40S ribosomal protein S9

Overview
Name40S ribosomal protein S9
Smed IDSMED30021513
Length (bp)681
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 40S ribosomal protein S9 (SMED30021513) t-SNE clustered cells

Violin plots show distribution of expression levels for 40S ribosomal protein S9 (SMED30021513) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 40S ribosomal protein S9 (SMED30021513) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 40S ribosomal protein S9 (SMED30021513) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021513

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30021513SMESG000058106.1 SmedASXL_018649SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30021513SMESG000058106.1 dd_Smed_v4_92_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30021513SMESG000058106.1 dd_Smed_v4_92_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30021513SMESG000058106.1 dd_Smed_v4_92_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021513SMESG000058106.1 dd_Smed_v4_92_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021513SMESG000058106.1 dd_Smed_v4_92_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30021513SMESG000058106.1 dd_Smed_v4_92_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021513SMESG000058106.1 dd_Smed_v4_92_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021513SMESG000058106.1 dd_Smed_v4_92_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30021513SMESG000058106.1 dd_Smed_v4_92_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30021513SMESG000058106.1 dd_Smed_v4_92_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021513SMESG000058106.1 Contig47187newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021513SMESG000058106.1 Contig47187uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30021513SMESG000058106.1 dd_Smed_v6_92_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30021513SMESG000058106.1 dd_Smed_v6_92_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 40S ribosomal protein S9 vs. Ensembl Human
Match: RPS9 (ribosomal protein S9 [Source:HGNC Symbol;Acc:HGNC:10442])

HSP 1 Score: 296.59 bits (758), Expect = 1.385e-102
Identity = 147/170 (86.47%), Postives = 158/170 (92.94%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKN 604
            V  KTY TPRRPFEK RLD E+KLIG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKDP+RLFEGNALLRRLV+IGVL E +MKLDY+LGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSFIVRLDS KHIDFS +SPYGGGR GRVKRKN
Sbjct:    8 VCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKN 177          
BLAST of 40S ribosomal protein S9 vs. Ensembl Human
Match: RPS9 (ribosomal protein S9 [Source:HGNC Symbol;Acc:HGNC:10442])

HSP 1 Score: 296.59 bits (758), Expect = 1.385e-102
Identity = 147/170 (86.47%), Postives = 158/170 (92.94%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKN 604
            V  KTY TPRRPFEK RLD E+KLIG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKDP+RLFEGNALLRRLV+IGVL E +MKLDY+LGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSFIVRLDS KHIDFS +SPYGGGR GRVKRKN
Sbjct:    8 VCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKN 177          
BLAST of 40S ribosomal protein S9 vs. Ensembl Human
Match: RPS9 (ribosomal protein S9 [Source:HGNC Symbol;Acc:HGNC:10442])

HSP 1 Score: 296.59 bits (758), Expect = 1.385e-102
Identity = 147/170 (86.47%), Postives = 158/170 (92.94%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKN 604
            V  KTY TPRRPFEK RLD E+KLIG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKDP+RLFEGNALLRRLV+IGVL E +MKLDY+LGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSFIVRLDS KHIDFS +SPYGGGR GRVKRKN
Sbjct:    8 VCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKN 177          
BLAST of 40S ribosomal protein S9 vs. Ensembl Human
Match: RPS9 (ribosomal protein S9 [Source:HGNC Symbol;Acc:HGNC:10442])

HSP 1 Score: 296.59 bits (758), Expect = 1.385e-102
Identity = 147/170 (86.47%), Postives = 158/170 (92.94%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKN 604
            V  KTY TPRRPFEK RLD E+KLIG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKDP+RLFEGNALLRRLV+IGVL E +MKLDY+LGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSFIVRLDS KHIDFS +SPYGGGR GRVKRKN
Sbjct:    8 VCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKN 177          
BLAST of 40S ribosomal protein S9 vs. Ensembl Human
Match: RPS9 (ribosomal protein S9 [Source:HGNC Symbol;Acc:HGNC:10442])

HSP 1 Score: 296.59 bits (758), Expect = 1.385e-102
Identity = 147/170 (86.47%), Postives = 158/170 (92.94%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKN 604
            V  KTY TPRRPFEK RLD E+KLIG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKDP+RLFEGNALLRRLV+IGVL E +MKLDY+LGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSFIVRLDS KHIDFS +SPYGGGR GRVKRKN
Sbjct:    8 VCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKN 177          
BLAST of 40S ribosomal protein S9 vs. Ensembl Celegans
Match: rps-9 (40S ribosomal protein S9 [Source:UniProtKB/Swiss-Prot;Acc:Q20228])

