGVELEDYNVSVPILGFKKFMLTHLVNIDQDTYSVLQIFKSESHPSVYK--VASGLKEGLSLFGILNRCHCKWGEKLLRLWFTRPTHDLGELSSRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKVSDWQVLYKTVYSALGLRDACRSLPQSIQLFRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRFTVLPNIDPEIDEKKRRLMGLPSFLTEVARKELENLDSRIPSCSVIYIPLIGFLLSIPRLPSMVEASDFEINGLDFMFLSEEKLHYRSARTKELDALLGDLHCEIRDQETLLMYQLQCQVLARAAVLTRVLDLASRLDVLLALASAARDYGYSRPRYSPQVLGVRIQNGRHPLMELCARTFVPNSTECGGDKGRVKVITGPNSSGKSIYLKQVGLITFMALVGSFVPAEEAEIGAVDAIFTRIHSCESISLGLSTFMIDLNQVAKAVNNATAQSLVLIDEFGKGTNTVDGLALLAAVLRHWLARGPTCPHIFVATNFLSLVQLQLLPQGPLVQYLTMETCEDGN-DLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEV 774          
BLAST of mutS protein homolog 5 vs. Ensembl Human
Match: MSH5 (mutS homolog 5 [Source:HGNC Symbol;Acc:HGNC:7328])

HSP 1 Score: 388.267 bits (996), Expect = 1.062e-121
Identity = 234/620 (37.74%), Postives = 355/620 (57.26%), Query Frame = 3
Query:  447 SMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXX-XXPGMEYLFSMNNAVYYKNYTTKNL--------------ETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSG-EIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRL--FSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            +MT  EK +F+ SIIP +    VR+ GGLLKF+ ++R+GVELE     +P+L  + +     + ID+++   L IF   SHPS +K  V    KEGLS+F +LN CH K    +L  W  RP  D+  +  RLD + FF   QN D+ Q+L R L  + N+  IL RMK S   + DW VL +++   + + +   ++ + +++ + I  +F+D L+ IAS I K++D EG   + RF V   +DP +DEKK +   LP  L+ +A +EL+  ++ I  C ++Y+P +G+LL+IP   +  E     I G++++F     ++Y++  TK L              ET +M+ LQ  +L    +L   LDL   LD LL+LA AAR  G +RP +      ++I+NGRHPL E+ +  F+PNST      G++ +I+G N SGKS+YLKQ+G++  +A +GSFVPA +  +   +A+ TR+ S ES   GLSTFM+DLNQ++     A A S +LIDEFGKG     G++L+ A LR  +A+   CPHIFV T+F  L    L+   P VQ+      ED +  L++ YQ+ +G  + SHA   A    + D ++ R  EV
Sbjct:  158 AMTATEKILFLSSIIPFDCLLTVRALGGLLKFLGRRRIGVELEDYNVSVPILGFKKFMLTHLVNIDQDTYSVLQIFKSESHPSVYK--VASGLKEGLSLFGILNRCHCKWGEKLLRLWFTRPTHDLGELSSRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKVSDWQVLYKTVYSALGLRDACRSLPQSIQLFRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRFTVLPNIDPEIDEKKRRLMGLPSFLTEVARKELENLDSRIPSCSVIYIPLIGFLLSIPRLPSMVEASDFEINGLDFMFLSEEKLHYRSARTKELDALLGDLHCEIRDQETLLMYQLQCQVLARAAVLTRVLDLASRLDVLLALASAARDYGYSRPRYSPQVLGVRIQNGRHPLMELCARTFVPNSTECGGDKGRVKVITGPNSSGKSIYLKQVGLITFMALVGSFVPAEEAEIGAVDAIFTRIHSCESISLGLSTFMIDLNQVAKAVNNATAQSLVLIDEFGKGTNTVDGLALLAAVLRHWLARGPTCPHIFVATNFLSLVQLQLLPQGPLVQYLTMETCEDGN-DLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEV 774          
BLAST of mutS protein homolog 5 vs. Ensembl Celegans
Match: msh-5 (MutS protein homolog 5 [Source:UniProtKB/Swiss-Prot;Acc:Q19272])

HSP 1 Score: 253.832 bits (647), Expect = 1.770e-70
Identity = 182/624 (29.17%), Postives = 318/624 (50.96%), Query Frame = 3
Query:  447 SMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEE-----LKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXXXXPGMEYLFSMNNAVYYKNYTTKNLE--------------TSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQE-VFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSE-CPHIFVVTHFHRLFSLIQ-DLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            SMTE++K++ I      E+ NM+RS G LL F+++ R+GV  +      P+  ++ +T    + ID N+++ALDI  K +         KK   +G S++ L++ C S +    L  W R P TD   +  R  CV +F+   N +V   L   L  V  +  +  + ++ TA L  W   + ++  L+ I  I    + P+  +  +E+    ++  IA     II+    + Q R  V  G+D  LDE +  Y ++P +L+A+A++E     L  ++N       VY+P VG++L++P +     Q    P M  L+S +  +  +N TT  L+              T+I+  L+  +++    ++  L +   +D L+S  + A Q G   P       I+     HP+   V    F+PN   S     K +II+G N  GKSVY+K IGI++ L+ IGSFVPA    +   + ++TR+ +++S L G+STF  D+ Q++L  +KA  +S ++IDEFGKG   + G+SL+ + + + + + ++ CPHIF+ +HFH L + I  +     F  F V+ +   ++ YL+++  G ++CS A+  A+   +   ++ RA  +
Sbjct:  216 SMTEEDKYIIIKMRFDIEAVNMIRSFGALLLFLDETRMGVTDDPLSVTSPIKSIKTFTLGNLVEIDFNTIQALDILPKETE-------NKKTFGQGRSLYQLMDKCRSTVGKKCLRKWFRNPTTDRDDLVSRQKCVHYFKQDWNAEVTAKLSSILGRVKALNSVFQKFQSGTAQLIHWECFVSTVNALVEILNIIR--QTPISKEFPVESDLLREVSEIAVIAGSIINFAESKIQGRVTVMNGIDEELDEIRDTYENMPMVLTAIAKQEEARLGLPPYSN----VACVYIPLVGFVLSVPRDYGVESQ----PDMTLLYSTHEDLRVRNATTSRLDDEFGDILMRLIDSQTAIILTLKTRVMKKKRSIIKLLSIASRIDVLISFGLIAAQNGWNCPALVDEPVIEAVELYHPISVLVVKKSFVPNQVSSGRDGIKASIITGPNACGKSVYMKSIGIMVFLSHIGSFVPARHAKIGIVDRIVTRMFTVDSVLDGMSTFAKDVEQVALALRKATGNSLVIIDEFGKGTMTEVGLSLLASVMTYWMNRGADRCPHIFLSSHFHALPNYIPLETNIATFLTFTVLREAGGKIKYLFRMTPGLVDCSFALSVAKEEGIPPPVIGRACRI 822          
BLAST of mutS protein homolog 5 vs. Ensembl Celegans
Match: msh-5 (MutS protein homolog 5 [Source:UniProtKB/Swiss-Prot;Acc:Q19272])

HSP 1 Score: 157.147 bits (396), Expect = 3.586e-39
Identity = 116/382 (30.37%), Postives = 204/382 (53.40%), Query Frame = 3
Query: 1173 GVDPYLDEKKSKYYHLPDLLSALAEEE-----LKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXXXXPGMEYLFSMNNAVYYKNYTTKNLE--------------TSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQE-VFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSE-CPHIFVVTHFHRLFSLIQ-DLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            G+D  LDE +  Y ++P +L+A+A++E     L  ++N       VY+P VG++L++P +     Q    P M  L+S +  +  +N TT  L+              T+I+  L+  +++    ++  L +   +D L+S  + A Q G   P       I+     HP+   V    F+PN   S     K +II+G N  GKSVY+K IGI++ L+ IGSFVPA    +   + ++TR+ +++S L G+STF  D+ Q++L  +KA  +S ++IDEFGKG   + G+SL+ + + + + + ++ CPHIF+ +HFH L + I  +     F  F V+ +   ++ YL+++  G ++CS A+  A+   +   ++ RA  +
Sbjct:    3 GIDEELDEIRDTYENMPMVLTAIAKQEEARLGLPPYSN----VACVYIPLVGFVLSVPRDYGVESQ----PDMTLLYSTHEDLRVRNATTSRLDDEFGDILMRLIDSQTAIILTLKTRVMKKKRSIIKLLSIASRIDVLISFGLIAAQNGWNCPALVDEPVIEAVELYHPISVLVVKKSFVPNQVSSGRDGIKASIITGPNACGKSVYMKSIGIMVFLSHIGSFVPARHAKIGIVDRIVTRMFTVDSVLDGMSTFAKDVEQVALALRKATGNSLVIIDEFGKGTMTEVGLSLLASVMTYWMNRGADRCPHIFLSSHFHALPNYIPLETNIATFLTFTVLREAGGKIKYLFRMTPGLVDCSFALSVAKEEGIPPPVIGRACRI 376          
BLAST of mutS protein homolog 5 vs. Ensembl Celegans
Match: msh-2 (MSH (MutS Homolog) family [Source:UniProtKB/TrEMBL;Acc:Q9TXR4])

HSP 1 Score: 112.849 bits (281), Expect = 3.047e-25
Identity = 73/231 (31.60%), Postives = 130/231 (56.28%), Query Frame = 3
Query: 1569 TRP--LFETSGEIKIENGRHPLQEVFS-NPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            TRP  L   S  ++++  RHP+ E  S  PFIPN    +    +L I++GAN  GKS YL+   + I+LAQIGSFVP +  +++  + + TR+ + +    G+STFM ++   S   ++A  +S ++IDE G+G     G  +  A  + ++  + +C  IF  THFH +  L +    V  +    IE  ++++  LY++ +G  +CS  +Q A++V + +N++ +A ++
Sbjct:  592 TRPNLLPLGSKRLELKQCRHPVIEGNSEKPFIPNDVVLDKC--RLIILTGANMGGKSTYLRSAALSILLAQIGSFVPCSSATISVVDGIFTRVGASDKQSQGISTFMAEMLDCSAILQRATKNSFVVIDELGRGTSTFDGFGIASAIAQDIL-NRIQCLSIF-ATHFHEMGKLAEQPGAVALQMGVQIE--NNEIHMLYKVFEGVAQCSFGLQVAKMVGIDENVINKAAQL 816          
BLAST of mutS protein homolog 5 vs. Ensembl Celegans
Match: msh-6 (MSH (MutS Homolog) family [Source:UniProtKB/TrEMBL;Acc:Q9N3T8])

HSP 1 Score: 102.449 bits (254), Expect = 5.987e-22
Identity = 65/227 (28.63%), Postives = 111/227 (48.90%), Query Frame = 3
Query: 1605 IENGRHPLQEVFSN-------PFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVIEDKHS-------QLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRA 2243
            ++ G HP   + S         FI NST     +  + +++G N  GKS  ++Q  +L +LA IGS VPA  M LTP + + TR+ + +  + G STF ++L +  +  K A  HS +L+DE G+G     G ++  A L+  ++    C   F  TH+H +     + P V+  +   + DK +        + +LY+L  G    S+   AA+L  +   +++ A
Sbjct:  921 VDKGVHPCLALQSRNEVTQTTSFIANSTTMGASEAAVMLLTGPNMGGKSTLMRQTAVLAILAHIGSMVPAFSMRLTPIDRIFTRIGANDRIMCGESTFFIELKETDIMLKNATKHSLLLVDELGRGTSTFDGTAIASAVLQ-KISDDLAC-RTFFSTHYHSICDSFTNHPNVRLAHMKCVVDKENNEDPTMEDVTFLYELESGICPKSYGFYAAKLAGIDHQVVRNA 1145          
BLAST of mutS protein homolog 5 vs. Ensembl Celegans
Match: him-14 (MutS protein homolog him-14 [Source:UniProtKB/Swiss-Prot;Acc:Q23405])

HSP 1 Score: 73.559 bits (179), Expect = 3.992e-13
Identity = 51/164 (31.10%), Postives = 82/164 (50.00%), Query Frame = 3
Query: 1572 RPLFETSGEIKIENGRHP-LQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHF 2060
            +P F  S    I  GRHP L    S   I N T     D +  II+G N +GKS YLKQ   L ++AQIG F+PA   SL   N + +R+   +  +   S F  +++  +   + A+ +S +++DE  +    + GI++  A    ++  +S   + F+ THF
Sbjct:  545 KPTFGPS--FSISQGRHPILDWDDSEKTITNDTCLT-RDRRFGIITGPNMAGKSTYLKQTAQLAIMAQIGCFIPANYASLPIFNRIFSRMGHNDELIRNKSAFASEMSDAAAIVQYADKNSLVVLDELARSTSTEEGIAITYAICEKVLKLQS---YTFLATHF 702          
BLAST of mutS protein homolog 5 vs. Ensembl Fly
Match: spel1 (gene:FBgn0015546 transcript:FBtr0344018)

HSP 1 Score: 113.62 bits (283), Expect = 2.388e-25
Identity = 80/242 (33.06%), Postives = 133/242 (54.96%), Query Frame = 3
Query: 1542 AIAARQIGG--TRP--LFETSGEIKIENGRHPLQEVFSN-PFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            AIAAR       RP  L E + E+ +E+ RHP  E+  +  FI NS      +  + II+G N  GKS Y++ +G  +++A IG+FVP +  +++  +++L R+ + ++ + GLSTFMV++ + S   + A   S ++IDE G+G     G  +  +    + AK+++C  +F  THFH +  L + L  V+  +   + D       LYQ+  G +E S  IQ ARL N  ++++Q A EV
Sbjct:  607 AIAARSAPTPYVRPKMLEEGARELVLEDVRHPCLELQEHVNFIANSVDFKKEECNMFIITGPNMGGKSTYIRSVGTAVLMAHIGAFVPCSLATISMVDSILGRVGASDNIIKGLSTFMVEMIETSGIIRTATDKSLVIIDELGRGTSTYEGCGIAWSIAEHL-AKETKCFTLF-ATHFHEITKLAETLSTVKNCHMAAVADA-DDFTLLYQVRSGVMEKSFGIQVARLANFPEHVVQNAQEV 845          
BLAST of mutS protein homolog 5 vs. Ensembl Fly
Match: spel1 (gene:FBgn0015546 transcript:FBtr0344019)

HSP 1 Score: 113.62 bits (283), Expect = 2.388e-25
Identity = 80/242 (33.06%), Postives = 133/242 (54.96%), Query Frame = 3
Query: 1542 AIAARQIGG--TRP--LFETSGEIKIENGRHPLQEVFSN-PFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            AIAAR       RP  L E + E+ +E+ RHP  E+  +  FI NS      +  + II+G N  GKS Y++ +G  +++A IG+FVP +  +++  +++L R+ + ++ + GLSTFMV++ + S   + A   S ++IDE G+G     G  +  +    + AK+++C  +F  THFH +  L + L  V+  +   + D       LYQ+  G +E S  IQ ARL N  ++++Q A EV
Sbjct:  607 AIAARSAPTPYVRPKMLEEGARELVLEDVRHPCLELQEHVNFIANSVDFKKEECNMFIITGPNMGGKSTYIRSVGTAVLMAHIGAFVPCSLATISMVDSILGRVGASDNIIKGLSTFMVEMIETSGIIRTATDKSLVIIDELGRGTSTYEGCGIAWSIAEHL-AKETKCFTLF-ATHFHEITKLAETLSTVKNCHMAAVADA-DDFTLLYQVRSGVMEKSFGIQVARLANFPEHVVQNAQEV 845          
BLAST of mutS protein homolog 5 vs. Ensembl Fly
Match: spel1 (gene:FBgn0015546 transcript:FBtr0080630)

HSP 1 Score: 113.62 bits (283), Expect = 2.388e-25
Identity = 80/242 (33.06%), Postives = 133/242 (54.96%), Query Frame = 3
Query: 1542 AIAARQIGG--TRP--LFETSGEIKIENGRHPLQEVFSN-PFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            AIAAR       RP  L E + E+ +E+ RHP  E+  +  FI NS      +  + II+G N  GKS Y++ +G  +++A IG+FVP +  +++  +++L R+ + ++ + GLSTFMV++ + S   + A   S ++IDE G+G     G  +  +    + AK+++C  +F  THFH +  L + L  V+  +   + D       LYQ+  G +E S  IQ ARL N  ++++Q A EV
Sbjct:  607 AIAARSAPTPYVRPKMLEEGARELVLEDVRHPCLELQEHVNFIANSVDFKKEECNMFIITGPNMGGKSTYIRSVGTAVLMAHIGAFVPCSLATISMVDSILGRVGASDNIIKGLSTFMVEMIETSGIIRTATDKSLVIIDELGRGTSTYEGCGIAWSIAEHL-AKETKCFTLF-ATHFHEITKLAETLSTVKNCHMAAVADA-DDFTLLYQVRSGVMEKSFGIQVARLANFPEHVVQNAQEV 845          
BLAST of mutS protein homolog 5 vs. Ensembl Fly
Match: spel1 (gene:FBgn0015546 transcript:FBtr0309281)

HSP 1 Score: 113.62 bits (283), Expect = 2.388e-25
Identity = 80/242 (33.06%), Postives = 133/242 (54.96%), Query Frame = 3
Query: 1542 AIAARQIGG--TRP--LFETSGEIKIENGRHPLQEVFSN-PFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            AIAAR       RP  L E + E+ +E+ RHP  E+  +  FI NS      +  + II+G N  GKS Y++ +G  +++A IG+FVP +  +++  +++L R+ + ++ + GLSTFMV++ + S   + A   S ++IDE G+G     G  +  +    + AK+++C  +F  THFH +  L + L  V+  +   + D       LYQ+  G +E S  IQ ARL N  ++++Q A EV
Sbjct:  607 AIAARSAPTPYVRPKMLEEGARELVLEDVRHPCLELQEHVNFIANSVDFKKEECNMFIITGPNMGGKSTYIRSVGTAVLMAHIGAFVPCSLATISMVDSILGRVGASDNIIKGLSTFMVEMIETSGIIRTATDKSLVIIDELGRGTSTYEGCGIAWSIAEHL-AKETKCFTLF-ATHFHEITKLAETLSTVKNCHMAAVADA-DDFTLLYQVRSGVMEKSFGIQVARLANFPEHVVQNAQEV 845          
BLAST of mutS protein homolog 5 vs. Ensembl Fly
Match: Msh6 (gene:FBgn0036486 transcript:FBtr0075646)