HSP 1 Score: 294.278 bits (752), Expect = 3.604e-102
Identity = 144/179 (80.45%), Postives = 161/179 (89.94%), Query Frame = 2
Query:   77 MSRIPKVYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNARK 613
            M+R+  V  K   +PRRPFEKERLD E+KLIG FGL+NKREVWRVKYTLAK+RKAARELLTL++KDPKRLFEGNALLRRLVKIGVL E +MKLDYVLGLK+EDFLERRLQTQVFKLGLA+SIHHAR+LI Q HIRVR+Q+V+VPSFIVRLDS KHIDFS +SPYGGGR GRVKR+  RK
Sbjct:    1 MARLKTVQSKVTKSPRRPFEKERLDQELKLIGTFGLKNKREVWRVKYTLAKVRKAARELLTLEDKDPKRLFEGNALLRRLVKIGVLDETKMKLDYVLGLKVEDFLERRLQTQVFKLGLAKSIHHARILIKQHHIRVRRQVVDVPSFIVRLDSQKHIDFSLQSPYGGGRPGRVKRRTLRK 179          
BLAST of 40S ribosomal protein S9 vs. Ensembl Fly
Match: RpS9 (gene:FBgn0010408 transcript:FBtr0076425)

HSP 1 Score: 302.753 bits (774), Expect = 2.412e-105
Identity = 149/177 (84.18%), Postives = 162/177 (91.53%), Query Frame = 2
Query:   83 RIPKVYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNARK 613
            RIP V+ KTY TPRRP+EK RLD E+K+IG +GLRNKREVWRVKY LAKIRKAARELLTLDEKD KRLF+GNALLRRLV+IGVL E RMKLDYVLGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSF+VRLDS KHIDFS KSP+GGGR GRVKRKN +K
Sbjct:    5 RIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARELLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNLKK 181          
BLAST of 40S ribosomal protein S9 vs. Ensembl Fly
Match: RpS9 (gene:FBgn0010408 transcript:FBtr0076423)

HSP 1 Score: 302.753 bits (774), Expect = 2.412e-105
Identity = 149/177 (84.18%), Postives = 162/177 (91.53%), Query Frame = 2
Query:   83 RIPKVYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNARK 613
            RIP V+ KTY TPRRP+EK RLD E+K+IG +GLRNKREVWRVKY LAKIRKAARELLTLDEKD KRLF+GNALLRRLV+IGVL E RMKLDYVLGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSF+VRLDS KHIDFS KSP+GGGR GRVKRKN +K
Sbjct:    5 RIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARELLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNLKK 181          
BLAST of 40S ribosomal protein S9 vs. Ensembl Fly
Match: RpS9 (gene:FBgn0010408 transcript:FBtr0342577)

HSP 1 Score: 302.753 bits (774), Expect = 2.412e-105
Identity = 149/177 (84.18%), Postives = 162/177 (91.53%), Query Frame = 2
Query:   83 RIPKVYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNARK 613
            RIP V+ KTY TPRRP+EK RLD E+K+IG +GLRNKREVWRVKY LAKIRKAARELLTLDEKD KRLF+GNALLRRLV+IGVL E RMKLDYVLGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSF+VRLDS KHIDFS KSP+GGGR GRVKRKN +K
Sbjct:    5 RIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARELLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNLKK 181          
BLAST of 40S ribosomal protein S9 vs. Ensembl Fly
Match: RpS9 (gene:FBgn0010408 transcript:FBtr0076424)

HSP 1 Score: 229.18 bits (583), Expect = 3.388e-77
Identity = 114/133 (85.71%), Postives = 122/133 (91.73%), Query Frame = 2
Query:   83 RIPKVYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIR 481
            RIP V+ KTY TPRRP+EK RLD E+K+IG +GLRNKREVWRVKY LAKIRKAARELLTLDEKD KRLF+GNALLRRLV+IGVL E RMKLDYVLGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIR
Sbjct:    5 RIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARELLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIR 137          
BLAST of 40S ribosomal protein S9 vs. Ensembl Fly
Match: CG4866 (gene:FBgn0034232 transcript:FBtr0086940)