HSP 1 Score: 107.457 bits (267), Expect = 2.441e-23
Identity = 66/226 (29.20%), Postives = 119/226 (52.65%), Query Frame = 3
Query: 1599 IKIENGRHPLQEVFSNPFIPNS-TYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQF-------KNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            I++E G HP     +  +IPN        +  L++++G N  GKS  ++++G+L+++AQIG+ +PA    L+  + + TRL + +  L+G STF+V+LN+ SL  K A  HS +L+DE G+G     G ++  + + F+   K  C  +F  TH+H L     +  ++         +N +  +     + +LY+   G    S+   AA+L  +   I++RA E+
Sbjct:  923 IQLEEGYHPCANAST--YIPNGLELGTASEAPLSLLTGPNMGGKSTLMREVGLLVIMAQIGAHIPAASCRLSLVDRIFTRLGAQDDILAGHSTFLVELNETSLILKHATCHSLVLLDELGRGTATYDGTAIAASVVNFLANLK--CRTLF-STHYHNLIDFFHNDKRITLGHMACMVENEDNADPTQETVTFLYKYTAGACPKSYGFNAAKLAGMPQGIIKRAYEL 1143          
BLAST of mutS protein homolog 5 vs. Ensembl Zebrafish
Match: msh5 (mutS homolog 5 [Source:ZFIN;Acc:ZDB-GENE-131127-632])

HSP 1 Score: 343.969 bits (881), Expect = 1.221e-105
Identity = 216/668 (32.34%), Postives = 370/668 (55.39%), Query Frame = 3
Query:  402 MSLRKIFELNLPS-SVSMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTX-XXXXXXXXXXXXXPGMEYLFSM----------------------NNAVYYKNYTTKNLETSI--MHC-----------------------LQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRL--FSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            +S +++   +LP  S ++TE EK ++I S IP +S  MVRS GGLLK +EK+R+G ELE     IP+L    YT    +++D ++  AL IF    HPS  K  ++   KEGLS++ +LN C SK  S +L  WL RP  D++++ +R + + FF + +N   L  L   L+ + NI  +L +M      +  W  L +++   + I +   ++ + +++ ++I   FTD L+ IA++I+K++D EG   + RF V+  VDP +DEKK +   LPD L+ +A  EL+  +     C ++Y+P +G+LLT+  + +  ++Q   I G++++ SM                       + ++Y++  TK L++ +  +HC                       LQ S+L+ +  +   + L  ELDCL++LA A+R+ G   P+  T   + +   RHPL E+ ++ F+ N+  S++ +GK+ +I+G N SGKS++LKQ+G+++ +A IGS VPA +  +   + + TR+ S ES   GLSTFM+D+NQ++     +  +S +L+DEFGKG     G+SL+V+ L   + +  +CPH+ + T FH L    LI D   +         +   +L++LYQ+ +G  + S A   A L  + D++++R +EV
Sbjct:   65 VSKQRLISAHLPLLSSTITESEKILYISSCIPLDSGLMVRSIGGLLKCVEKRRIGSELEDNDVGIPILQFLTYTLQDVVYVDRDTYSALQIFKSELHPSVLK--LQSGVKEGLSLYGILNQCRSKYGSLLLRQWLHRPTRDLNILNRRQEVIRFFTSPRNFADLCTLQSCLRSIKNISMLLHKMSLCNPKVAVWQSLYKTVYSAVCIRDTIRSLPQSIQLFREISENFTDDLFYIATYISKVVDFEGSISENRFTVRPNVDPVIDEKKRRMMGLPDFLTDVARAELENLDPRFSTCSVIYMPLIGFLLTVPRLPSMLDKQSFEIAGLDFIVSMPESLVWLKHIFEFVCGLFQFLSKDQLHYRSTRTKELDSMLGDLHCDILGLSFLHAFLFAYLEMAVMRKLQASVLQRSDCMYKVMSLCAELDCLIALAQASREHGYCCPILTTEHRLALIESRHPLLELCTSVFVSNTYISSETEGKVKVITGPNSSGKSIFLKQVGLIVFMALIGSNVPAKEAEIGLVDGIFTRMHSRESISVGLSTFMIDVNQMAHSLNHSTENSLVLVDEFGKGTNTVDGLSLLVSCLSHWLRRGLQCPHLLMSTCFHSLIQLGLIPDSSLLALLTLETAIEG-DELVFLYQVKNGICQSSCAANIATLAGIPDDLVRRGVEV 729          
BLAST of mutS protein homolog 5 vs. Ensembl Zebrafish
Match: msh5 (mutS homolog 5 [Source:ZFIN;Acc:ZDB-GENE-131127-632])

HSP 1 Score: 265.774 bits (678), Expect = 1.114e-78
Identity = 160/503 (31.81%), Postives = 289/503 (57.46%), Query Frame = 3
Query:  795 SWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXX-XXPGMEYLFSMNNAVYYKNYTTK--------------NLETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRL--FSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            +WL RP  D++++ +R + + FF + +N   L  L   L+ + NI  +L +M      +  W  L +++   + I +   ++ + +++ ++I   FTD L+ IA++I+K++D EG   + RF V+  VDP +DEKK +   LPD L+ +A  EL+  +     C ++Y+P +G+LLT+P   +  +++   I G++++F   + ++Y++  TK              +LE ++M  LQ S+L+ +  +   + L  ELDCL++LA A+R+ G   P+  T   + +   RHPL E+ ++ F+ N+  S++ +GK+ +I+G N SGKS++LKQ+G+++ +A IGS VPA +  +   + + TR+ S ES   GLSTFM+D+NQ++     +  +S +L+DEFGKG     G+SL+V+ L   + +  +CPH+ + T FH L    LI D   +         +   +L++LYQ+ +G  + S A   A L  + D++++R +EV
Sbjct:   11 TWLHRPTRDLNILNRRQEVIRFFTSPRNFADLCTLQSCLRSIKNISMLLHKMSLCNPKVAVWQSLYKTVYSAVCIRDTIRSLPQSIQLFREISENFTDDLFYIATYISKVVDFEGSISENRFTVRPNVDPVIDEKKRRMMGLPDFLTDVARAELENLDPRFSTCSVIYMPLIGFLLTVPRLPSMLDKQSFEIAGLDFIFLSKDQLHYRSTRTKELDSMLGDLHCDILDLEMAVMRKLQASVLQRSDCMYKVMSLCAELDCLIALAQASREHGYCCPILTTEHRLALIESRHPLLELCTSVFVSNTYISSETEGKVKVITGPNSSGKSIFLKQVGLIVFMALIGSNVPAKEAEIGLVDGIFTRMHSRESISVGLSTFMIDVNQMAHSLNHSTENSLVLVDEFGKGTNTVDGLSLLVSCLSHWLRRGLQCPHLLMSTCFHSLIQLGLIPDSSLLALLTLETAIEG-DELVFLYQVKNGICQSSCAANIATLAGIPDDLVRRGVEV 512          
BLAST of mutS protein homolog 5 vs. Ensembl Zebrafish
Match: msh5 (mutS homolog 5 [Source:ZFIN;Acc:ZDB-GENE-131127-632])

HSP 1 Score: 238.81 bits (608), Expect = 3.367e-69
Identity = 144/442 (32.58%), Postives = 258/442 (58.37%), Query Frame = 3
Query:  978 WNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXX-XXPGMEYLFSMNNAVYYKNYTTK--------------NLETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRL--FSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            W  L +++   + I +   ++ + +++ ++I   FTD L+ IA++I+K++D EG   + RF V+  VDP +DEKK +   LPD L+ +A  EL+  +     C ++Y+P +G+LLT+P   +  +++   I G++++F   + ++Y++  TK              +LE ++M  LQ S+L+ +  +   + L  ELDCL++LA A+R+ G   P+  T   + +   RHPL E+ ++ F+ N+  S++ +GK+ +I+G N SGKS++LKQ+G+++ +A IGS VPA +  +   + + TR+ S ES   GLSTFM+D+NQ++     +  +S +L+DEFGKG     G+SL+V+ L   + +  +CPH+ + T FH L    LI D   +         +   +L++LYQ+ +G  + S A   A L  + D++++R +EV
Sbjct:   16 WQSLYKTVYSAVCIRDTIRSLPQSIQLFREISENFTDDLFYIATYISKVVDFEGSISENRFTVRPNVDPVIDEKKRRMMGLPDFLTDVARAELENLDPRFSTCSVIYMPLIGFLLTVPRLPSMLDKQSFEIAGLDFIFLSKDQLHYRSTRTKELDSMLGDLHCDILDLEMAVMRKLQASVLQRSDCMYKVMSLCAELDCLIALAQASREHGYCCPILTTEHRLALIESRHPLLELCTSVFVSNTYISSETEGKVKVITGPNSSGKSIFLKQVGLIVFMALIGSNVPAKEAEIGLVDGIFTRMHSRESISVGLSTFMIDVNQMAHSLNHSTENSLVLVDEFGKGTNTVDGLSLLVSCLSHWLRRGLQCPHLLMSTCFHSLIQLGLIPDSSLLALLTLETAIEG-DELVFLYQVKNGICQSSCAANIATLAGIPDDLVRRGVEV 456          
BLAST of mutS protein homolog 5 vs. Ensembl Zebrafish
Match: msh4 (mutS homolog 4 [Source:ZFIN;Acc:ZDB-GENE-131121-643])

HSP 1 Score: 110.923 bits (276), Expect = 1.748e-24
Identity = 75/234 (32.05%), Postives = 123/234 (52.56%), Query Frame = 3
Query: 1572 RPLFETSGEIKIENGRHP-LQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKV-----QFKNFNVIEDKHSQLIYLYQLVDGHI-ECSHAIQAARLVNVSDNILQRAIEV 2252
            RP F  +  + I+ GRHP L+ +     I N++Y ++      II+G N SGKS +LKQ+ ++ ++AQIG FVPA   S+   + + TR+   +   +  STFMV++ ++S     A   S I+IDE G+G   + GI +  +   F++  K+        THF  L  L    P V     Q ++    + +  +++Y YQL  GH  E ++ I+AA + N+  +I+Q A  V
Sbjct:  523 RPEF--TDTLAIQQGRHPVLERISGQQPISNNSYISEG-SNFVIITGPNMSGKSTFLKQVALVQIMAQIGCFVPAEYASVRIADQIFTRIGVDDDFETNSSTFMVEMKEVSYIIHNATNSSLIIIDELGRGTSPEEGIGICHSVCEFLINLKA---FTLFATHFLELCQLQTLYPNVENQHMQVQHIRTGDGRAERVVYTYQLSRGHSEERNYGIRAAEMTNLPLDIIQEAKTV 750          
BLAST of mutS protein homolog 5 vs. Ensembl Zebrafish
Match: msh4 (mutS homolog 4 [Source:ZFIN;Acc:ZDB-GENE-131121-643])

HSP 1 Score: 110.923 bits (276), Expect = 1.875e-24
Identity = 75/234 (32.05%), Postives = 123/234 (52.56%), Query Frame = 3
Query: 1572 RPLFETSGEIKIENGRHP-LQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKV-----QFKNFNVIEDKHSQLIYLYQLVDGHI-ECSHAIQAARLVNVSDNILQRAIEV 2252
            RP F  +  + I+ GRHP L+ +     I N++Y ++      II+G N SGKS +LKQ+ ++ ++AQIG FVPA   S+   + + TR+   +   +  STFMV++ ++S     A   S I+IDE G+G   + GI +  +   F++  K+        THF  L  L    P V     Q ++    + +  +++Y YQL  GH  E ++ I+AA + N+  +I+Q A  V
Sbjct:  629 RPEF--TDTLAIQQGRHPVLERISGQQPISNNSYISEG-SNFVIITGPNMSGKSTFLKQVALVQIMAQIGCFVPAEYASVRIADQIFTRIGVDDDFETNSSTFMVEMKEVSYIIHNATNSSLIIIDELGRGTSPEEGIGICHSVCEFLINLKA---FTLFATHFLELCQLQTLYPNVENQHMQVQHIRTGDGRAERVVYTYQLSRGHSEERNYGIRAAEMTNLPLDIIQEAKTV 856          
BLAST of mutS protein homolog 5 vs. Ensembl Xenopus
Match: cgrrf1 (cell growth regulator with ring finger domain 1 [Source:Xenbase;Acc:XB-GENE-1004756])

HSP 1 Score: 379.407 bits (973), Expect = 3.772e-119
Identity = 234/647 (36.17%), Postives = 361/647 (55.80%), Query Frame = 3
Query:  372 FVTHHDISYNMSLRKIFELNLPSSVS-MTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXX-XXXPGMEYLFSMNNAVYYKNYTTKNL--------------ETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSL--IQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEVRI 2258
            F++H  +   +  R+I   N P+  S  TE EK +++ SIIP +   M+ + GGLLKF+E++R+GV+LE     +P+L ++ Y            +  L IF    HPS +K  +    KEGLS++ LLN C +K   + L  WL RP T+   +  RLD ++FF   QNQ +++     LK + NI  IL RM  S   + DW  L +++   I I +    + + + +   I + F+++L  I + I K++D E   K + F +K  VDP +DEKK +   LP  L+ +A++EL+  ++ I  C I+Y+P +G+LL+        ++    I G+E++F +   +YY+   T+ L              ET IM+ LQ   LE + +     +   +LD LL++A+ AR+ G TRP +     I I+ GRHPL    S  F+PNST S   + ++ II+G N  GKSVYLKQ+G+++ ++ IGSFVPA +  + P + + TR++SLES   GLSTFM+DLNQ++     A   S +LIDEFGKG     G+SL+ A LR  +    +CPHIFV T+FH L  L  + D P +QF+      D   ++++ YQ+ DG  E S A + A L  +   I++RAIEVR+
Sbjct:   73 FLSHPGL--QICKRRILSWNFPTLPSNFTESEKILYLSSIIPFDCPKMICTLGGLLKFLERRRIGVQLEDCSVGVPILSLKKYVLY---------VIVLQIFKSEVHPSVYK--LTSGVKEGLSLYGLLNRCCTKQGENTLRMWLMRPTTNQCQLGSRLDVIEFFIAPQNQQIVENFQSSLKSIKNIPLILKRMTLSNTKVTDWLALHKAVCSAIYIGDTCRTLPQNVFLFSTISSAFSNELLYIKNLIGKVVDFEESVKGRCFCIKPFVDPAVDEKKRQLRGLPSFLTDVAKKELETLDSHIPSCYIIYIPLIGFLLSFQRLPFMEDKNDFKIAGLEFMFLLQGRLYYRTVRTRELDSLFGDLHCEIRDQETVIMYQLQTLTLEKSAVFQYVTEFTGQLDALLAMAVIARENGYTRPRYTMGNSIYIKEGRHPLMVFCSGTFVPNSTLSKQNEKRIKIITGPNSCGKSVYLKQVGLIVFMSMIGSFVPAAEAEIGPVDGIFTRIQSLESVSLGLSTFMIDLNQVARAVNNATEKSLVLIDEFGKGTNTVDGLSLLAAVLRHWINMGCQCPHIFVATNFHSLVKLKILPDSPILQFQTLEWCLDGE-EIVFFYQIKDGVSEASQAAKVAALAGLPAGIIKRAIEVRL 705          
BLAST of mutS protein homolog 5 vs. Ensembl Xenopus
Match: cgrrf1 (cell growth regulator with ring finger domain 1 [Source:Xenbase;Acc:XB-GENE-1004756])

HSP 1 Score: 379.022 bits (972), Expect = 1.310e-118
Identity = 232/634 (36.59%), Postives = 355/634 (55.99%), Query Frame = 3
Query:  411 RKIFELNLPSSVS-MTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXX-XXXPGMEYLFSMNNAVYYKNYTTKNL--------------ETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSL--IQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEVRI 2258
            R+I   N P+  S  TE EK +++ SIIP +   M+ + GGLLKF+E++R+GV+LE     +P+L ++ Y            +  L IF    HPS +K  +    KEGLS++ LLN C +K   + L  WL RP T+   +  RLD ++FF   QNQ +++     LK + NI  IL RM  S   + DW  L +++   I I +    + + + +   I + F+++L  I + I K++D E   K + F +K  VDP +DEKK +   LP  L+ +A++EL+  ++ I  C I+Y+P +G+LL+        ++    I G+E++F +   +YY+   T+ L              ET IM+ LQ   LE + +     +   +LD LL++A+ AR+ G TRP +     I I+ GRHPL    S  F+PNST S   + ++ II+G N  GKSVYLKQ+G+++ ++ IGSFVPA +  + P + + TR++SLES   GLSTFM+DLNQ++     A   S +LIDEFGKG     G+SL+ A LR  +    +CPHIFV T+FH L  L  + D P +QF+      D   ++++ YQ+ DG  E S A + A L  +   I++RAIEVR+
Sbjct:  116 RRILSWNFPTLPSNFTESEKILYLSSIIPFDCPKMICTLGGLLKFLERRRIGVQLEDCSVGVPILSLKKYVLY---------VIVLQIFKSEVHPSVYK--LTSGVKEGLSLYGLLNRCCTKQGENTLRMWLMRPTTNQCQLGSRLDVIEFFIAPQNQQIVENFQSSLKSIKNIPLILKRMTLSNTKVTDWLALHKAVCSAIYIGDTCRTLPQNVFLFSTISSAFSNELLYIKNLIGKVVDFEESVKGRCFCIKPFVDPAVDEKKRQLRGLPSFLTDVAKKELETLDSHIPSCYIIYIPLIGFLLSFQRLPFMEDKNDFKIAGLEFMFLLQGRLYYRTVRTRELDSLFGDLHCEIRDQETVIMYQLQTLTLEKSAVFQYVTEFTGQLDALLAMAVIARENGYTRPRYTMGNSIYIKEGRHPLMVFCSGTFVPNSTLSKQNEKRIKIITGPNSCGKSVYLKQVGLIVFMSMIGSFVPAAEAEIGPVDGIFTRIQSLESVSLGLSTFMIDLNQVARAVNNATEKSLVLIDEFGKGTNTVDGLSLLAAVLRHWINMGCQCPHIFVATNFHSLVKLKILPDSPILQFQTLEWCLDGE-EIVFFYQIKDGVSEASQAAKVAALAGLPAGIIKRAIEVRL 737          
BLAST of mutS protein homolog 5 vs. Ensembl Xenopus
Match: cgrrf1 (cell growth regulator with ring finger domain 1 [Source:Xenbase;Acc:XB-GENE-1004756])

HSP 1 Score: 315.079 bits (806), Expect = 6.120e-95
Identity = 214/634 (33.75%), Postives = 333/634 (52.52%), Query Frame = 3
Query:  411 RKIFELNLPSSVS-MTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXX-XXXPGMEYLFSMNNAVYYKNYTTKNL--------------ETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSL--IQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEVRI 2258
            R+I   N P+  S  TE EK +++ SIIP +   M+ + GGLLKF+E++R+GV+LE     +P+L ++ Y            +  L IF    HPS +K  +    KEGLS++  L +  + + S                   RLD ++FF   QNQ +++     LK + NI  IL RM  S   + DW  L +++   I I +    + + + +   I + F+++L  I + I K++            V E         K +   LP  L+ +A++EL+  ++ I  C I+Y+P +G+LL+        ++    I G+E++F +   +YY+   T+ L              ET IM+ LQ   LE + +     +   +LD LL++A+ AR+ G TRP +     I I+ GRHPL    S  F+PNST S   + ++ II+G N  GKSVYLKQ+G+++ ++ IGSFVPA +  + P + + TR++SLES   GLSTFM+DLNQ++     A   S +LIDEFGKG     G+SL+ A LR  +    +CPHIFV T+FH L  L  + D P +QF+      D   ++++ YQ+ DG  E S A + A L  +   I++RAIEVR+
Sbjct:  100 RRILSWNFPTLPSNFTESEKILYLSSIIPFDCPKMICTLGGLLKFLERRRIGVQLEDCSVGVPILSLKKYVLY---------VIVLQIFKSEVHPSVYK--LTSGVKEGLSLYGNLCSPSTYLGS-------------------RLDVIEFFIAPQNQQIVENFQSSLKSIKNIPLILKRMTLSNTKVTDWLALHKAVCSAIYIGDTCRTLPQNVFLFSTISSAFSNELLYIKNLIGKVVCLSASFAILSTCVTE---------KRQLRGLPSFLTDVAKKELETLDSHIPSCYIIYIPLIGFLLSFQRLPFMEDKNDFKIAGLEFMFLLQGRLYYRTVRTRELDSLFGDLHCEIRDQETVIMYQLQTLTLEKSAVFQYVTEFTGQLDALLAMAVIARENGYTRPRYTMGNSIYIKEGRHPLMVFCSGTFVPNSTLSKQNEKRIKIITGPNSCGKSVYLKQVGLIVFMSMIGSFVPAAEAEIGPVDGIFTRIQSLESVSLGLSTFMIDLNQVARAVNNATEKSLVLIDEFGKGTNTVDGLSLLAAVLRHWINMGCQCPHIFVATNFHSLVKLKILPDSPILQFQTLEWCLDGE-EIVFFYQIKDGVSEASQAAKVAALAGLPAGIIKRAIEVRL 693          
BLAST of mutS protein homolog 5 vs. Ensembl Xenopus
Match: MSH3 (mutS homolog 3 [Source:NCBI gene;Acc:100486354])

HSP 1 Score: 112.079 bits (279), Expect = 1.012e-24
Identity = 78/252 (30.95%), Postives = 133/252 (52.78%), Query Frame = 3
Query: 1542 AIAARQIGGTRPLFETSG-EIKIENGRHPLQEVF---SNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVI------EDKHS--------QLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRA 2243
            A  A+Q G  RP    SG EI I+NGRHP+ ++     + F+PNST       ++ II+G N  GKS Y+KQ+ ++ ++AQIGS+VPA  +++   + + TR+ + ++   G STFM +L   +   K A   S +++DE G+G     GI++  + L +++  KS       VTH+  L  L +   + Q  N+++       ED  S         + +LYQ+  G    S+ +  A+L ++  +++ RA
Sbjct:  548 AEVAKQDGYCRPAVHDSGSEIIIKNGRHPVIDLLLEEQSQFVPNSTSLMADKERVMIITGPNMGGKSSYIKQVALITIMAQIGSYVPAEAVTVGIVDGIFTRMGAADNIYKGRSTFMDELLDTAEILKNATPRSLVILDELGRGTSTHDGIAIAYSTLEYII--KSVTSLTLFVTHYPSLCELEKAYAE-QVGNYHMAFFVDEEEDTDSAESLQQPQHVTFLYQITQGIAARSYGLNVAKLADIPHSVVTRA 796          
BLAST of mutS protein homolog 5 vs. Ensembl Xenopus
Match: MSH3 (mutS homolog 3 [Source:NCBI gene;Acc:100486354])

HSP 1 Score: 112.079 bits (279), Expect = 1.069e-24
Identity = 78/252 (30.95%), Postives = 133/252 (52.78%), Query Frame = 3
Query: 1542 AIAARQIGGTRPLFETSG-EIKIENGRHPLQEVF---SNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVI------EDKHS--------QLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRA 2243
            A  A+Q G  RP    SG EI I+NGRHP+ ++     + F+PNST       ++ II+G N  GKS Y+KQ+ ++ ++AQIGS+VPA  +++   + + TR+ + ++   G STFM +L   +   K A   S +++DE G+G     GI++  + L +++  KS       VTH+  L  L +   + Q  N+++       ED  S         + +LYQ+  G    S+ +  A+L ++  +++ RA
Sbjct:  544 AEVAKQDGYCRPAVHDSGSEIIIKNGRHPVIDLLLEEQSQFVPNSTSLMADKERVMIITGPNMGGKSSYIKQVALITIMAQIGSYVPAEAVTVGIVDGIFTRMGAADNIYKGRSTFMDELLDTAEILKNATPRSLVILDELGRGTSTHDGIAIAYSTLEYII--KSVTSLTLFVTHYPSLCELEKAYAE-QVGNYHMAFFVDEEEDTDSAESLQQPQHVTFLYQITQGIAARSYGLNVAKLADIPHSVVTRA 792          
BLAST of mutS protein homolog 5 vs. Ensembl Mouse
Match: Msh5 (mutS homolog 5 [Source:MGI Symbol;Acc:MGI:1329021])

HSP 1 Score: 380.178 bits (975), Expect = 7.756e-119
Identity = 233/622 (37.46%), Postives = 350/622 (56.27%), Query Frame = 3
Query:  441 SVSMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXX-XXPGMEYLFSMNNAVYYKNYTTKNLETSI--MHC------------LQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETS-GEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRL--FSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            S SMT  EK +F+ SIIP +    VR+ GGLLKF+ ++R+GVELE     +P+L  + +     + ID+++   L IF   SHPS +K  V    KEGLS+F +LN C  K    +L  W  RP  ++  +  RLD + FF   QN D+ Q+L R L  + N+  IL RMK S   + DW VL +++   + + +   ++ + +++ Q I  +F+D L+ IAS I K++D E    + RF V   +DP +D KK +   LP  L+ +A++EL+  ++ I  C ++Y+P +G+LL+IP      E     I G++++F   + ++Y++  TK L+T +  +HC            LQ  +L    +L   LDL   LD LL+LA AAR  G +RP +      ++I NGRHPL E+ +  F+PNST      G++ +I+G N SGKS+YLKQ+G++  +A +GSFVPA +  +   +A+ TR+ S ES   GLSTFM+DLNQ++     A  HS +LIDEFGKG     G++L+ A LR  +A    CPH+FV T+F  L    L+   P VQ+      ED    L++ YQL  G    SHA   A    + D ++ R  EV
Sbjct:  155 SDSMTATEKILFLSSIIPFDCVLTVRALGGLLKFLSRRRIGVELEDYDVGVPILGFKKFVLTHLVSIDQDTYSVLQIFKSESHPSVYK--VASGLKEGLSLFGILNRCRCKWGQKLLRLWFTRPTRELRELNSRLDVIQFFLMPQNLDMAQMLHRLLSHIKNVPLILKRMKLSHTKVSDWQVLYKTVYSALGLRDACRSLPQSIQLFQDIAQEFSDDLHHIASLIGKVVDFEESLAENRFTVLPNIDPDIDAKKRRLIGLPSFLTEVAQKELENLDSRIPSCSVIYIPLIGFLLSIPRLPFMVEASDFEIEGLDFMFLSEDKLHYRSARTKELDTLLGDLHCEIRDQETLLMYQLQCQVLARASVLTRVLDLASRLDVLLALASAARDYGYSRPHYSPCIHGVRIRNGRHPLMELCARTFVPNSTDCGGDQGRVKVITGPNSSGKSIYLKQVGLITFMALVGSFVPAEEAEIGVIDAIFTRIHSCESISLGLSTFMIDLNQVAKAVNNATEHSLVLIDEFGKGTNSVDGLALLAAVLRHWLALGPSCPHVFVATNFLSLVQLQLLPQGPLVQYLTMETCEDGE-DLVFFYQLCQGVASASHASHTAAQAGLPDPLIARGKEV 773          
BLAST of mutS protein homolog 5 vs. Ensembl Mouse
Match: Msh5 (mutS homolog 5 [Source:MGI Symbol;Acc:MGI:1329021])

HSP 1 Score: 380.178 bits (975), Expect = 7.756e-119
Identity = 233/622 (37.46%), Postives = 350/622 (56.27%), Query Frame = 3
Query:  441 SVSMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXX-XXPGMEYLFSMNNAVYYKNYTTKNLETSI--MHC------------LQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETS-GEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRL--FSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            S SMT  EK +F+ SIIP +    VR+ GGLLKF+ ++R+GVELE     +P+L  + +     + ID+++   L IF   SHPS +K  V    KEGLS+F +LN C  K    +L  W  RP  ++  +  RLD + FF   QN D+ Q+L R L  + N+  IL RMK S   + DW VL +++   + + +   ++ + +++ Q I  +F+D L+ IAS I K++D E    + RF V   +DP +D KK +   LP  L+ +A++EL+  ++ I  C ++Y+P +G+LL+IP      E     I G++++F   + ++Y++  TK L+T +  +HC            LQ  +L    +L   LDL   LD LL+LA AAR  G +RP +      ++I NGRHPL E+ +  F+PNST      G++ +I+G N SGKS+YLKQ+G++  +A +GSFVPA +  +   +A+ TR+ S ES   GLSTFM+DLNQ++     A  HS +LIDEFGKG     G++L+ A LR  +A    CPH+FV T+F  L    L+   P VQ+      ED    L++ YQL  G    SHA   A    + D ++ R  EV
Sbjct:  155 SDSMTATEKILFLSSIIPFDCVLTVRALGGLLKFLSRRRIGVELEDYDVGVPILGFKKFVLTHLVSIDQDTYSVLQIFKSESHPSVYK--VASGLKEGLSLFGILNRCRCKWGQKLLRLWFTRPTRELRELNSRLDVIQFFLMPQNLDMAQMLHRLLSHIKNVPLILKRMKLSHTKVSDWQVLYKTVYSALGLRDACRSLPQSIQLFQDIAQEFSDDLHHIASLIGKVVDFEESLAENRFTVLPNIDPDIDAKKRRLIGLPSFLTEVAQKELENLDSRIPSCSVIYIPLIGFLLSIPRLPFMVEASDFEIEGLDFMFLSEDKLHYRSARTKELDTLLGDLHCEIRDQETLLMYQLQCQVLARASVLTRVLDLASRLDVLLALASAARDYGYSRPHYSPCIHGVRIRNGRHPLMELCARTFVPNSTDCGGDQGRVKVITGPNSSGKSIYLKQVGLITFMALVGSFVPAEEAEIGVIDAIFTRIHSCESISLGLSTFMIDLNQVAKAVNNATEHSLVLIDEFGKGTNSVDGLALLAAVLRHWLALGPSCPHVFVATNFLSLVQLQLLPQGPLVQYLTMETCEDGE-DLVFFYQLCQGVASASHASHTAAQAGLPDPLIARGKEV 773          
BLAST of mutS protein homolog 5 vs. Ensembl Mouse
Match: Msh5 (mutS homolog 5 [Source:MGI Symbol;Acc:MGI:1329021])

HSP 1 Score: 271.166 bits (692), Expect = 4.534e-80
Identity = 165/454 (36.34%), Postives = 256/454 (56.39%), Query Frame = 3
Query:  441 SVSMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXX-XXXXXXXXXPGMEYLFSMNNAVYYKNYTTKNLETSI--MHC------------LQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETS-GEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGI 1754
            S SMT  EK +F+ SIIP +    VR+ GGLLKF+ ++R+GVELE     +P+L  + +     + ID+++   L IF   SHPS +K  V    KEGLS+F +LN C  K    +L  W  RP  ++  +  RLD + FF   QN D+ Q+L R L  + N+  IL RMK S   + DW VL +++   + + +   ++ + +++ Q I  +F+D L+ IAS I K++D E    + RF V   +DP +D KK +   LP  L+ +A++EL+  ++ I  C ++Y+P +G+LL+IP            I G++++F   + ++Y++  TK L+T +  +HC            LQ  +L    +L   LDL   LD LL+LA AAR  G +RP +      ++I NGRHPL E+ +  F+PNST      G++ +I+G N SGKS+YLKQ+ I
Sbjct:  155 SDSMTATEKILFLSSIIPFDCVLTVRALGGLLKFLSRRRIGVELEDYDVGVPILGFKKFVLTHLVSIDQDTYSVLQIFKSESHPSVYK--VASGLKEGLSLFGILNRCRCKWGQKLLRLWFTRPTRELRELNSRLDVIQFFLMPQNLDMAQMLHRLLSHIKNVPLILKRMKLSHTKVSDWQVLYKTVYSALGLRDACRSLPQSIQLFQDIAQEFSDDLHHIASLIGKVVDFEESLAENRFTVLPNIDPDIDAKKRRLIGLPSFLTEVAQKELENLDSRIPSCSVIYIPLIGFLLSIPRLPFMVEASDFEIEGLDFMFLSEDKLHYRSARTKELDTLLGDLHCEIRDQETLLMYQLQCQVLARASVLTRVLDLASRLDVLLALASAARDYGYSRPHYSPCIHGVRIRNGRHPLMELCARTFVPNSTDCGGDQGRVKVITGPNSSGKSIYLKQLRI 606          
BLAST of mutS protein homolog 5 vs. Ensembl Mouse
Match: Msh5 (mutS homolog 5 [Source:MGI Symbol;Acc:MGI:1329021])

HSP 1 Score: 207.223 bits (526), Expect = 5.932e-58
Identity = 108/295 (36.61%), Postives = 171/295 (57.97%), Query Frame = 3
Query:  441 SVSMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLT 1325
            S SMT  EK +F+ SIIP +    VR+ GGLLKF+ ++R+GVELE     +P+L  + +     + ID+++   L IF   SHPS +K  V    KEGLS+F +LN C  K    +L  W  RP  ++  +  RLD + FF   QN D+ Q+L R L  + N+  IL RMK S   + DW VL +++   + + +   ++ + +++ Q I  +F+D L+ IAS I K++D E    + RF V   +DP +D KK +   LP  L+ +A++EL+  ++ I  C ++Y+P +G+LL+
Sbjct:  155 SDSMTATEKILFLSSIIPFDCVLTVRALGGLLKFLSRRRIGVELEDYDVGVPILGFKKFVLTHLVSIDQDTYSVLQIFKSESHPSVYK--VASGLKEGLSLFGILNRCRCKWGQKLLRLWFTRPTRELRELNSRLDVIQFFLMPQNLDMAQMLHRLLSHIKNVPLILKRMKLSHTKVSDWQVLYKTVYSALGLRDACRSLPQSIQLFQDIAQEFSDDLHHIASLIGKVVDFEESLAENRFTVLPNIDPDIDAKKRRLIGLPSFLTEVAQKELENLDSRIPSCSVIYIPLIGFLLS 447          
BLAST of mutS protein homolog 5 vs. Ensembl Mouse
Match: Msh3 (mutS homolog 3 [Source:MGI Symbol;Acc:MGI:109519])

HSP 1 Score: 117.472 bits (293), Expect = 2.547e-26
Identity = 77/252 (30.56%), Postives = 135/252 (53.57%), Query Frame = 3
Query: 1542 AIAARQIGGTRPLFETSGEIKIENGRHPLQEVF---SNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFN----VIEDKHSQ-----------LIYLYQLVDGHIECSHAIQAARLVNVSDNILQRA 2243
            A  A+Q    RP  +   +I I+NGRHP+ +V     + F+PNST  +D + ++ II+G N  GKS Y+KQ+ ++ ++AQIGS+VPA + ++   + + TR+ + ++   G STFM +L   +   ++A+  S +++DE G+G     GI++  A L + +           VTH+  +  L +  P+ Q  N++    V ED+  Q           + +LYQ+  G    S+ +  A+L +V   +LQ+A
Sbjct:  796 AKVAKQGNYCRPTLQEEKKIIIKNGRHPMIDVLLGEQDQFVPNSTSLSDSE-RVMIITGPNMGGKSSYIKQVALVTIMAQIGSYVPAEEATIGIVDGIFTRMGAADNIYKGRSTFMEELTDTAEIIRRASPQSLVILDELGRGTSTHDGIAIAYATLEYFIRDVKSL--TLFVTHYPPVCELEKCYPE-QVGNYHMGFLVNEDESKQDSGDMEQMPDSVTFLYQITRGIAARSYGLNVAKLADVPREVLQKA 1043          
BLAST of mutS protein homolog 5 vs. UniProt/SwissProt
Match: sp|O43196|MSH5_HUMAN (MutS protein homolog 5 OS=Homo sapiens OX=9606 GN=MSH5 PE=1 SV=1)

HSP 1 Score: 388.267 bits (996), Expect = 5.101e-121
Identity = 234/620 (37.74%), Postives = 355/620 (57.26%), Query Frame = 3
Query:  447 SMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXX-XXPGMEYLFSMNNAVYYKNYTTKNL--------------ETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSG-EIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRL--FSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            +MT  EK +F+ SIIP +    VR+ GGLLKF+ ++R+GVELE     +P+L  + +     + ID+++   L IF   SHPS +K  V    KEGLS+F +LN CH K    +L  W  RP  D+  +  RLD + FF   QN D+ Q+L R L  + N+  IL RMK S   + DW VL +++   + + +   ++ + +++ + I  +F+D L+ IAS I K++D EG   + RF V   +DP +DEKK +   LP  L+ +A +EL+  ++ I  C ++Y+P +G+LL+IP   +  E     I G++++F     ++Y++  TK L              ET +M+ LQ  +L    +L   LDL   LD LL+LA AAR  G +RP +      ++I+NGRHPL E+ +  F+PNST      G++ +I+G N SGKS+YLKQ+G++  +A +GSFVPA +  +   +A+ TR+ S ES   GLSTFM+DLNQ++     A A S +LIDEFGKG     G++L+ A LR  +A+   CPHIFV T+F  L    L+   P VQ+      ED +  L++ YQ+ +G  + SHA   A    + D ++ R  EV
Sbjct:  158 AMTATEKILFLSSIIPFDCLLTVRALGGLLKFLGRRRIGVELEDYNVSVPILGFKKFMLTHLVNIDQDTYSVLQIFKSESHPSVYK--VASGLKEGLSLFGILNRCHCKWGEKLLRLWFTRPTHDLGELSSRLDVIQFFLLPQNLDMAQMLHRLLGHIKNVPLILKRMKLSHTKVSDWQVLYKTVYSALGLRDACRSLPQSIQLFRDIAQEFSDDLHHIASLIGKVVDFEGSLAENRFTVLPNIDPEIDEKKRRLMGLPSFLTEVARKELENLDSRIPSCSVIYIPLIGFLLSIPRLPSMVEASDFEINGLDFMFLSEEKLHYRSARTKELDALLGDLHCEIRDQETLLMYQLQCQVLARAAVLTRVLDLASRLDVLLALASAARDYGYSRPRYSPQVLGVRIQNGRHPLMELCARTFVPNSTECGGDKGRVKVITGPNSSGKSIYLKQVGLITFMALVGSFVPAEEAEIGAVDAIFTRIHSCESISLGLSTFMIDLNQVAKAVNNATAQSLVLIDEFGKGTNTVDGLALLAAVLRHWLARGPTCPHIFVATNFLSLVQLQLLPQGPLVQYLTMETCEDGN-DLVFFYQVCEGVAKASHASHTAAQAGLPDKLVARGKEV 774          
BLAST of mutS protein homolog 5 vs. UniProt/SwissProt
Match: sp|Q9QUM7|MSH5_MOUSE (MutS protein homolog 5 OS=Mus musculus OX=10090 GN=Msh5 PE=1 SV=1)