HSP 1 Score: 46.2098 bits (108), Expect = 4.458e-6
Identity = 32/122 (26.23%), Postives = 60/122 (49.18%), Query Frame = 2
Query:  155 EMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIV 520
            E K++  F ++ + +  +      +IR+ A  +  LD  +P +      LL +L  +GV S +++ L+    +    F  RRL   + KL ++  +  A  LI   H+RV  +M+  P+F+V
Sbjct:   29 ENKILRRFHIQKREDYTKYNKLSREIRELAERIAKLDASEPFKTEATTMLLNKLHAMGV-SNDQLTLETAAKISASHFCRRRLPVIMVKLRMSEHLKAATDLIEHGHVRVGPEMIKDPAFLV 149          
BLAST of 40S ribosomal protein S9 vs. Ensembl Zebrafish
Match: rps9 (ribosomal protein S9 [Source:ZFIN;Acc:ZDB-GENE-010724-15])

HSP 1 Score: 301.212 bits (770), Expect = 1.343e-104
Identity = 147/173 (84.97%), Postives = 161/173 (93.06%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNARK 613
            V  KTY TPRRPFEK RLD E++LIG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKDPKRLFEGNALLRRLV+IGVL E +MKLDY+LGLK+EDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSF+VRLDS KHIDFS +SPYGGGR GRVKRKNA+K
Sbjct:    8 VCSKTYVTPRRPFEKSRLDQELRLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKVEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLRSPYGGGRPGRVKRKNAKK 180          
BLAST of 40S ribosomal protein S9 vs. Ensembl Zebrafish
Match: rps9 (ribosomal protein S9 [Source:ZFIN;Acc:ZDB-GENE-010724-15])

HSP 1 Score: 301.212 bits (770), Expect = 1.343e-104
Identity = 147/173 (84.97%), Postives = 161/173 (93.06%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNARK 613
            V  KTY TPRRPFEK RLD E++LIG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKDPKRLFEGNALLRRLV+IGVL E +MKLDY+LGLK+EDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSF+VRLDS KHIDFS +SPYGGGR GRVKRKNA+K
Sbjct:    8 VCSKTYVTPRRPFEKSRLDQELRLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKVEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLRSPYGGGRPGRVKRKNAKK 180          
BLAST of 40S ribosomal protein S9 vs. Ensembl Zebrafish
Match: rps9 (ribosomal protein S9 [Source:ZFIN;Acc:ZDB-GENE-010724-15])

HSP 1 Score: 223.787 bits (569), Expect = 6.111e-75
Identity = 111/129 (86.05%), Postives = 120/129 (93.02%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIR 481
            V  KTY TPRRPFEK RLD E++LIG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKDPKRLFEGNALLRRLV+IGVL E +MKLDY+LGLK+EDFLERRLQTQVFKLGLA+SIHHARVLI QRHIR
Sbjct:    8 VCSKTYVTPRRPFEKSRLDQELRLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKVEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIR 136          
BLAST of 40S ribosomal protein S9 vs. Ensembl Zebrafish
Match: rps9 (ribosomal protein S9 [Source:ZFIN;Acc:ZDB-GENE-010724-15])

HSP 1 Score: 221.861 bits (564), Expect = 2.920e-74
Identity = 110/128 (85.94%), Postives = 119/128 (92.97%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHI 478
            V  KTY TPRRPFEK RLD E++LIG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKDPKRLFEGNALLRRLV+IGVL E +MKLDY+LGLK+EDFLERRLQTQVFKLGLA+SIHHARVLI QRHI
Sbjct:    8 VCSKTYVTPRRPFEKSRLDQELRLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKVEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHI 135          
BLAST of 40S ribosomal protein S9 vs. Ensembl Zebrafish
Match: rps9 (ribosomal protein S9 [Source:ZFIN;Acc:ZDB-GENE-010724-15])

HSP 1 Score: 221.861 bits (564), Expect = 2.920e-74
Identity = 110/128 (85.94%), Postives = 119/128 (92.97%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHI 478
            V  KTY TPRRPFEK RLD E++LIG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKDPKRLFEGNALLRRLV+IGVL E +MKLDY+LGLK+EDFLERRLQTQVFKLGLA+SIHHARVLI QRHI
Sbjct:    8 VCSKTYVTPRRPFEKSRLDQELRLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKVEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHI 135          
BLAST of 40S ribosomal protein S9 vs. Ensembl Xenopus
Match: ENSXETT00000002668.1 (ribosomal protein S9 [Source:NCBI gene;Acc:448529])