HSP 1 Score: 380.563 bits (976), Expect = 4.538e-118
Identity = 233/622 (37.46%), Postives = 350/622 (56.27%), Query Frame = 3
Query:  441 SVSMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXX-XXPGMEYLFSMNNAVYYKNYTTKNLETSI--MHC------------LQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETS-GEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRL--FSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            S SMT  EK +F+ SIIP +    VR+ GGLLKF+ ++R+GVELE     +P+L  + +     + ID+++   L IF   SHPS +K  V    KEGLS+F +LN C  K    +L  W  RP  ++  +  RLD + FF   QN D+ Q+L R L  + N+  IL RMK S   + DW VL +++   + + +   ++ + +++ Q I  +F+D L+ IAS I K++D E    + RF V   +DP +D KK +   LP  L+ +A++EL+  ++ I  C ++Y+P +G+LL+IP      E     I G++++F   + ++Y++  TK L+T +  +HC            LQ  +L    +L   LDL   LD LL+LA AAR  G +RP +      ++I NGRHPL E+ +  F+PNST      G++ +I+G N SGKS+YLKQ+G++  +A +GSFVPA +  +   +A+ TR+ S ES   GLSTFM+DLNQ++     A  HS +LIDEFGKG     G++L+ A LR  +A    CPH+FV T+F  L    L+   P VQ+      ED    L++ YQL  G    SHA   A    + D ++ R  EV
Sbjct:  155 SDSMTATEKILFLSSIIPFDCVLTVRALGGLLKFLSRRRIGVELEDYDVGVPILGFKKFVLTHLVSIDQDTYSVLQIFKSESHPSVYK--VASGLKEGLSLFGILNRCRCKWGQKLLRLWFTRPTRELRELNSRLDVIQFFLMPQNLDMAQMLHRLLSHIKNVPLILKRMKLSHTKVSDWQVLYKTVYSALGLRDACRSLPQSIQLFQDIAQEFSDDLHHIASLIGKVVDFEESLAENRFTVLPNIDPDIDAKKRRLIGLPSFLTEVAQKELENLDSRIPSCSVIYIPLIGFLLSIPRLPFMVEASDFEIEGLDFMFLSEDKLHYRSARTKELDTLLGDLHCEIRDQETLLMYQLQCQVLARASVLTRVLDLASRLDVLLALASAARDYGYSRPHYSPCIHGVRIRNGRHPLMELCARTFVPNSTDCGGDQGRVKVITGPNSSGKSIYLKQVGLITFMALVGSFVPAEEAEIGVIDAIFTRIHSCESISLGLSTFMIDLNQVAKAVNNATEHSLVLIDEFGKGTNSVDGLALLAAVLRHWLALGPSCPHVFVATNFLSLVQLQLLPQGPLVQYLTMETCEDGE-DLVFFYQLCQGVASASHASHTAAQAGLPDPLIARGKEV 773          
BLAST of mutS protein homolog 5 vs. UniProt/SwissProt
Match: sp|Q6MG62|MSH5_RAT (MutS protein homolog 5 OS=Rattus norvegicus OX=10116 GN=Msh5 PE=2 SV=1)

HSP 1 Score: 379.022 bits (972), Expect = 1.749e-117
Identity = 232/622 (37.30%), Postives = 353/622 (56.75%), Query Frame = 3
Query:  441 SVSMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXX-XXPGMEYLFSMNNAVYYKNYTTKNL--------------ETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGE-IKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRL--FSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            S SMT  EK +F+ SIIP +    VR+ GGLLKF+ ++RVGVELE     +P+L  + +     + ID+++   L IF   SHPS +K  V    KEGLS+F +LN C  +    +L  W  RP  ++  +  RLD ++FF   QN D+ Q++ R L  + N+  IL RMK S   + DW VL +++   + + +   ++ + +++ + I  +F+D L+ IAS I K++D E    + RF V   +DP +D KK +   LP  L+ +A++EL+  ++ I  C ++Y+P +G+LL+IP  +   E     I G++++F   + ++Y++  TK L              E  +MH LQ  +L    +L   LDL   LD LL+LA AAR  G +RP +    + ++I+NGRHPL E+ +  F+PNST      G++ +I+G N SGKS+YLKQ+G++  +A +GSFVPA +  +   +A+ TR+ S ES   GLSTFM+DLNQ++     A  HS +LIDEFGKG     G++L+ A LR  +A    CPHIFV T+F  L    L+   P VQ+      ED +  L++ YQL  G    SHA   A    + D ++ R  EV
Sbjct:  153 SESMTATEKILFLSSIIPFDCVLTVRALGGLLKFLSRRRVGVELEDYSVGVPILGFKKFVLTHLVSIDQDTYSVLQIFKSESHPSVYK--VASGLKEGLSLFGILNRCRCRWGQKLLRLWFTRPTRELRELNSRLDVIEFFLMPQNLDMAQMMHRLLSHIKNVPLILKRMKLSHTKVSDWQVLYKTVYSALGLRDACRSLPQSIQLFRDITQEFSDDLHHIASLIGKVVDFEESLAENRFTVLPNIDPEIDAKKRRLMGLPSFLTEVAQKELENLDSCIPSCSVIYIPLIGFLLSIPRLSFMVEASDFEIEGLDFMFLSEDKLHYRSARTKELDALLGDLHCEIRDQEMLLMHQLQCQVLARAPVLTRVLDLASRLDVLLALASAARDYGYSRPHYSPCIQGVRIKNGRHPLMELCARTFVPNSTDCGGDQGRVKVITGPNSSGKSIYLKQVGLITFMALVGSFVPAEEAEIGVIDAIFTRIHSCESISLGLSTFMIDLNQVAKAVNNATEHSLVLIDEFGKGTNSVDGLALLTAVLRHWLALGPSCPHIFVATNFLSLVQLQLLPQGPLVQYLTMETCEDGN-DLVFFYQLCHGVASASHASYTAAQAGLPDPLIARGKEV 771          
BLAST of mutS protein homolog 5 vs. UniProt/SwissProt
Match: sp|Q19272|MSH5_CAEEL (MutS protein homolog 5 OS=Caenorhabditis elegans OX=6239 GN=msh-5 PE=2 SV=2)

HSP 1 Score: 253.832 bits (647), Expect = 2.251e-69
Identity = 182/624 (29.17%), Postives = 318/624 (50.96%), Query Frame = 3
Query:  447 SMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEE-----LKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXXXXPGMEYLFSMNNAVYYKNYTTKNLE--------------TSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQE-VFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSE-CPHIFVVTHFHRLFSLIQ-DLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            SMTE++K++ I      E+ NM+RS G LL F+++ R+GV  +      P+  ++ +T    + ID N+++ALDI  K +         KK   +G S++ L++ C S +    L  W R P TD   +  R  CV +F+   N +V   L   L  V  +  +  + ++ TA L  W   + ++  L+ I  I    + P+  +  +E+    ++  IA     II+    + Q R  V  G+D  LDE +  Y ++P +L+A+A++E     L  ++N       VY+P VG++L++P +     Q    P M  L+S +  +  +N TT  L+              T+I+  L+  +++    ++  L +   +D L+S  + A Q G   P       I+     HP+   V    F+PN   S     K +II+G N  GKSVY+K IGI++ L+ IGSFVPA    +   + ++TR+ +++S L G+STF  D+ Q++L  +KA  +S ++IDEFGKG   + G+SL+ + + + + + ++ CPHIF+ +HFH L + I  +     F  F V+ +   ++ YL+++  G ++CS A+  A+   +   ++ RA  +
Sbjct:  216 SMTEEDKYIIIKMRFDIEAVNMIRSFGALLLFLDETRMGVTDDPLSVTSPIKSIKTFTLGNLVEIDFNTIQALDILPKETE-------NKKTFGQGRSLYQLMDKCRSTVGKKCLRKWFRNPTTDRDDLVSRQKCVHYFKQDWNAEVTAKLSSILGRVKALNSVFQKFQSGTAQLIHWECFVSTVNALVEILNIIR--QTPISKEFPVESDLLREVSEIAVIAGSIINFAESKIQGRVTVMNGIDEELDEIRDTYENMPMVLTAIAKQEEARLGLPPYSN----VACVYIPLVGFVLSVPRDYGVESQ----PDMTLLYSTHEDLRVRNATTSRLDDEFGDILMRLIDSQTAIILTLKTRVMKKKRSIIKLLSIASRIDVLISFGLIAAQNGWNCPALVDEPVIEAVELYHPISVLVVKKSFVPNQVSSGRDGIKASIITGPNACGKSVYMKSIGIMVFLSHIGSFVPARHAKIGIVDRIVTRMFTVDSVLDGMSTFAKDVEQVALALRKATGNSLVIIDEFGKGTMTEVGLSLLASVMTYWMNRGADRCPHIFLSSHFHALPNYIPLETNIATFLTFTVLREAGGKIKYLFRMTPGLVDCSFALSVAKEEGIPPPVIGRACRI 822          
BLAST of mutS protein homolog 5 vs. UniProt/SwissProt
Match: sp|Q6L4V0|MSH5_ORYSJ (DNA mismatch repair protein MSH5 OS=Oryza sativa subsp. japonica OX=39947 GN=MSH5 PE=2 SV=1)

HSP 1 Score: 243.047 bits (619), Expect = 2.135e-67
Identity = 201/683 (29.43%), Postives = 334/683 (48.90%), Query Frame = 3
Query:  336 KDDMTLSEDAFSFVTHHDISYNMSLRKIFELNLPS-SVSMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELE--SEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALL--PDWNVLIQSIAGLISIFEIFS-AIKEPLEIK---------QKIEAKFTDKLYLIASWITKIIDTE-GIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICG----IVYLPQVGYLLTXXXXXXXXXXXXXXPGMEYLFSMNNA---VYYKNYTTKNL--------------ETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSEC-PHIFVVTHFHRLF--SLIQDLPKVQFKNFNVI----EDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            ++D      A   +     SY  +  ++  L + +    ++ +E+  F++S++   S   VR+ GGLL  ++ +R+   L+     + I +  V   +  K + +D  + +AL IF    HPS    G+ +  KEG S+F +LN C + M   +L +W  RP+ DI +I  RL+ + FF   +  DV+  L   LK V +I  +L +  + ++     DW+  ++ I  L+ I +IF   I E L IK          K  +  T++L  ++  +  +ID + G EK    +VK+G+   LDE +  Y  LPD L  ++  E+  F    + C     IVY+ Q+GYL+    E   +   I +P  E+ FS        YY    T+ L              E +I+  L   + ++   L   ++   ELDC+LSLAI ARQ    RP+      ++I+NGRH LQE+  + F+PN T      G++ II+G N SGKS+Y+KQ+ +++ LA IGSFVPA    +   + +       +S  S  STFM+DL+Q+    + A + S  L+DEFGKG   + GI L+   +        +C P + + TH  ++F  S +     ++    +V+    +  +  +I+LY+LV G    S  +  A+L  V   ++QRA+ V
Sbjct:   85 RNDCNDEAPAVKLMKSSTFSYEQAWHRLMYLKVAAMDEGLSVKERICFLNSMMDLGSDVQVRAAGGLLAILDNERLLDTLDQMEGGASIAIDSVAQISLDKFLKLDATAHEALQIFQVDKHPS--YMGIGR-AKEGFSVFGMLNKCVTPMGKHLLRTWFLRPIIDIDVINNRLNTISFFLCCE--DVMSALRGTLKSVRDIPHMLKKFNSPSSFCTSSDWHAFLKCICSLLHINKIFEVGISEHLAIKLQHMNIDLVGKANSSITEELDYVSDLVVGVIDVQRGKEKGYDTLVKDGLCEELDELRMVYEELPDFLEQVSANEIASFPFSFE-CRKAPLIVYVHQIGYLMCFFDEKISDALLIGLPDFEFAFSEEGEERRFYYHTQKTRELDNLLGDIYHKILDMERAIIRDLVCRVCQFIPQLTKAVNFAAELDCILSLAIVARQNNYVRPILTEDSILEIQNGRHALQEMTVDTFVPNDTKIRS-SGRINIITGPNYSGKSIYIKQVALVVFLAHIGSFVPADSAIVGLTDRIFC-AMGSKSMTSEQSTFMIDLHQVGTMLRHATSRSLCLLDEFGKGTLTEDGIGLLGGTISHFT--DYDCPPKVLLSTHLTQIFTESYLPQSEHIKCYTMSVLNPDEQTDNEDVIFLYRLVPGQALLSFGLHCAQLAGVPSEVVQRAVTV 757          
BLAST of mutS protein homolog 5 vs. TrEMBL
Match: A0A1S3IM19 (mutS protein homolog 5 OS=Lingula unguis OX=7574 GN=LOC106165042 PE=4 SV=1)

HSP 1 Score: 457.988 bits (1177), Expect = 3.600e-145
Identity = 265/658 (40.27%), Postives = 399/658 (60.64%), Query Frame = 3
Query:  330 DDKDDMTLSEDAFSFVTHHDISYNMSLRKIFELNLPS-SVSMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXXXXPGMEYLFSMNNAVYYKNYTTKNL--------------ETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFS--LIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            D+KD      +   F+   D +  +  R++  +NLP       E +K +++ S++P +  NMVR+ G LLK++EK RVGVELE    ++PVL ++ ++    M ID+N+  AL IF K  HPS +K G     KEGLS+F ++N C S++ S ML  W  RPL DI+ +++R D V FF N +N ++   L   LK + N  +IL RMK + A + DW  L ++I   I I +I  A  + ++I +KI   FT+ L+ IA  I+KI+D +    Q RFVVK  VDP LDEKK  Y  LPD ++ +A+EEL   + DI  C ++YLPQ+GYLL IP      E++  +PG++++F  N+  Y+K+  T+ L              ETSIMH LQ +ILE+  +LL+ +DL   LDCLL+LA  AR+    RP   T   I I++GRHPLQE+  +PF+PN+T S    GK+ +++G N SGKSVYLKQ+ ++  LA IGS+VPA    +   + + +R+K++ES   GLSTFM+DLNQ+S     A  +S I++DEFGKG E   G++L+ + L+  +A  S CPH+ V THFH L    L+ +  +++F+  ++++++ ++L++LYQL+DG   CS A   A    +   I+ R +EV
Sbjct:  129 DEKD-----SNVLQFLPSADFTLEVCKRRLLTVNLPGIPDHFDESQKTLYLSSLVPMDCTNMVRATGALLKYLEKCRVGVELEGADVRVPVLALKTFSLDDMMIIDDNTYCALQIFQKELHPSVYKSGSWNSAKEGLSLFGIVNKCKSRIGSMMLRLWFLRPLKDINTLRQRQDAVAFFFNPRNIEINNSLQDCLKHINNTPKILNRMKQAQASIGDWQALYKTIYNAIHIGDICRAQADKIDIFEKISTAFTEDLHRIAILISKIVDFDESFAQNRFVVKPNVDPTLDEKKKTYNGLPDFMTTVAQEELSKLSEDILECNVIYLPQLGYLLAIPKSKFLEEKEYQVPGLDFMFFSNDTSYFKSARTRELDHLLGDTQCDITDHETSIMHRLQNTILEHCKVLLDIMDLTAHLDCLLALATCAREYNYVRPELTTENIIVIQSGRHPLQELCCSPFVPNATMSGGDHGKMKVLTGPNASGKSVYLKQVALITFLAHIGSYVPAESARIGLLDRIFSRIKTMESVSVGLSTFMIDLNQVSAAINNATQNSLIILDEFGKGTETTDGLALLCSCLKHWLALGSSCPHVLVSTHFHGLIQHRLLPNSQQLKFQTMDIVQNE-TELVFLYQLIDGSTNCSQACHIAAQAGLPKEIVSRGLEV 780          
BLAST of mutS protein homolog 5 vs. TrEMBL
Match: A0A210PVY1 (MutS protein-like 5 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT02253 PE=4 SV=1)

HSP 1 Score: 449.899 bits (1156), Expect = 6.627e-142
Identity = 259/658 (39.36%), Postives = 404/658 (61.40%), Query Frame = 3
Query:  333 DKDDMTLSEDAFSFVTHHDISYNMSLRKIFELNLPS-SVSMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTX-XXXXXXXXXXXXXPGMEYLFSMNNAVYYKNYTTKNL--------------ETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLF--SLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            D D      D    +   D S ++  R++  LNLPS     TE EK +++ S++P ++ +MVR+ GGLLK++EK R+GVELE  I  +PVLD++ ++    M +D+ +  +L IF + SHPS +K G  +  KEGLS+F +LN C S++ S  L  W  +PL D+S++ +R + + FF + +N +VL  L   LK + N+ ++L RM N+ A + DW  L +++   I I +I  A    ++I +KI  KFT+ L+ IA+ ++KI+D E    Q RFVVK GVD  LDE+K  Y  LPD ++ +A+EEL   +++I  C ++YLPQ+GYLL I  ++  + E    IPG+E++F  N+ ++YK+ +T+ L              E SIMH LQ +ILE++ +L++ +DL  ELDCL +LA  AR+    RP   +   I ++ GRHPLQE+  +PF+PN   S++ +GK+ I++G N SGKSVYL+Q+G+++ LA IGSFVPA + ++   + + TR+ SLES   GLSTFM+D+NQ++   + A   S +L+DEFGKG  M  G+SL+ + +      K  CPH+ V THFH +    L+   P +++   + I D   +L++LYQL +GH   S+A   A    + + I++R +EV
Sbjct:  138 DADREWSDSDVVKLLPSVDFSLDICKRRLLHLNLPSIPKHYTETEKTLYLSSLVPFDNVSMVRATGGLLKYLEKMRIGVELEDNIVGVPVLDLRCFSLGDQMVLDDTAYSSLQIFQRESHPSAYKAG-SRSAKEGLSLFGILNRCRSQVGSRKLRMWCLQPLRDLSVLIQRQNAIAFFVSPRNIEVLTTLTDCLKHIKNVTRVLARMTNTQASVGDWQALYKTVYHAIYIGDICRAQSMEIDIFKKITTKFTEDLHRIATLVSKIVDFEESSSQARFVVKSGVDSELDERKRTYNGLPDFMTKVAKEELNRLSDEITECNVIYLPQLGYLLAIPKMDRMQTEADYVIPGLEFMFLSNSMLHYKSASTRELDRLLGDTQCEITDQENSIMHKLQNTILEHSRVLVDVMDLCAELDCLTTLAQCAREYNYVRPNLVSEAVIIVKGGRHPLQELCCSPFVPNDILSDEENGKIKILTGPNASGKSVYLRQVGMIVYLAHIGSFVPAEQATIGMFDRIFTRIHSLESVSVGLSTFMIDINQMTESLRNATDKSLVLVDEFGKGTAMTDGLSLLCSSIIHWDDMKGACPHVVVSTHFHSMVHQHLLPLSPNIKYLTMDTIHDDE-ELLFLYQLKEGHTSSSYASYIATKSGLPEEIVKRGVEV 793          
BLAST of mutS protein homolog 5 vs. TrEMBL
Match: A7RIQ7 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g238590 PE=4 SV=1)