HSP 1 Score: 189.889 bits (481), Expect = 1.936e-61
Identity = 93/114 (81.58%), Postives = 104/114 (91.23%), Query Frame = 2
Query:  263 DEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKN 604
            +  D  R+++GNALLRRLV+IGVL E +MKLDY+LGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSFIVRLDS KHIDFS +SPYGGGR GRVKRKN
Sbjct:    1 NSNDEFRVYKGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKN 114          
BLAST of 40S ribosomal protein S9 vs. Ensembl Xenopus
Match: ENSXETT00000026300.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:101489596:101490713:-1 gene:ENSXETG00000013777.1 transcript:ENSXETT00000026300.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 4.390e-9
Identity = 36/81 (44.44%), Postives = 44/81 (54.32%), Query Frame = 2
Query:  236 KAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHI 478
            +AARELLTL EK+P+RL E            VL E +MKLDY+LGLKI            +K    RS+    VL+ QRHI
Sbjct:    1 RAARELLTLGEKEPERLCE------------VLEEWKMKLDYILGLKIS-------WNTTYK---HRSLSWTHVLMRQRHI 59          
BLAST of 40S ribosomal protein S9 vs. Ensembl Xenopus
Match: imp3 (IMP3, U3 small nucleolar ribonucleoprotein [Source:NCBI gene;Acc:448133])

HSP 1 Score: 51.9878 bits (123), Expect = 8.759e-8
Identity = 40/123 (32.52%), Postives = 68/123 (55.28%), Query Frame = 2
Query:  155 EMKLIGMFGLRNKREVWRVKYTLAK-IRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIV 520
            E+K++  + L +KRE +     L++ IR+ A+++  LDEKD  R+     LL +L  +G++   +  L     +    F  RRL T V KL +A+++  A   I Q HIRV  +++  P+F+V
Sbjct:   29 EVKVLRKYHL-DKREDYTKYNKLSRNIRELAQKIRDLDEKDKFRVQSTAKLLEKLYCMGLIPT-KQNLQLCQNVSASSFCRRRLPTIVVKLRMAQNLKTAITFIEQGHIRVGPEVITDPAFLV 149          
BLAST of 40S ribosomal protein S9 vs. Ensembl Mouse
Match: Rps9 (ribosomal protein S9 [Source:MGI Symbol;Acc:MGI:1924096])

HSP 1 Score: 296.59 bits (758), Expect = 9.509e-103
Identity = 147/170 (86.47%), Postives = 158/170 (92.94%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKN 604
            V  KTY TPRRPFEK RLD E+KLIG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKDP+RLFEGNALLRRLV+IGVL E +MKLDY+LGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSFIVRLDS KHIDFS +SPYGGGR GRVKRKN
Sbjct:    8 VCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKN 177          
BLAST of 40S ribosomal protein S9 vs. Ensembl Mouse
Match: Rps9 (ribosomal protein S9 [Source:MGI Symbol;Acc:MGI:1924096])

HSP 1 Score: 296.59 bits (758), Expect = 9.509e-103
Identity = 147/170 (86.47%), Postives = 158/170 (92.94%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKN 604
            V  KTY TPRRPFEK RLD E+KLIG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKDP+RLFEGNALLRRLV+IGVL E +MKLDY+LGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSFIVRLDS KHIDFS +SPYGGGR GRVKRKN
Sbjct:    8 VCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKN 177          
BLAST of 40S ribosomal protein S9 vs. Ensembl Mouse
Match: Rps9 (ribosomal protein S9 [Source:MGI Symbol;Acc:MGI:1924096])

HSP 1 Score: 222.631 bits (566), Expect = 1.727e-74
Identity = 112/129 (86.82%), Postives = 120/129 (93.02%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIR 481
            V  KTY TPRRPFEK RLD E+KLIG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKDP+RLFEGNALLRRLV+IGVL E +MKLDY+LGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIR
Sbjct:    8 VCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIR 136          
BLAST of 40S ribosomal protein S9 vs. Ensembl Mouse
Match: Rps9 (ribosomal protein S9 [Source:MGI Symbol;Acc:MGI:1924096])

HSP 1 Score: 221.476 bits (563), Expect = 5.504e-74
Identity = 111/128 (86.72%), Postives = 119/128 (92.97%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHI 478
            V  KTY TPRRPFEK RLD E+KLIG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKDP+RLFEGNALLRRLV+IGVL E +MKLDY+LGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHI
Sbjct:    4 VCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHI 131          
BLAST of 40S ribosomal protein S9 vs. Ensembl Mouse
Match: Rps9 (ribosomal protein S9 [Source:MGI Symbol;Acc:MGI:1924096])