HSP 1 Score: 436.417 bits (1121), Expect = 3.074e-136
Identity = 257/644 (39.91%), Postives = 385/644 (59.78%), Query Frame = 3
Query:  387 DISYNMSLRKIFELN-LPSSVS-MTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIK----------------QILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXX-XXPGMEYLFSMNNAVYYKNYTTKNLETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLF--SLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEVR 2255
            D + +   R+I  LN LP      T+ E+ +++ S++P ++ NMVR+ G LLK++EKKR G ELE     +P+LD+ +++    + +D+N+  AL IF K SHPS +K G    +KEGLS+F +LN   S + S +L  W  RP  DI ++ +R   + FF   +N D++  L   LK V N+                 +IL+RMK + A + DW  L +++   + I ++   I   + I +KI    T  L+ IAS I  IID +   +Q RFVVK GVDP LDE+K  Y  LPD ++ +A +EL   N  I  C ++YLPQ+GYLL +P      E+K   + G++++F  NN VYYK+ +T++ ET+IMH LQ +ILE T +LL+ ++   ELDCL+SLA++AR+     P   +   + I  G HPLQE+  + F+PN T  N+  G++ I++G N SGKSVYLKQ+G+++ LA IGSFVPA    +   + L TR+ + E+   GLSTFM+DLNQ++   + A   S +LIDEFGKG     G+SL+ A LR  +A  S+CP   V THFH L    L+ D+P ++F+   VI+D   +L++LY LVDGH + S+A   A L  + +++++R  E R
Sbjct:  148 DFTVDACKRRIIALNGLPGMPQHFTDMERTIYMTSLVPFDNVNMVRAAGALLKYLEKKRFGQELEDPDVHVPILDLVVFSIDDMVIVDDNTYSALQIFQKESHPSVYKSGTS--SKEGLSLFGVLNRTRSALGSRLLRMWFLRPTRDILVLTERQKAITFFTTPRNIDLIASLQDCLKNVKNVSVRLYITKRELKVKSVPRILVRMKTAQASITDWQALYKTVYNAMYIADLCRTIPSEIAIAKKITVLVTQDLHNIASLINTIIDFDDSTEQNRFVVKPGVDPALDERKRTYNGLPDFMTKVARKELNKLNPSIVECNVIYLPQLGYLLAVPRTTKMKEEKDFEMDGLDFVFLSNNMVYYKSASTRDHETAIMHRLQSTILERTKVLLDVMECTAELDCLISLAVSARENNYVCPEITSKSILHITGGMHPLQELCVSQFVPNDTAINEDSGRVVILTGPNASGKSVYLKQVGLIVFLAHIGSFVPAESAIIGVTDRLFTRIHTRETVSVGLSTFMIDLNQVASAIQSATDKSLVLIDEFGKGTATVDGLSLLCATLRHWLASSSKCPKTLVSTHFHSLIRQKLLPDIPILRFQTTEVIQDG-KELVFLYHLVDGHAKTSYASHIAALAGMPEHLVKRGTEAR 788          
BLAST of mutS protein homolog 5 vs. TrEMBL
Match: A0A2B4SNF7 (MutS protein-like 5 OS=Stylophora pistillata OX=50429 GN=Msh5 PE=4 SV=1)

HSP 1 Score: 423.32 bits (1087), Expect = 9.837e-131
Identity = 252/649 (38.83%), Postives = 379/649 (58.40%), Query Frame = 3
Query:  387 DISYNMSLRKIFELN--LPS-SVSMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGV-KKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXX-XXPGMEYLFSMNNAVYYKNYTTKNL--------------ETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLF--SLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEVRIIKLC 2270
            D SY +  R+I  LN  LP      TE E+ + + S++P ++ +MVRS G L+K+I+KKR+GVE+E    ++P+L +++++ +  + +D N+  AL IF K SHPS +K G      KEGLS+F + N   S + S ML  W  RP  +I+++Q+R   V +F N +N +++  L   LK + N+  IL RM  + A + DW  L ++      I ++   I   + I +KI   FTD+L  I S ++KIID +   +Q RFVVK GVDP LDEKK  Y  LPD ++ +A EEL   ++ I  C ++YLPQ+GYLL IP      E+    I G+E++F  NN ++YK+  T+ L              ET+IMH LQ  ILE+T +L++ ++   ELDCL+SLA+ AR+     P       + IE GRHPLQE+  N F+PN T      G++ +++G N SGKSVYLKQ+G+++ L  IGSFVPA   ++   + + TR+ + E+   GLSTFM+DLNQ++     A  +S +++DEFGKG     G+SL+ A LR  + + S CP + V THFH L    L+   P V ++   V+E+    + +LY L+DG+ E S A   A L  +   +L+RA +V  +  C
Sbjct:  252 DFSYEVCKRRITALNACLPGIPQHFTENERDIHMSSLVPFDNVSMVRSAGALIKYIDKKRIGVEMEDPEVRVPILGLKVFSLSDLLIVDNNTYSALQIFQKESHPSVYKMGAGNSGAKEGLSLFGITNRTKSAIGSHMLRMWFLRPSRNINLLQQRQKSVSYFMNLRNAELVASLQDCLKHIKNVSGILSRMTTAQASVGDWQALYKTAYNATYIADLCRRIPVDIAIAKKIATSFTDELLQIGSLMSKIIDFDESTEQNRFVVKPGVDPALDEKKRTYNGLPDFMTTVAREELNKLSSSITECNVIYLPQLGYLLAIPRSPELKEESDFGIDGLEFVFLSNNRLHYKSARTRELDNLLGDTQCEITDHETAIMHRLQTVILEHTKVLMDVMECCAELDCLISLAVCARENNYVCPKLTMDSVLNIEQGRHPLQELCVNLFVPNDTVFEKDKGRMKVLTGPNASGKSVYLKQVGLIVFLTHIGSFVPAESATVGITDRIFTRIHTRETVSVGLSTFMIDLNQVATAVNAATDNSLVIVDEFGKGTATIDGLSLLTATLRHWLRQGSSCPKLLVSTHFHSLVKQKLLPQTPLVTYQTMQVMEEDE-DIAFLYHLIDGYAESSLACHIASLAGLPHELLKRAQQVTQLTRC 899          
BLAST of mutS protein homolog 5 vs. TrEMBL
Match: A0A3M6UXS0 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00012502 PE=4 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 3.034e-129
Identity = 252/654 (38.53%), Postives = 379/654 (57.95%), Query Frame = 3
Query:  387 DISYNMSLRKIFELN--LPS-SVSMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGV-KKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXX-XXPGMEYLFSMNNAVYYKNYTTKNL--------------ETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKS-----GISLIVAFLRFMVAKKSECPHIFVVTHFHRLF--SLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEVRIIKLC 2270
            D SY +  R+I  LN  LP      TE E+ + + S++P ++ +MVRS G L+K+I+KKRVGVE++    ++P+L +++++ +  + +D N+  AL IF K SHPS +K G      KEGLS+F + N   S + S ML  W  RP  +I ++Q+R   V +F + +N +++  L   LK + N+  IL RM  + A + DW  L ++      I ++   I   + I +KI   FTD+L  I S ++KIID +    Q RFVVK GVDP LDEKK  Y  LPD ++ +A EEL   ++ I  C ++YLPQ+GYLL IP      E+    + G+E++F  NN ++YK+  T+ L              ET+IMH LQ  ILE+T +LL+ ++   ELDCL+SLA+ AR+     P       + IE GRHPLQE+  N F+PN +      G++ +++G N SGKSVYLKQ+G+++ LA IGSFVPA   ++   + + TR+ + E+   GLSTFM+DLNQ++     A  +S +++DEFGKG    +     G+SL+ A LR  + + S CP + V THFH L    L+   P V ++   V+E+    + +LY L+DG  E S A   A L  + D +L+RA +V  +  C
Sbjct:  209 DFSYEVCKRRITALNACLPGIPQHFTENEREIHMSSLVPFDNISMVRSAGALIKYIDKKRVGVEMDDPEVRVPILGLKVFSLSDLLIVDNNTYSALQIFQKESHPSVYKMGAGNSGAKEGLSLFGVTNRTRSAIGSHMLRMWFLRPSRNIDLLQQRQKAVSYFMSLRNAELVASLQDCLKHIKNVSGILSRMTTAQASVGDWQALYKTAYNATYIADLCRRIPTDVAIAKKIATSFTDELLQIGSLMSKIIDFDESTDQNRFVVKPGVDPALDEKKRTYNGLPDFMTTVAREELNKLSSSITECNVIYLPQLGYLLAIPRSPEMKEEDDFAMDGLEFVFLSNNRLHYKSTRTRELDNLLGDTQCEITDHETAIMHRLQTVILEHTKVLLHVMECCAELDCLISLALCARENNYVCPKLTMDSVLNIEQGRHPLQELCVNLFVPNDSVIEQDKGRMKVLTGPNASGKSVYLKQVGLIVFLAHIGSFVPAESATVGITDRIFTRIHTRETVSVGLSTFMIDLNQVATAVNAATENSLVIVDEFGKGTATVTITTIDGLSLLTAILRHWLRQGSSCPKLLVSTHFHSLVKQKLLPQTPLVTYQTMQVLEEGE-DVAFLYHLIDGCAESSLACHIASLAGLPDELLKRAQQVTELTRC 861          
BLAST of mutS protein homolog 5 vs. Ensembl Cavefish
Match: msh5 (mutS homolog 5 [Source:NCBI gene;Acc:103041936])

HSP 1 Score: 348.977 bits (894), Expect = 2.326e-107
Identity = 216/625 (34.56%), Postives = 352/625 (56.32%), Query Frame = 3
Query:  432 LPSSVSMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXX-XXPGMEYLFSMNNAVYYKNYTTKNL--------------ETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKK-SECPHIFVVTHFHRLFSL--IQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            LPSS+  TE EK  ++ S IP +S  M+RS GGLLK ++++RVGVELE     +P+L +  YT    ++ID ++  AL IF    HPS +K   +   KEGLS++ +LN C  K  S +L  W  RP  D+S++++R + V +F +  N DV+  L   L+ VGNI  +L +M  +   + DW  L +++   + I +   ++ + + + ++I   F D+L  IA+ I+K++D E       F+VK  VDP +DEKK     L D L+ +A  E++  ++    C ++Y+P +G+LL++P      +++   I G+++LF   + ++Y++  TK L              E ++M  LQ S+L+ +  L   L L  ELDCL++LA A++  G   P    S  + +   RHPL E+    F+ N   +++ +GK+ +++G N SGKS+YLKQ+G+++ +A IGS VPA +  +   +A+ TR+ S ES   GLSTFM+D+NQ+S         S +L+DEFGKG     G+SL+ A L   + +  SECP +F+ T+FH +  L  +   P +         D   +L++LYQL +G  + S+A   A L  +   ++QR +EV
Sbjct:  135 LPSSI--TENEKIPYLSSCIPFDSVLMLRSIGGLLKCLDRRRVGVELEDSSVGVPILQLLTYTLNDVVYIDRDTYSALQIFKSELHPSVYK--FQSGVKEGLSLYGILNRCRCKHGSRLLRQWFHRPTRDMSVLKRRQEVVRYFTSPHNSDVMNTLQNFLRNVGNIPTLLYKMSVTHTKVSDWQSLYKTVYSAVGIRDTVRSLPQNIHVFREICCDFKDELPYIATLISKVVDFESSLADNCFIVKPNVDPAIDEKKRTMMGLSDFLTDVARAEMENLDSRFSTCSVIYIPLIGFLLSVPRLPGMVDKENFEIEGLDFLFVSEDRLHYRSAKTKELDHMLGDLHSDIKDMERAVMAKLQASVLQRSSCLYKVLSLCAELDCLMALAQASQNYGYCSPTLTQSCRLTLHQSRHPLLELCVPVFVANPCITSETEGKVKVLTGPNSSGKSIYLKQVGLIVFMALIGSDVPAKEAEIGLVDAIFTRMHSRESVSVGLSTFMIDVNQMSHALNNGTGTSLVLVDEFGKGTNTVDGLSLLAACLNHWLRRSPSECPFVFLATNFHSVLQLGLLPQSPLLSLLTLETAVDGE-ELVFLYQLKEGICQSSYAANIATLAGLEPALVQRGVEV 754          
BLAST of mutS protein homolog 5 vs. Ensembl Cavefish
Match: msh5 (mutS homolog 5 [Source:NCBI gene;Acc:103041936])

HSP 1 Score: 348.977 bits (894), Expect = 2.326e-107
Identity = 216/625 (34.56%), Postives = 352/625 (56.32%), Query Frame = 3
Query:  432 LPSSVSMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXX-XXPGMEYLFSMNNAVYYKNYTTKNL--------------ETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKK-SECPHIFVVTHFHRLFSL--IQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            LPSS+  TE EK  ++ S IP +S  M+RS GGLLK ++++RVGVELE     +P+L +  YT    ++ID ++  AL IF    HPS +K   +   KEGLS++ +LN C  K  S +L  W  RP  D+S++++R + V +F +  N DV+  L   L+ VGNI  +L +M  +   + DW  L +++   + I +   ++ + + + ++I   F D+L  IA+ I+K++D E       F+VK  VDP +DEKK     L D L+ +A  E++  ++    C ++Y+P +G+LL++P      +++   I G+++LF   + ++Y++  TK L              E ++M  LQ S+L+ +  L   L L  ELDCL++LA A++  G   P    S  + +   RHPL E+    F+ N   +++ +GK+ +++G N SGKS+YLKQ+G+++ +A IGS VPA +  +   +A+ TR+ S ES   GLSTFM+D+NQ+S         S +L+DEFGKG     G+SL+ A L   + +  SECP +F+ T+FH +  L  +   P +         D   +L++LYQL +G  + S+A   A L  +   ++QR +EV
Sbjct:  135 LPSSI--TENEKIPYLSSCIPFDSVLMLRSIGGLLKCLDRRRVGVELEDSSVGVPILQLLTYTLNDVVYIDRDTYSALQIFKSELHPSVYK--FQSGVKEGLSLYGILNRCRCKHGSRLLRQWFHRPTRDMSVLKRRQEVVRYFTSPHNSDVMNTLQNFLRNVGNIPTLLYKMSVTHTKVSDWQSLYKTVYSAVGIRDTVRSLPQNIHVFREICCDFKDELPYIATLISKVVDFESSLADNCFIVKPNVDPAIDEKKRTMMGLSDFLTDVARAEMENLDSRFSTCSVIYIPLIGFLLSVPRLPGMVDKENFEIEGLDFLFVSEDRLHYRSAKTKELDHMLGDLHSDIKDMERAVMAKLQASVLQRSSCLYKVLSLCAELDCLMALAQASQNYGYCSPTLTQSCRLTLHQSRHPLLELCVPVFVANPCITSETEGKVKVLTGPNSSGKSIYLKQVGLIVFMALIGSDVPAKEAEIGLVDAIFTRMHSRESVSVGLSTFMIDVNQMSHALNNGTGTSLVLVDEFGKGTNTVDGLSLLAACLNHWLRRSPSECPFVFLATNFHSVLQLGLLPQSPLLSLLTLETAVDGE-ELVFLYQLKEGICQSSYAANIATLAGLEPALVQRGVEV 754          
BLAST of mutS protein homolog 5 vs. Ensembl Cavefish
Match: msh2 (mutS homolog 2 [Source:NCBI gene;Acc:103047089])

HSP 1 Score: 109.383 bits (272), Expect = 5.093e-24
Identity = 75/229 (32.75%), Postives = 117/229 (51.09%), Query Frame = 3
Query: 1572 RPLFETSGEIKIENGRHPLQEVFSN-PFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAK-KSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVIE-DKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIE 2249
            R L + SG + ++  RHP  E   +  FIPN       +    II+G N  GKS Y++Q+G+++++AQIG FVP  +  L+  + +L R+ + +S + G+STFM ++ + +   + A   S I+IDE G+G     G  L  A   ++  + KS C      THFH L +L Q  P V   N +V      S L  LY++  G  + S  I  A L N   +++  A E
Sbjct:  625 RILEKGSGRLILKGSRHPCVEAQDDVAFIPNDVTFTRGEQMFHIITGPNMGGKSTYIRQVGVIVLMAQIGCFVPCDEAELSVVDCVLARVGAGDSQIKGVSTFMAEMLETAAILRSATEDSLIIIDELGRGTSTYDGFGLAWAISEYIATRLKSFC---LFATHFHELTALAQQEPTV--CNLHVTALTTDSTLTMLYRVKKGVCDQSFGIHVAELANFPKHVIANARE 848          

HSP 2 Score: 54.6842 bits (130), Expect = 3.863e-7
Identity = 53/220 (24.09%), Postives = 102/220 (46.36%), Query Frame = 3
Query:  564 VELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGL-SIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVD-FFQNSQ-NQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIA---GLISIFEIFSAIKEPLEIKQKIEAKFTD---KLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDE 1196
            +EL S+ +      +  +   + M +D  +++AL++F          QG   D   G  S+  LLN C +     +++ WL++PL D + I++RLD V+ F ++S+  Q   + LLR+     ++ ++  +++  +A L D   + Q++    GL+   E  +  K  + +     + F+D           I   +D   I+  + F+VK   DP L E
Sbjct:  278 LELLSDEANFGSFKLTTFDLNQYMRLDNAAVQALNLF----------QGSSSDDPTGTHSLAGLLNKCRTPQGQRLVNQWLKQPLIDKNKIEERLDLVESFVEDSELRQSCQEDLLRRFP---DLNRLAKKLQRQSANLQDCYRVYQAVGQLPGLVQALERHTG-KHQVLLNAAFISPFSDLTSDFSKFQEMIETTLDMNQIDHHE-FLVKPSFDPTLSE 482          
BLAST of mutS protein homolog 5 vs. Ensembl Cavefish
Match: msh3 (mutS homolog 3 [Source:NCBI gene;Acc:103037699])

HSP 1 Score: 109.383 bits (272), Expect = 5.678e-24
Identity = 75/251 (29.88%), Postives = 133/251 (52.99%), Query Frame = 3
Query: 1542 AIAARQIGGTRP-LFETSGEIKIENGRHPLQEVF---SNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVI------------EDKHSQLI-YLYQLVDGHIECSHAIQAARLVNVSDNILQRA 2243
            A  A++    RP + E    I I +GRHP+ ++     + ++PN T       +  I++G N  GKS Y++Q+ ++ ++AQ+GSFVPA + S+   + + TR+ + ++   G STFM +L + S     A + S +++DE G+G     GI++  A L F + +  +C  +F VTH+  L  L +  P +   N+++             E+   + I +LYQL +G    S+ +  ARL N+ ++IL+ A
Sbjct:  822 AQVAKENNYCRPEVLEQERHIVIRDGRHPVIDMLMGEQDQYVPNDTELQGDGKRAMIVTGPNMGGKSSYIRQVALVTIMAQLGSFVPAREASIGMVDGIFTRMGASDNISRGRSTFMEELLEASEILSHATSRSLVILDELGRGTSTHDGIAIAYATLEFFI-RDVKCLTLF-VTHYPPLCELEKLYP-LHVGNYHMAFLLNEPEIVGDEEEVQPEFITFLYQLTEGAAGRSYGLNVARLANIPESILRTA 1069          
BLAST of mutS protein homolog 5 vs. Ensembl Cavefish
Match: msh3 (mutS homolog 3 [Source:NCBI gene;Acc:103037699])

HSP 1 Score: 109.383 bits (272), Expect = 5.678e-24
Identity = 75/251 (29.88%), Postives = 133/251 (52.99%), Query Frame = 3
Query: 1542 AIAARQIGGTRP-LFETSGEIKIENGRHPLQEVF---SNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVI------------EDKHSQLI-YLYQLVDGHIECSHAIQAARLVNVSDNILQRA 2243
            A  A++    RP + E    I I +GRHP+ ++     + ++PN T       +  I++G N  GKS Y++Q+ ++ ++AQ+GSFVPA + S+   + + TR+ + ++   G STFM +L + S     A + S +++DE G+G     GI++  A L F + +  +C  +F VTH+  L  L +  P +   N+++             E+   + I +LYQL +G    S+ +  ARL N+ ++IL+ A
Sbjct:  822 AQVAKENNYCRPEVLEQERHIVIRDGRHPVIDMLMGEQDQYVPNDTELQGDGKRAMIVTGPNMGGKSSYIRQVALVTIMAQLGSFVPAREASIGMVDGIFTRMGASDNISRGRSTFMEELLEASEILSHATSRSLVILDELGRGTSTHDGIAIAYATLEFFI-RDVKCLTLF-VTHYPPLCELEKLYP-LHVGNYHMAFLLNEPEIVGDEEEVQPEFITFLYQLTEGAAGRSYGLNVARLANIPESILRTA 1069          
BLAST of mutS protein homolog 5 vs. Ensembl Sea Lamprey
Match: msh3 (mutS homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-060526-307])

HSP 1 Score: 129.028 bits (323), Expect = 7.175e-31
Identity = 89/258 (34.50%), Postives = 141/258 (54.65%), Query Frame = 3
Query: 1542 AIAARQ-IGGTRPLF-ETSGEIKIENGRHPLQEVF---SNPFIPNSTYSNDWDGKLT-IISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIF----------------VVTHFHRLFSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIE 2249
            AIA+R      RP F E    I IENGRHP+ E+     N ++PNST+  D DGK   II+G N  GKS Y++Q+ ++ V+AQ+GSFVPA+   L+  +A+ TR+ + ++   G STFM +L++ S   +KA  HS +++DE G+G     GI++  A L + V K+ +C  +F                VV+++H  F L +     Q ++   +E     + +LYQL +G    S+ +  ARL  + + +L  A +
Sbjct:  639 AIASRDGYCSIRPEFVEEKSLIVIENGRHPVVELLMGDQNQYVPNSTHL-DADGKRAMIITGPNMGGKSSYIRQVALIAVMAQMGSFVPASHAKLSSLHAIHTRMGASDNIYKGHSTFMEELSEASEIIRKATRHSLVILDELGRGTSTHDGIAIAYATLEYFV-KEVQCLTLFVTHYPPVCEMERLNAEVVSNYHMSFLLSEPEETAQGEDGERLES----VTFLYQLTEGPAARSYGLNVARLAAIPEQVLHTAAQ 890          
BLAST of mutS protein homolog 5 vs. Ensembl Sea Lamprey
Match: msh6 (mutS homolog 6 (E. coli) [Source:ZFIN;Acc:ZDB-GENE-020905-3])

HSP 1 Score: 89.7373 bits (221), Expect = 1.582e-18
Identity = 67/240 (27.92%), Postives = 116/240 (48.33%), Query Frame = 3
Query: 1599 IKIENGRHPLQEV--FSNPFIPN------STYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXX-----XXXXXXTFMVDLNQISLCCKKANAHSTILIDEF-------GKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVI-----EDKHSQ--LIYLYQLVDGHIECSHAIQAARLVNVSDNILQ 2237
            +++   RHP        + FIPN      S   +D   +  +++G N  GKS  ++Q G+++++AQ+G +VPA    LTP + + TRL + +        +G STF V+L++ S   + A  HS +L+DE        G+G     G ++  A +   +A+   C  +F  TH+H L       P V+  +   +     +D  SQ  + +LY+ V G    S+   AARL  + D +++
Sbjct: 1121 LELRGSRHPCVSTTFLGDSFIPNDVVVGLSDGDDDGGARCVLVTGPNMGGKSTLMRQAGLIVIMAQLGCYVPAEACRLTPVDRVFTRLGASDRIMSVLRRAGESTFFVELSETSSILQHATRHSLVLLDELGFLLRPRGRGTATYDGTAIASAVV-HELAEGVRCRTLF-STHYHSLVEDFAASPHVRLGHMACMVEQENDDDPSQETITFLYKFVAGACPKSYGFNAARLAGLPDAVVR 1358          
BLAST of mutS protein homolog 5 vs. Ensembl Yeast
Match: MSH5 (Protein of the MutS family; forms a dimer with Msh4p that facilitates crossovers between homologs during meiosis; msh5-Y823H mutation confers tolerance to DNA alkylating agents; homologs present in C. elegans and humans [Source:SGD;Acc:S000002313])

HSP 1 Score: 204.912 bits (520), Expect = 1.442e-55
Identity = 169/601 (28.12%), Postives = 285/601 (47.42%), Query Frame = 3
Query:  633 MFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGL-SIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIK---EPLEIKQKIEAKFT-DKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPD------------LLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXXXXPGMEYLFSMNNAVYYKNY--------------TTKNLETSIMHCLQESILEY-THMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSN-------DW----DGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFS---LIQDLPKVQF--------KNFNVIEDKH-------SQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            M +DEN++ AL IF     P+  K G  K  + G  S+F L N   S  A  +L SWL  PLT+   I+ R   +    + QN  +   L + +K   +    + ++++  + L  W+ +   +   I+IF++ S++K   +   I   I+ K     L      +  +ID +     K   +  GVD  LDE ++ Y HL              LL+ + +E+ K   +  ++   VY+PQ+GYL+TI +        I     E +F  +  +Y+KN                  + E  I+  LQE IL   T +    + L      L    ++A +      L E    ++I NGRH L E F + +IPNST  +        W     G++ +++GAN SGKSVYL Q G+++ LAQIG FVPA +  +   + +LTR+++ E+     S+F++D  Q++     A   S ILIDE+GKG ++  G SL  + +  M +K  +CP I   THFH LF+   L +++  ++         + +N++E  H         + +L+++ +G  + S  I  A++  +S +I++RA E+
Sbjct:  247 MVLDENTISALHIF-----PTAHKLGHDKMMRNGFFSVFELFNQVSSDYARRILKSWLINPLTNKKRIETRYSIIRTLLDKQNAIIFSDLSQSIKRCPDAFGFINQLRSGKSTLGTWSKVASFLEKGIAIFQLVSSLKLGSDEANILHDIKNKVDISALKECLRKVETVIDFDTSRDTKTLTINTGVDNRLDECRNIYNHLEGILLDVARETQIFLLNTMPQEDCKTTKSLEKLVNAVYIPQLGYLVTISVLMEPLLDGIPNLQWEEIFRSSENIYFKNGRVLELDETYGDIYGAISDFEIEILFSLQEQILRRKTQLTAYNILLSELEILLSFAQVSAERNYAEPQLVEDECILEIINGRHALYETFLDNYIPNSTMIDGGLFSELSWCEQNKGRIIVVTGANASGKSVYLTQNGLIVYLAQIGCFVPAERARIGIADKILTRIRTQETVYKTQSSFLLDSQQMAKSLSLATEKSLILIDEYGKGTDILDGPSLFGSIMLNM-SKSEKCPRIIACTHFHELFNENVLTENIKGIKHYCTDILISQKYNLLETAHVGEDHESEGITFLFKVKEGISKQSFGIYCAKVCGLSRDIVERAEEL 841          
BLAST of mutS protein homolog 5 vs. Ensembl Yeast
Match: MSH3 (Mismatch repair protein; forms dimers with Msh2p that mediate repair of insertion or deletion mutations and removal of nonhomologous DNA ends, contains a PCNA (Pol30p) binding motif required for genome stability [Source:SGD;Acc:S000000688])

HSP 1 Score: 144.436 bits (363), Expect = 7.343e-36
Identity = 155/597 (25.96%), Postives = 268/597 (44.89%), Query Frame = 3
Query:  633 MFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVD----------FFQNSQNQ------DVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVL-------IQSIAGLIS-----IFEIFSAIKEPLEIKQ-----------KIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKS---KYYHLP--------DLLSALAEEELKGFNND-IQICGIVYLPQVGYLLTXXXXXXXXXXXXXXPGMEYLFSMNNAVYYKNYTTKNLETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKI-ENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVIEDKHS-----QLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            M +D NSL++LDIF   +H  G  +G         S+F LL++  +     ML  W+ +PL D+  I++RLD ++          FF+ S NQ      D+L+ L R + G  + K++   +K  T+ +  + +         +S  G I      +F +FS + E L   Q            +  K +DK  +    +     +EGI K +R    E V   L E+ +   KY   P        D L  +   ++K   +D I++     + +                    P  + L       YYK+   +  E      L +   EYT +    L+L      L   A +   +   RP F    +  I +N R+P+ E     ++PN    +  +GK+ II+G N  GKS Y++Q+ +L ++AQIGSFVPA ++ L+    +LTR+ + +  ++G STF V++  I    K  N  S +L+DE G+G     GI++  A +++  ++ S+CP I   THF  L  +    P ++  + + +E++ +      +I+LY+L  G    S+ +  A+L  +  +I+ RA  +
Sbjct:  418 MLLDPNSLQSLDIF---THDGG--KG---------SLFWLLDHTRTSFGLRMLREWILKPLVDVHQIEERLDAIECITSEINNSIFFE-SLNQMLNHTPDLLRTLNRIMYGTTSRKEVYFYLKQITSFVDHFKMHQSYLSEHFKSSDGRIGKQSPLLFRLFSELNELLSTTQLPHFLTMINVSAVMEKNSDKQVMDFFNLNNYDCSEGIIKIQR--ESESVRSQLKEELAEIRKYLKRPYLNFRDEVDYLIEVKNSQIKDLPDDWIKVNNTKMVSRF-----------------TTPRTQKL--TQKLEYYKDLLIRESELQYKEFLNKITAEYTELRKITLNLAQYDCILSLAATSC-NVNYVRPTFVNGQQAIIAKNARNPIIESLDVHYVPNDIMMSPENGKINIITGPNMGGKSSYIRQVALLTIMAQIGSFVPAEEIRLSIFENVLTRIGAHDDIINGDSTFKVEMLDILHILKNCNKRSLLLLDEVGRGTGTHDGIAISYALIKYF-SELSDCPLILFTTHFPMLGEIKS--PLIRNYHMDYVEEQKTGEDWMSVIFLYKLKKGLTYNSYGMNVAKLARLDKDIINRAFSI 974          
BLAST of mutS protein homolog 5 vs. Ensembl Yeast
Match: MSH2 (Protein that binds to DNA mismatches; forms heterodimers with Msh3p and Msh6p that bind to DNA mismatches to initiate the mismatch repair process; contains a Walker ATP-binding motif required for repair activity and involved in interstrand cross-link repair; Msh2p-Msh6p binds to and hydrolyzes ATP [Source:SGD;Acc:S000005450])

HSP 1 Score: 104.76 bits (260), Expect = 1.876e-23
Identity = 75/222 (33.78%), Postives = 117/222 (52.70%), Query Frame = 3
Query: 1611 NGRHPLQEVFSN-PFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVI--------EDKHS--QLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRA 2243
            + RHP+ E+  +  FI N        G   II+G N  GKS Y++Q+G++ ++AQIG FVP  +  +   +A+L R+ + +S L G+STFMV++ + +   K A+ +S I++DE G+G     G  L  A     +A K  C  +F  THFH L  L + LP V  KN +V+        E KH    +  LY++  G  + S  I  A +V   + I++ A
Sbjct:  655 SSRHPVLEMQDDISFISNDVTLESGKGDFLIITGPNMGGKSTYIRQVGVISLMAQIGCFVPCEEAEIAIVDAILCRVGAGDSQLKGVSTFMVEILETASILKNASKNSLIIVDELGRGTSTYDGFGLAWAIAEH-IASKIGCFALF-ATHFHELTELSEKLPNV--KNMHVVAHIEKNLKEQKHDDEDITLLYKVEPGISDQSFGIHVAEVVQFPEKIVKMA 872          

HSP 2 Score: 51.2174 bits (121), Expect = 5.899e-7
Identity = 64/281 (22.78%), Postives = 127/281 (45.20%), Query Frame = 3
Query:  519 SCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNK-VSHP--------SGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRK------LKGVGNIKQILLRMKNSTALLPDWNVLIQ---SIAGLISIFEIFSAIKEPLEIKQKIE--------AKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSAL---AEEELKGFNND 1274
            +C  L+ +++       L SE  ++   ++  +   + M +D +++KAL++F +   +P        SGF      ++ +  S+F LLN+C +     +L+ WL++PLT+I  I KR D VD+        + QI LR+      L  + +I+++  ++ N    L D   + Q    I  ++ +F  F     P E   ++         +   + L      +   +D +  E+   F++K   +  L + +SK   L D + ++   + E+L GF+ D
Sbjct:  264 ACNALIGYLQ-------LLSEQDQVGKYELVEHKLKEFMKLDASAIKALNLFPQGPQNPFGSNNLAVSGFTSA--GNSGKVTSLFQLLNHCKTNAGVRLLNEWLKQPLTNIDEINKRHDLVDYL-------IDQIELRQMLTSEYLPMIPDIRRLTKKL-NKRGNLEDVLKIYQFSKRIPEIVQVFTSFLEDDSPTEPVNELVRSVWLAPLSHHVEPLSKFEEMVETTVDLDAYEENNEFMIKVEFNEELGKIRSKLDTLRDEIHSIHLDSAEDL-GFDPD 526          
BLAST of mutS protein homolog 5 vs. Ensembl Yeast
Match: MSH6 (Protein required for mismatch repair in mitosis and meiosis; forms a complex with Msh2p to repair both single-base & insertion-deletion mispairs; also involved in interstrand cross-link repair; potentially phosphorylated by Cdc28p [Source:SGD;Acc:S000002504])

HSP 1 Score: 96.2857 bits (238), Expect = 9.818e-21
Identity = 63/226 (27.88%), Postives = 116/226 (51.33%), Query Frame = 3
Query: 1590 SGEIKIENGRHP---LQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHI----FVVTHFHRLFSLIQDLPKVQFKNFNVIEDKHSQ-LIYLYQLVDGHIECSHAIQAARLVNVSDNILQRA 2243
            +G +K ++ RHP   L    +  FIPN         +L +++GAN +GKS  L+   I +++AQ+G +VP     LTP + ++TRL + ++ + G STF V+L +       A   S +++DE G+G     G ++  + L  +        HI    F  TH+  L S  +  P+V+    +++ D+ ++ + +LY++++G  E S  +  A +  +S  I+  A
Sbjct:  940 NGFLKFKSLRHPCFNLGATTAKDFIPNDIELGKEQPRLGLLTGANAAGKSTILRMACIAVIMAQMGCYVPCESAVLTPIDRIMTRLGANDNIMQGKSTFFVELAETKKILDMATNRSLLVVDELGRGGSSSDGFAIAESVLHHVAT------HIQSLGFFATHYGTLASSFKHHPQVRPLKMSILVDEATRNVTFLYKMLEGQSEGSFGMHVASMCGISKEIIDNA 1159          
BLAST of mutS protein homolog 5 vs. Ensembl Yeast
Match: MSH1 (DNA-binding protein of the mitochondria; involved in repair of mitochondrial DNA; has ATPase activity and binds to DNA mismatches; has homology to E. coli MutS; transcription is induced during meiosis [Source:SGD;Acc:S000001162])

HSP 1 Score: 95.5153 bits (236), Expect = 1.220e-20
Identity = 82/289 (28.37%), Postives = 144/289 (49.83%), Query Frame = 3
Query: 1416 NYTTKNLETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPL-QEVFSNPFIPNSTYSNDWDGK--LTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQD-------LPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            N   +N E +I+   +   ++ ++ +      +  LD L S A+ A +     P  + S ++++ NGRH + +E  S   +   T +N    K  L +I+G N  GKS +L+Q  I+++LAQIG FVP +K  +   + L +R+ S +   + +STFMV++ + S   + A   S  ++DE G+G   K GIS+  A L++++ + ++C  +F  THF +    I D         KV+F    + +   +   Y ++L  G    S AI+ A L       L+ A E+
Sbjct:  671 NLKIRNEEANIIDLFKRKFIDRSNEVRQVATTLGYLDTLSSFAVLANERNLVCPKVDESNKLEVVNGRHLMVEEGLSARSLETFTANNCELAKDNLWVITGPNMGGKSTFLRQNAIIVILAQIGCFVPCSKARVGIVDKLFSRVGSADDLYNEMSTFMVEMIETSFILQGATERSLAILDEIGRGTSGKEGISIAYATLKYLL-ENNQCRTLF-ATHFGQELKQIIDNKCSKGMSEKVKFYQSGITDLGGNNFCYNHKLKPGICTKSDAIRVAELAGFPMEALKEAREI 957          
BLAST of mutS protein homolog 5 vs. Ensembl Nematostella
Match: EDO48759 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIQ7])

HSP 1 Score: 436.417 bits (1121), Expect = 4.252e-140
Identity = 257/644 (39.91%), Postives = 385/644 (59.78%), Query Frame = 3
Query:  387 DISYNMSLRKIFELN-LPSSVS-MTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIK----------------QILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXX-XXPGMEYLFSMNNAVYYKNYTTKNLETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLF--SLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEVR 2255
            D + +   R+I  LN LP      T+ E+ +++ S++P ++ NMVR+ G LLK++EKKR G ELE     +P+LD+ +++    + +D+N+  AL IF K SHPS +K G    +KEGLS+F +LN   S + S +L  W  RP  DI ++ +R   + FF   +N D++  L   LK V N+                 +IL+RMK + A + DW  L +++   + I ++   I   + I +KI    T  L+ IAS I  IID +   +Q RFVVK GVDP LDE+K  Y  LPD ++ +A +EL   N  I  C ++YLPQ+GYLL +P      E+K   + G++++F  NN VYYK+ +T++ ET+IMH LQ +ILE T +LL+ ++   ELDCL+SLA++AR+     P   +   + I  G HPLQE+  + F+PN T  N+  G++ I++G N SGKSVYLKQ+G+++ LA IGSFVPA    +   + L TR+ + E+   GLSTFM+DLNQ++   + A   S +LIDEFGKG     G+SL+ A LR  +A  S+CP   V THFH L    L+ D+P ++F+   VI+D   +L++LY LVDGH + S+A   A L  + +++++R  E R
Sbjct:  148 DFTVDACKRRIIALNGLPGMPQHFTDMERTIYMTSLVPFDNVNMVRAAGALLKYLEKKRFGQELEDPDVHVPILDLVVFSIDDMVIVDDNTYSALQIFQKESHPSVYKSGTS--SKEGLSLFGVLNRTRSALGSRLLRMWFLRPTRDILVLTERQKAITFFTTPRNIDLIASLQDCLKNVKNVSVRLYITKRELKVKSVPRILVRMKTAQASITDWQALYKTVYNAMYIADLCRTIPSEIAIAKKITVLVTQDLHNIASLINTIIDFDDSTEQNRFVVKPGVDPALDERKRTYNGLPDFMTKVARKELNKLNPSIVECNVIYLPQLGYLLAVPRTTKMKEEKDFEMDGLDFVFLSNNMVYYKSASTRDHETAIMHRLQSTILERTKVLLDVMECTAELDCLISLAVSARENNYVCPEITSKSILHITGGMHPLQELCVSQFVPNDTAINEDSGRVVILTGPNASGKSVYLKQVGLIVFLAHIGSFVPAESAIIGVTDRLFTRIHTRETVSVGLSTFMIDLNQVASAIQSATDKSLVLIDEFGKGTATVDGLSLLCATLRHWLASSSKCPKTLVSTHFHSLIRQKLLPDIPILRFQTTEVIQDG-KELVFLYHLVDGHAKTSYASHIAALAGMPEHLVKRGTEAR 788          
BLAST of mutS protein homolog 5 vs. Ensembl Nematostella
Match: EDO26509 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBU4])

HSP 1 Score: 120.939 bits (302), Expect = 1.470e-30
Identity = 71/231 (30.74%), Postives = 128/231 (55.41%), Query Frame = 3
Query: 1572 RPLFETSGEIKIENGRHPL---QEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNV-IEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            RP+ + S +++I+NGRHP+   Q      +I N    N    ++ +I+G N SGKS  L+Q  ++++LAQ+GS+VPA    +   + + TR+ + ++   G STFMV++N+ +      +  S +L+DE G+G     GIS+  A   F+    S+   +F  TH+H L  + +   ++  KN+NV +++    +I+L +LV G    S  I  A+L  + + ++ RA ++
Sbjct:   32 RPILDESTDLEIKNGRHPVIEKQLPIGEEYIANDVVLNRNQQQIIMITGPNMSGKSAILRQTALIVLLAQMGSYVPAQNARIGIVDKIFTRVGASDNISMGESTFMVEMNETASILNNISERSLVLLDEIGRGTSTYDGISIAWAIAEFLHEHPSKAKTLF-ATHYHELNDMTETFERI--KNYNVSVKELKDTIIFLRKLVAGGSNHSFGIHVAKLAGMPNRVIHRASKI 259          
BLAST of mutS protein homolog 5 vs. Ensembl Nematostella
Match: EDO38799 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBW8])

HSP 1 Score: 115.931 bits (289), Expect = 1.407e-26
Identity = 80/252 (31.75%), Postives = 128/252 (50.79%), Query Frame = 3
Query: 1542 AIAARQIGGTRPLFETSGE---IKIENGRHPLQEVF---SNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFN--VIEDKHSQL----------IYLYQLVDGHIECSHAIQAARLVNVSDNILQRA 2243
            A  ARQ G   P+ +   E   + I  GRHP+ +V       ++PN+T  N    +  II+G N  GKS Y+KQ+ +++++AQ+GSFVPA  + LTP +A+ TR+ + ++   G STFMV+L + S    +A   S +++DE G+G     G+++  A LR  + +         VTH+  L  L +  P     N    +  D  ++L           +LY+LV G    S+ +  ARL  +  NI+  A
Sbjct:  622 ATVARQPGYVCPVIKKETEASSVLITQGRHPVIDVLLQEHAQYVPNNTELNTEGPRCMIITGPNMGGKSSYIKQVALIVLMAQMGSFVPAHSVELTPLDAIYTRMGASDNIYKGRSTFMVELQETSEILAQATRRSLVILDELGRGTSTHDGVAIAYATLRHFIDQTHSL--TLFVTHYPSLAELERIFPGHVTNNHMAFMTSDGDTELASVAMDTPAVTFLYELVRGVAARSYGLNVARLAGIPINIVAMA 871          
BLAST of mutS protein homolog 5 vs. Ensembl Nematostella
Match: EDO35291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM04])

HSP 1 Score: 98.2117 bits (243), Expect = 5.862e-21
Identity = 61/184 (33.15%), Postives = 102/184 (55.43%), Query Frame = 3
Query: 1572 RPLFETSGEIKIENGRHP-LQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNV 2120
            RP F  +  + I+ GRHP L ++     +PN+ Y+ +    L II+G N SGKS YLKQI +L V+AQIG +VPA   S    + + +R+ S +   +  STFM+++ +I+   + A+  S I++DE G+G   + G+ +  A    ++  K+     F  THF  L ++ +  P V+  +F +
Sbjct:  588 RPEF--TDTLAIKQGRHPILDKILHETPVPNNMYAAEGTNFL-IITGPNMSGKSTYLKQIALLQVMAQIGCYVPAEYASFRLADQIFSRIGSDDDIETNSSTFMLEMKEINYIIQNASDKSLIIVDELGRGTSSEEGVGICYAVCEHLLGIKA---FTFFATHFLELTTMDELYPNVENLHFEI 765          
BLAST of mutS protein homolog 5 vs. Ensembl Nematostella
Match: EDO38319 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD83])

HSP 1 Score: 92.0485 bits (227), Expect = 4.091e-19
Identity = 63/174 (36.21%), Postives = 96/174 (55.17%), Query Frame = 3
Query: 1587 TSGEIKIENGRHPLQEVFSN-PFIPNS-TYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAK-KSECPHIFVVTHFHRLFSLIQDLPKV 2099
            + G+I +   RHP  E+  N  FI N  T S D    L II+G N  GKS Y++QIG+++++AQ+G FVP +   ++  + +L R+ S +S L G+STFM ++ + +   + A   S I+IDE G+G     G  L  A   ++  + KS C      THFH L SL  ++  V
Sbjct:  486 SEGDIILTGSRHPCLEIQDNVAFIANDVTLSRDKQMFL-IITGPNMGGKSTYIRQIGVIVLMAQLGCFVPCSTAQISITDCILARVGSGDSQLKGVSTFMSEMLETASILRTATKDSLIIIDELGRGTSTYDGFGLAWAISEYIATQIKSFC---LFATHFHELTSLADEVSTV 655          
BLAST of mutS protein homolog 5 vs. Ensembl Medaka
Match: msh5 (mutS homolog 5 [Source:NCBI gene;Acc:101170121])

HSP 1 Score: 345.51 bits (885), Expect = 4.739e-106
Identity = 216/641 (33.70%), Postives = 364/641 (56.79%), Query Frame = 3
Query:  387 DISYNMSLRKIFELNLPS-SVSMTEQEKWVFIHSIIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXX-XXPGMEYLFSMNNAVYYKNYTTKNL--------------ETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKS-ECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVIEDK--HSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            D    +  +++   +LP    S+TE+++  ++ S I  +S  M+R+ G LLK ++++RVGVELE     +P+L    YT    ++ID ++   L IF    HPS +K  +    KEGLS++ ++N C  K  + +L  W  RP  D++++ +R + + FF + QN DVL  L   L+ + NI  +L RM  +   + DW  L +++  ++ + +    + + + + + I   F+D L  I + I +I+D E   ++ RF VK  VDP +DEKK +   L D L+ +A  EL+  +  +  C ++Y+P +G+LL++P   +  E++   + G+E++F   + ++Y++  T+ L              ET++M  LQ +ILE +  L   LDL+ ELDCL++++ A+++   T P   +  +I I  GRHPL E+ S  F+ NS  S D +G++ II+G N SGKS+YLKQ+G+++ +A IGS VPA +  +   + + TR++S ES   GLSTFM+DLNQ++     +  +S +LIDEFGKG     G+SL+ A +   + K   + PHI + T+FH L  L   LP  +  +F  +E      +L++LYQL +G  + S+A   A L  +   ++ RA+EV
Sbjct:  117 DFGLEVGKQRLLSAHLPLLPASITERDRMSYLSSCITFDSPLMLRAVGALLKCLDRRRVGVELEDSSVGVPILQFHAYTLKGGVYIDSDTYSVLQIFKSDMHPSVYK--LHSGEKEGLSLYGIMNRCRCKFGAKLLRQWFLRPTQDLAVLCRRQEVIRFFTSPQNSDVLSTLQSLLRNIRNIPSLLRRMSLANTKVTDWQSLYKTVYSVVCVRDSVRHLPQSIGVFRDISGGFSDDLSYITALIGRIVDFEATVQENRFTVKPNVDPAIDEKKRRMAGLSDFLTDVARRELEHLDPRVPSCCVIYIPLIGFLLSLPRLPSMVEKEDFEMEGLEFMFLSEDRLHYRSQRTRELDELLGDMHCDIRDMETAVMTQLQNAILERSPSLYQVLDLIAELDCLMAMSSASQEYSYTSPKLASHKKITITQGRHPLLELCSPVFVANSFQSFDKEGRVKIITGPNSSGKSIYLKQVGLIVFMALIGSDVPAKEAEIGLVDGIYTRMQSRESVSVGLSTFMIDLNQMAQALNSSTGNSLLLIDEFGKGTNSVDGLSLLAASVCHWLRKAPVDVPHILLSTNFHSLLQL-GLLPASRMVSFLTLETAVDGDELVFLYQLREGICQSSYAANIASLAGLPARLVHRAVEV 754          
BLAST of mutS protein homolog 5 vs. Ensembl Medaka
Match: msh6 (mutS homolog 6 [Source:NCBI gene;Acc:101160935])

HSP 1 Score: 108.227 bits (269), Expect = 1.587e-23
Identity = 71/234 (30.34%), Postives = 119/234 (50.85%), Query Frame = 3
Query: 1599 IKIENGRHPL--QEVFSNPFIPNSTY---SNDWDG-------KLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPK---VQFKNF-----NVIEDKHSQLI-YLYQLVDGHIECSHAIQAARLVNVSDNILQ 2237
            I +   RHP   +  F + FIPN  Y     + DG          +++G N  GKS  ++Q G++++LAQ+G +VPA  +  TP + + TRL + +  ++G STF V+L++ +     A  HS +L+DE G+G     G ++  A ++ +  K   C      TH+H   SL++D  K   V+  +      N  ED   + I +LY+ + G    S+   AARL N+ + ++Q
Sbjct: 1025 INLVGSRHPCVTKTFFGDDFIPNDIYIGCPGNGDGLEEEGCASCVLVTGPNMGGKSTLMRQCGLVVILAQLGCYVPAESLRFTPVDRVFTRLGASDRIMAGESTFFVELSETASILHHATKHSLVLLDELGRGTATYDGTAIASAVVKELAEKV--CCRTLFSTHYH---SLVEDYAKNSAVRLGHMACMVENECEDPSQETITFLYKFISGACPKSYGFNAARLANLPEEVIQ 1253          
BLAST of mutS protein homolog 5 vs. Ensembl Medaka
Match: msh3 (mutS homolog 3 [Source:NCBI gene;Acc:101156254])

HSP 1 Score: 107.842 bits (268), Expect = 1.797e-23
Identity = 81/251 (32.27%), Postives = 127/251 (50.60%), Query Frame = 3
Query: 1542 AIAARQIGGTRP-LFETSGEIKIENGRHPLQEVF---SNPFIPNSTYSNDWDGKLT-IISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNV------------IEDKHSQ---LIYLYQLVDGHIECSHAIQAARLVNVSDNIL 2234
            A  A+Q G  RP + E   +I I +GRHP  ++     N F+PN T     DGK T II+G N  GKS Y++Q+ ++ ++AQIGSFVPA++  L   + + TR+ + ++   G STFM +L + S    +A   S +++DE G+G     GI++  A L + +           VTH+  L  L +  P     NF++             +D   Q   + +LY L +G    S+ +  A+L +V D IL
Sbjct:  800 AEVAQQGGYCRPKVCEDQPQIMIRDGRHPAIDLLMGEQNQFVPNHT-DLQGDGKRTMIITGPNMGGKSSYIRQVALICIMAQIGSFVPASEACLGLLDGIYTRMGASDNIYKGRSTFMEELTEASEIISRATERSLVILDELGRGTSTHDGIAIAYATLEYFIRHVKS--FTLFVTHYPPLCELERMYPD-HVSNFHMAFLLNETHISSDTKDGDVQPEFITFLYNLTEGAAGQSYGLNVAKLADVPDPIL 1046          
BLAST of mutS protein homolog 5 vs. Ensembl Medaka
Match: msh6 (mutS homolog 6 [Source:NCBI gene;Acc:101160935])

HSP 1 Score: 107.842 bits (268), Expect = 2.064e-23
Identity = 71/234 (30.34%), Postives = 119/234 (50.85%), Query Frame = 3
Query: 1599 IKIENGRHPL--QEVFSNPFIPNSTY---SNDWDG-------KLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPK---VQFKNF-----NVIEDKHSQLI-YLYQLVDGHIECSHAIQAARLVNVSDNILQ 2237
            I +   RHP   +  F + FIPN  Y     + DG          +++G N  GKS  ++Q G++++LAQ+G +VPA  +  TP + + TRL + +  ++G STF V+L++ +     A  HS +L+DE G+G     G ++  A ++ +  K   C      TH+H   SL++D  K   V+  +      N  ED   + I +LY+ + G    S+   AARL N+ + ++Q
Sbjct: 1107 INLVGSRHPCVTKTFFGDDFIPNDIYIGCPGNGDGLEEEGCASCVLVTGPNMGGKSTLMRQCGLVVILAQLGCYVPAESLRFTPVDRVFTRLGASDRIMAGESTFFVELSETASILHHATKHSLVLLDELGRGTATYDGTAIASAVVKELAEKV--CCRTLFSTHYH---SLVEDYAKNSAVRLGHMACMVENECEDPSQETITFLYKFISGACPKSYGFNAARLANLPEEVIQ 1335          
BLAST of mutS protein homolog 5 vs. Ensembl Medaka
Match: msh2 (mutS homolog 2 [Source:NCBI gene;Acc:101167993])

HSP 1 Score: 105.531 bits (262), Expect = 7.102e-23
Identity = 75/228 (32.89%), Postives = 116/228 (50.88%), Query Frame = 3
Query: 1572 RPLFETSGEIKIENGRHPLQEVFSN-PFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVIE-DKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIE 2249
            R L E    +++   RHP  E  ++  FIPN       +    II+G N  GKS Y++Q+G++ ++AQIG FVP  K  L+  +++L R+ + +S + G+STFM ++ + +   + A  +S I+IDE G+G     G  L  A    + +K S C  +F  THFH L +L    P V   N +V     H+ L  LY++  G  + S  I  A L      +L  A E
Sbjct:  622 RILDEGCRRLELVQARHPCMETDADTAFIPNDVSFVQGERSFYIITGPNMGGKSTYIRQVGVIALMAQIGCFVPCEKAELSVTDSILARVGAGDSQVKGVSTFMSEMLETAAILRSATENSLIIIDELGRGTSTYDGFGLAWAISEHIASKIS-CFCLF-ATHFHELTALASQQPSVH--NLHVTALTTHNTLTMLYRVKAGVCDQSFGIHVAELACFPPAVLAVARE 845          

HSP 2 Score: 60.4622 bits (145), Expect = 6.191e-9
Identity = 56/214 (26.17%), Postives = 101/214 (47.20%), Query Frame = 3
Query:  633 MFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVD-FFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIA---GLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITK-------IIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSAL 1241
            M +D  ++ AL++F          QG   D     S+  LLN C +     +++ W+++PL D + I++RLD V+ F  +S+ +   Q  L  L    ++ ++  +    +A L D   + Q+++   GLI+ FE +S   + L     ++A FT  L  + +  TK        +D   I+  + F+VK   DP L E + K   L + + A+
Sbjct:  299 MRLDNAAVGALNLF----------QGSPDDISGAHSLAGLLNKCRTPQGQRLVNQWIKQPLMDKTKIEERLDLVESFVCDSELRQTCQGDL--LHRFPDLHRLAKKFHRHSATLQDCYRVYQAVSQIPGLIAAFEKYSGSYQVL-----LQAVFTSPLTDLQTDFTKYQEMVETTLDMNQIDHHE-FLVKASFDPVLTELREKMDDLEESMQAV 494          
BLAST of mutS protein homolog 5 vs. Planmine SMEST
Match: SMESG000006277.1 (SMESG000006277.1)

HSP 1 Score: 1091.26 bits (2821), Expect = 0.000e+0
Identity = 580/580 (100.00%), Postives = 580/580 (100.00%), Query Frame = 3
Query:  513 VRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXXXXPGMEYLFSMNNAVYYKNYTTKNLETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            VRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTIPIENNENEQKINIPGMEYLFSMNNAVYYKNYTTKNLETSIMHCLQESILEYTHMLLNCLDLVLELDCLLSLAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRLKSLESSLSGLSTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV
Sbjct:    9 VRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTIPIENNENEQKINIPGMEYLFSMNNAVYYKNYTTKNLETSIMHCLQESILEYTHMLLNCLDLVLELDCLLSLAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRLKSLESSLSGLSTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 588          
BLAST of mutS protein homolog 5 vs. Planmine SMEST
Match: SMESG000006277.1 (SMESG000006277.1)

HSP 1 Score: 1078.54 bits (2788), Expect = 0.000e+0
Identity = 579/594 (97.47%), Postives = 580/594 (97.64%), Query Frame = 3
Query:  513 VRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTXXXXXXXXXXXXXXPGMEYLFSMNNAVYYKNYTT--------------KNLETSIMHCLQESILEYTHMXXXXXXXXXXXXXXXXXAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 2252
            VRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTIPIENNENEQKINIPGMEYLFSMNNAVYYKNYTT              K+LETSIMHCLQESILEYTHMLLNCLDLVLELDCLLSLAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRLKSLESSLSGLSTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV
Sbjct:    9 VRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALAEEELKGFNNDIQICGIVYLPQVGYLLTIPIENNENEQKINIPGMEYLFSMNNAVYYKNYTTKKLDKEFGDILYEIKDLETSIMHCLQESILEYTHMLLNCLDLVLELDCLLSLAIAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRLKSLESSLSGLSTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVIEDKHSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEV 602          
BLAST of mutS protein homolog 5 vs. Planmine SMEST
Match: SMESG000006275.1 (SMESG000006275.1)

HSP 1 Score: 132.109 bits (331), Expect = 3.048e-36
Identity = 63/65 (96.92%), Postives = 63/65 (96.92%), Query Frame = 3
Query:  330 DDKDDMTLSEDAFSFVTHHDISYNMSLRKIFELNLPSSVSMTEQEKWVFIHSIIPTESYNMVRSC 524
            DDKDDMTLSEDAFSFVTHHDISYNMSLRKIFELNLPSSVSMTEQEKWVFIHSIIPTESYNMV S 
Sbjct:   19 DDKDDMTLSEDAFSFVTHHDISYNMSLRKIFELNLPSSVSMTEQEKWVFIHSIIPTESYNMVISL 83          

HSP 2 Score: 40.4318 bits (93), Expect = 3.048e-36
Identity = 18/18 (100.00%), Postives = 18/18 (100.00%), Query Frame = 1
Query:  235 MFVSTKHDYEKIKNIFND 288
            MFVSTKHDYEKIKNIFND
Sbjct:    1 MFVSTKHDYEKIKNIFND 18          
BLAST of mutS protein homolog 5 vs. Planmine SMEST
Match: SMESG000019325.1 (SMESG000019325.1)

HSP 1 Score: 106.301 bits (264), Expect = 6.989e-25
Identity = 74/231 (32.03%), Postives = 120/231 (51.95%), Query Frame = 3
Query: 1572 RPLFETSGEIKIENGRHPLQEVFSNP-FIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNV-----IEDKHSQLIYLYQLVDGHI-ECSHAIQAARLVNVSDNILQRA 2243
            RP F  +  + I+N R+PL +  SN   I N  Y+ +     TI++GAN SGKS+YL+QI ++ ++ QIG F+PA   S    + L TR+   +   S  STF +++ ++S        +S +LIDE G+G     G+ +  A    ++  K+    IF+ THF  L  L    P VQ  NF V      +   + L++ Y+ V G   + ++A++ A+L N+   +L  A
Sbjct:    6 RPEF--TDTLAIKNCRNPLLDRLSNKETISNHVYAANL-SNFTIVTGANMSGKSMYLRQIALVQIMGQIGCFIPAEYASFRLSDHLFTRIGVDDDIQSNSSTFTIEMREMSYIINTITDNSLVLIDELGRGTSFDEGLGICFAICEHLLQTKA---FIFIATHFRELSKLEILYPNVQNVNFEVKNLSESDGDENHLLFTYKCVRGVCPDFTNAMKLAKLSNLPKQLLFEA 230          
BLAST of mutS protein homolog 5 vs. Planmine SMEST
Match: SMESG000016751.1 (SMESG000016751.1)

HSP 1 Score: 95.5153 bits (236), Expect = 6.340e-20
Identity = 73/218 (33.49%), Postives = 119/218 (54.59%), Query Frame = 3
Query: 1602 KIENGRHPLQEVFSN-PFIPNSTYSNDWDGKLTIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRXXXXXXXXXXXXTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIVAFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQ--FKNFNVIEDK-HSQLIYLYQLVDGHIECSHAIQAARLVNVSDNILQRA 2243
            K++N RHPL E+ +N  +I N   S D      II+G N  GKS Y++ IG++ V+AQIGSFVP     ++  + ++TR+ + +  L+G+STFM ++  IS   K A + S I+IDE G+G     G  L  + +   +A + +    F  THFH L     DL K+     N +V      ++LI++Y++ +G    S+ I+ A+   + D  ++ A
Sbjct:  620 KVKNCRHPLVEMQNNMSYIANDI-SFDESRTFQIITGPNMGGKSTYIRSIGLISVMAQIGSFVPCDGAEISIFDRIMTRIGAGDCQLTGVSTFMAEMLDISWILKTATSKSLIIIDELGRGTSTFDGFGLAWS-ISEHIATELKAFSAF-ATHFHEL----TDLSKIHCNVNNLHVTAQTIGNELIFMYKVEEGPAVRSYGIEVAKASGLPDESIKLA 830          

HSP 2 Score: 49.6766 bits (117), Expect = 9.817e-6
Identity = 55/243 (22.63%), Postives = 102/243 (41.98%), Query Frame = 3
Query:  486 IIPTESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFIDENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLHSWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILLRMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPL------EIKQKIEAKFTDKLYLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDE 1196
            ++ TE    +   G ++ +++       L ++ S     DVQ +     M + E   +AL+I      PS        D ++  S++ LLN C +     +L  W+++PL D+++I  RLD V+   N  N+    +    L+ + ++++I  R++ +   L D   L  ++     +  + +    P       E+   I+    D    I  + T   D E + K   F VK  VD  L E
Sbjct:  245 LVDTEGAETIGCLGSVITYLD-------LANDESFFNFFDVQTFKLDNYMRVGEQCSRALNIL-----PS------PNDLRKHDSLYGLLNCCRTASGERLLLQWIKQPLMDVNLINNRLDIVESLIN-DNKLRGCLYEENLRRIPDLQRITRRLQRNKGNLQDIYKLYVALRQASDMLNLLNEHNGPYKCIIQSELSSVIQEILKDTENFIQMF-TSFFDFEAV-KNHEFKVKCDVDESLKE 466          
The following BLAST results are available for this feature:
BLAST of mutS protein homolog 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MSH51.062e-12137.74mutS homolog 5 [Source:HGNC Symbol;Acc:HGNC:7328][more]
MSH51.062e-12137.74mutS homolog 5 [Source:HGNC Symbol;Acc:HGNC:7328][more]
MSH51.062e-12137.74mutS homolog 5 [Source:HGNC Symbol;Acc:HGNC:7328][more]
MSH51.062e-12137.74mutS homolog 5 [Source:HGNC Symbol;Acc:HGNC:7328][more]
MSH51.062e-12137.74mutS homolog 5 [Source:HGNC Symbol;Acc:HGNC:7328][more]
back to top
BLAST of mutS protein homolog 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msh-51.770e-7029.17MutS protein homolog 5 [Source:UniProtKB/Swiss-Pr... [more]
msh-53.586e-3930.37MutS protein homolog 5 [Source:UniProtKB/Swiss-Pr... [more]
msh-23.047e-2531.60MSH (MutS Homolog) family [Source:UniProtKB/TrEMB... [more]
msh-65.987e-2228.63MSH (MutS Homolog) family [Source:UniProtKB/TrEMB... [more]
him-143.992e-1331.10MutS protein homolog him-14 [Source:UniProtKB/Swi... [more]
back to top
BLAST of mutS protein homolog 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spel12.388e-2533.06gene:FBgn0015546 transcript:FBtr0344018[more]
spel12.388e-2533.06gene:FBgn0015546 transcript:FBtr0344019[more]
spel12.388e-2533.06gene:FBgn0015546 transcript:FBtr0080630[more]
spel12.388e-2533.06gene:FBgn0015546 transcript:FBtr0309281[more]
Msh62.441e-2329.20gene:FBgn0036486 transcript:FBtr0075646[more]
back to top
BLAST of mutS protein homolog 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msh51.221e-10532.34mutS homolog 5 [Source:ZFIN;Acc:ZDB-GENE-131127-63... [more]
msh51.114e-7831.81mutS homolog 5 [Source:ZFIN;Acc:ZDB-GENE-131127-63... [more]
msh53.367e-6932.58mutS homolog 5 [Source:ZFIN;Acc:ZDB-GENE-131127-63... [more]
msh41.748e-2432.05mutS homolog 4 [Source:ZFIN;Acc:ZDB-GENE-131121-64... [more]
msh41.875e-2432.05mutS homolog 4 [Source:ZFIN;Acc:ZDB-GENE-131121-64... [more]
back to top
BLAST of mutS protein homolog 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cgrrf13.772e-11936.17cell growth regulator with ring finger domain 1 [S... [more]
cgrrf11.310e-11836.59cell growth regulator with ring finger domain 1 [S... [more]
cgrrf16.120e-9533.75cell growth regulator with ring finger domain 1 [S... [more]
MSH31.012e-2430.95mutS homolog 3 [Source:NCBI gene;Acc:100486354][more]
MSH31.069e-2430.95mutS homolog 3 [Source:NCBI gene;Acc:100486354][more]
back to top
BLAST of mutS protein homolog 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Msh57.756e-11937.46mutS homolog 5 [Source:MGI Symbol;Acc:MGI:1329021][more]
Msh57.756e-11937.46mutS homolog 5 [Source:MGI Symbol;Acc:MGI:1329021][more]
Msh54.534e-8036.34mutS homolog 5 [Source:MGI Symbol;Acc:MGI:1329021][more]
Msh55.932e-5836.61mutS homolog 5 [Source:MGI Symbol;Acc:MGI:1329021][more]
Msh32.547e-2630.56mutS homolog 3 [Source:MGI Symbol;Acc:MGI:109519][more]
back to top
BLAST of mutS protein homolog 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O43196|MSH5_HUMAN5.101e-12137.74MutS protein homolog 5 OS=Homo sapiens OX=9606 GN=... [more]
sp|Q9QUM7|MSH5_MOUSE4.538e-11837.46MutS protein homolog 5 OS=Mus musculus OX=10090 GN... [more]
sp|Q6MG62|MSH5_RAT1.749e-11737.30MutS protein homolog 5 OS=Rattus norvegicus OX=101... [more]
sp|Q19272|MSH5_CAEEL2.251e-6929.17MutS protein homolog 5 OS=Caenorhabditis elegans O... [more]
sp|Q6L4V0|MSH5_ORYSJ2.135e-6729.43DNA mismatch repair protein MSH5 OS=Oryza sativa s... [more]
back to top
BLAST of mutS protein homolog 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3IM193.600e-14540.27mutS protein homolog 5 OS=Lingula unguis OX=7574 G... [more]
A0A210PVY16.627e-14239.36MutS protein-like 5 OS=Mizuhopecten yessoensis OX=... [more]
A7RIQ73.074e-13639.91Predicted protein OS=Nematostella vectensis OX=453... [more]
A0A2B4SNF79.837e-13138.83MutS protein-like 5 OS=Stylophora pistillata OX=50... [more]
A0A3M6UXS03.034e-12938.53Uncharacterized protein OS=Pocillopora damicornis ... [more]
back to top
BLAST of mutS protein homolog 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msh52.326e-10734.56mutS homolog 5 [Source:NCBI gene;Acc:103041936][more]
msh52.326e-10734.56mutS homolog 5 [Source:NCBI gene;Acc:103041936][more]
msh25.093e-2432.75mutS homolog 2 [Source:NCBI gene;Acc:103047089][more]
msh35.678e-2429.88mutS homolog 3 [Source:NCBI gene;Acc:103037699][more]
msh35.678e-2429.88mutS homolog 3 [Source:NCBI gene;Acc:103037699][more]
back to top
BLAST of mutS protein homolog 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
msh37.175e-3134.50mutS homolog 3 (E. coli) [Source:ZFIN;Acc:ZDB-GENE... [more]
msh61.582e-1827.92mutS homolog 6 (E. coli) [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of mutS protein homolog 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MSH51.442e-5528.12Protein of the MutS family; forms a dimer with Msh... [more]
MSH37.343e-3625.96Mismatch repair protein; forms dimers with Msh2p t... [more]
MSH21.876e-2333.78Protein that binds to DNA mismatches; forms hetero... [more]
MSH69.818e-2127.88Protein required for mismatch repair in mitosis an... [more]
MSH11.220e-2028.37DNA-binding protein of the mitochondria; involved ... [more]
back to top
BLAST of mutS protein homolog 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO487594.252e-14039.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO265091.470e-3030.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO387991.407e-2631.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352915.862e-2133.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383194.091e-1936.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of mutS protein homolog 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msh54.739e-10633.70mutS homolog 5 [Source:NCBI gene;Acc:101170121][more]
msh61.587e-2330.34mutS homolog 6 [Source:NCBI gene;Acc:101160935][more]
msh31.797e-2332.27mutS homolog 3 [Source:NCBI gene;Acc:101156254][more]
msh62.064e-2330.34mutS homolog 6 [Source:NCBI gene;Acc:101160935][more]
msh27.102e-2332.89mutS homolog 2 [Source:NCBI gene;Acc:101167993][more]
back to top
BLAST of mutS protein homolog 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006277.10.000e+0100.00SMESG000006277.1[more]
SMESG000006277.10.000e+097.47SMESG000006277.1[more]
SMESG000006275.13.048e-3696.92SMESG000006275.1[more]
SMESG000019325.16.989e-2532.03SMESG000019325.1[more]
SMESG000016751.16.340e-2033.49SMESG000016751.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021525 ID=SMED30021525|Name=mutS protein homolog 5|organism=Schmidtea mediterranea sexual|type=transcript|length=2473bp
TTTGATTTTGATATGAGTCAATTGTCTTGTAAAAATACTTCTGACACAAA
CAAATTTACGAATTCAATGAATGATGAAATTAATGAAGTTTATTTGGCCT
TATGCATTCAAAATAAAAATATTGGATTTTCATTTTATGATGCAAAATCT
GATATAATTTTTCTAGTTCCTGATCTAGAGTTTGATAATAAATTTGAAAT
TTTATTTAACTTAATAATTGAAATTCAGCCACAAATGTTTGTTTCAACAA
AGCATGATTATGAAAAGATTAAAAATATTTTCAATGATGGTTAGATAGTC
ATAATGTAAATACGTTTTATAAGTAAGTAGATGATAAAGATGATATGACG
TTATCAGAGGATGCATTTTCCTTTGTAACTCATCACGACATTTCGTATAA
TATGAGTTTACGTAAAATTTTTGAACTAAACTTGCCTTCTTCGGTATCAA
TGACAGAACAAGAAAAATGGGTTTTTATTCACTCAATAATTCCAACCGAA
TCATATAATATGGTAAGATCTTGTGGGGGTCTTTTAAAATTTATAGAAAA
AAAGCGAGTTGGAGTTGAATTGGAATCGGAAATTTCTAAAATTCCAGTTT
TAGATGTTCAAATATACACTACTGCAAAGACAATGTTTATTGATGAGAAT
AGCTTGAAGGCTCTTGATATTTTTAATAAAGTTAGCCATCCTTCAGGTTT
CAAACAAGGAGTTAAGAAAGATACCAAAGAAGGACTAAGCATTTTTCATC
TTTTGAACAACTGCCATTCTAAAATGGCCTCTGACATGCTACATAGTTGG
TTACGTAGACCACTTACTGACATATCAATGATTCAAAAGAGACTTGATTG
TGTTGATTTCTTTCAAAATAGTCAAAACCAAGACGTACTTCAAATACTTC
TAAGAAAACTTAAAGGTGTCGGAAATATTAAGCAAATCTTGTTACGCATG
AAGAATTCAACTGCACTATTGCCCGATTGGAATGTCTTAATTCAGAGCAT
TGCTGGTCTTATCAGTATTTTTGAGATATTCTCTGCAATAAAAGAGCCTC
TTGAAATTAAGCAAAAAATCGAAGCCAAATTTACAGATAAATTATATTTG
ATTGCTTCCTGGATAACCAAAATTATAGACACTGAAGGAATTGAAAAACA
AAAAAGATTCGTCGTCAAAGAAGGAGTGGATCCATATTTGGATGAAAAAA
AATCTAAATATTACCATTTACCTGACTTACTATCAGCCTTAGCCGAAGAA
GAGTTAAAAGGTTTTAATAATGACATTCAAATTTGTGGGATTGTTTACCT
ACCCCAAGTTGGATATTTGCTAACAATACCAATTGAGAACAATGAAAATG
AACAAAAAATAAATATACCTGGAATGGAATATTTGTTTTCAATGAACAAC
GCTGTTTATTACAAAAATTATACCACGAAAAATCTAGAAACTTCAATAAT
GCATTGCTTGCAAGAAAGTATTCTTGAATATACTCATATGCTATTAAATT
GTTTGGACTTAGTATTAGAATTAGACTGTTTGTTGTCATTAGCGATAGCG
GCCAGGCAGATAGGGGGCACCCGCCCATTATTCGAAACAAGCGGTGAAAT
TAAAATTGAAAATGGCAGACATCCTTTGCAAGAAGTCTTTTCGAATCCAT
TTATACCAAATTCAACATATTCAAATGATTGGGATGGTAAGTTGACTATT
ATTTCTGGGGCTAATGGTTCTGGGAAAAGTGTTTATCTTAAACAGATAGG
AATTTTAATTGTATTAGCTCAGATTGGCAGTTTTGTTCCAGCTACCAAGA
TGTCATTAACTCCTCAAAATGCTCTTTTGACAAGGCTGAAGTCACTCGAA
TCTAGTTTATCTGGATTATCGACATTTATGGTGGATCTTAATCAAATATC
ACTTTGCTGTAAAAAGGCAAATGCACATTCCACAATTTTGATCGATGAAT
TCGGCAAAGGAGCTGAAATGAAATCAGGAATTTCTTTGATTGTTGCTTTT
CTTCGATTTATGGTGGCTAAGAAATCCGAGTGTCCTCATATATTTGTCGT
TACTCATTTTCATAGATTATTTTCCCTTATCCAAGATTTACCGAAGGTGC
AGTTCAAAAATTTCAATGTAATCGAAGATAAACATAGTCAATTAATATAT
TTGTATCAATTGGTTGATGGACATATTGAATGCAGCCATGCTATTCAAGC
GGCGAGGTTGGTTAATGTTTCTGATAATATACTCCAAAGAGCGATTGAGG
TCAGAATTATAAAATTATGTATATATACAGGGGCAGCTCGTAACGTTAAA
ACCACGTGAGGTATTAGGGAGTATTTTTTTTAATAAATTAAATTTTATAT
ATTTTACTATATTTTGATTGATAATTTAAACATCATACCTTGCAAAATAT
AATTAAAATACCGAAATATGTTGACGATCTCGCGTATTTTTTGAATCGTA
TAGCGAATATAGACGATCAGGAC
back to top

protein sequence of SMED30021525-orf-1

>SMED30021525-orf-1 ID=SMED30021525-orf-1|Name=SMED30021525-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=655bp
MTLSEDAFSFVTHHDISYNMSLRKIFELNLPSSVSMTEQEKWVFIHSIIP
TESYNMVRSCGGLLKFIEKKRVGVELESEISKIPVLDVQIYTTAKTMFID
ENSLKALDIFNKVSHPSGFKQGVKKDTKEGLSIFHLLNNCHSKMASDMLH
SWLRRPLTDISMIQKRLDCVDFFQNSQNQDVLQILLRKLKGVGNIKQILL
RMKNSTALLPDWNVLIQSIAGLISIFEIFSAIKEPLEIKQKIEAKFTDKL
YLIASWITKIIDTEGIEKQKRFVVKEGVDPYLDEKKSKYYHLPDLLSALA
EEELKGFNNDIQICGIVYLPQVGYLLTIPIENNENEQKINIPGMEYLFSM
NNAVYYKNYTTKNLETSIMHCLQESILEYTHMLLNCLDLVLELDCLLSLA
IAARQIGGTRPLFETSGEIKIENGRHPLQEVFSNPFIPNSTYSNDWDGKL
TIISGANGSGKSVYLKQIGILIVLAQIGSFVPATKMSLTPQNALLTRLKS
LESSLSGLSTFMVDLNQISLCCKKANAHSTILIDEFGKGAEMKSGISLIV
AFLRFMVAKKSECPHIFVVTHFHRLFSLIQDLPKVQFKNFNVIEDKHSQL
IYLYQLVDGHIECSHAIQAARLVNVSDNILQRAIEVRIIKLCIYTGAARN
VKTT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR000432DNA_mismatch_repair_MutS_C
IPR007696DNA_mismatch_repair_MutS_core
IPR011184DNA_mismatch_repair_Msh2
IPR027417P-loop_NTPase
IPR007861DNA_mismatch_repair_MutS_clamp
Vocabulary: molecular function
TermDefinition
GO:0030983mismatched DNA binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003677DNA binding
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0006298mismatch repair
GO:0051321meiotic cell cycle