HSP 1 Score: 221.476 bits (563), Expect = 6.281e-74
Identity = 111/128 (86.72%), Postives = 119/128 (92.97%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHI 478
            V  KTY TPRRPFEK RLD E+KLIG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKDP+RLFEGNALLRRLV+IGVL E +MKLDY+LGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHI
Sbjct:    8 VCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHI 135          
BLAST of 40S ribosomal protein S9 vs. UniProt/SwissProt
Match: sp|B4PEU8|RS9_DROYA (40S ribosomal protein S9 OS=Drosophila yakuba OX=7245 GN=RpS9 PE=2 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 2.418e-104
Identity = 149/177 (84.18%), Postives = 162/177 (91.53%), Query Frame = 2
Query:   83 RIPKVYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNARK 613
            RIP V+ KTY TPRRP+EK RLD E+K+IG +GLRNKREVWRVKY LAKIRKAARELLTLDEKD KRLF+GNALLRRLV+IGVL E RMKLDYVLGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSF+VRLDS KHIDFS KSP+GGGR GRVKRKN +K
Sbjct:    5 RIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARELLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNLKK 181          
BLAST of 40S ribosomal protein S9 vs. UniProt/SwissProt
Match: sp|P55935|RS9_DROME (40S ribosomal protein S9 OS=Drosophila melanogaster OX=7227 GN=RpS9 PE=1 SV=2)

HSP 1 Score: 302.753 bits (774), Expect = 2.418e-104
Identity = 149/177 (84.18%), Postives = 162/177 (91.53%), Query Frame = 2
Query:   83 RIPKVYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNARK 613
            RIP V+ KTY TPRRP+EK RLD E+K+IG +GLRNKREVWRVKY LAKIRKAARELLTLDEKD KRLF+GNALLRRLV+IGVL E RMKLDYVLGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSF+VRLDS KHIDFS KSP+GGGR GRVKRKN +K
Sbjct:    5 RIPSVFSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYALAKIRKAARELLTLDEKDEKRLFQGNALLRRLVRIGVLDESRMKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLKSPFGGGRPGRVKRKNLKK 181          
BLAST of 40S ribosomal protein S9 vs. UniProt/SwissProt
Match: sp|P29314|RS9_RAT (40S ribosomal protein S9 OS=Rattus norvegicus OX=10116 GN=Rps9 PE=1 SV=4)

HSP 1 Score: 296.59 bits (758), Expect = 6.651e-102
Identity = 147/170 (86.47%), Postives = 158/170 (92.94%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKN 604
            V  KTY TPRRPFEK RLD E+KLIG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKDP+RLFEGNALLRRLV+IGVL E +MKLDY+LGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSFIVRLDS KHIDFS +SPYGGGR GRVKRKN
Sbjct:    8 VCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKN 177          
BLAST of 40S ribosomal protein S9 vs. UniProt/SwissProt
Match: sp|A9L913|RS9_PAPAN (40S ribosomal protein S9 OS=Papio anubis OX=9555 GN=RPS9 PE=3 SV=1)

HSP 1 Score: 296.59 bits (758), Expect = 6.651e-102
Identity = 147/170 (86.47%), Postives = 158/170 (92.94%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKN 604
            V  KTY TPRRPFEK RLD E+KLIG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKDP+RLFEGNALLRRLV+IGVL E +MKLDY+LGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSFIVRLDS KHIDFS +SPYGGGR GRVKRKN
Sbjct:    8 VCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKN 177          
BLAST of 40S ribosomal protein S9 vs. UniProt/SwissProt
Match: sp|Q6ZWN5|RS9_MOUSE (40S ribosomal protein S9 OS=Mus musculus OX=10090 GN=Rps9 PE=1 SV=3)

HSP 1 Score: 296.59 bits (758), Expect = 6.651e-102
Identity = 147/170 (86.47%), Postives = 158/170 (92.94%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKN 604
            V  KTY TPRRPFEK RLD E+KLIG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKDP+RLFEGNALLRRLV+IGVL E +MKLDY+LGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSFIVRLDS KHIDFS +SPYGGGR GRVKRKN
Sbjct:    8 VCRKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLRSPYGGGRPGRVKRKN 177          
BLAST of 40S ribosomal protein S9 vs. TrEMBL
Match: A0A1I8H925 (S4 RNA-binding domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 5.713e-109
Identity = 156/179 (87.15%), Postives = 171/179 (95.53%), Query Frame = 2
Query:   77 MSRIPKVYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNARK 613
            MSR+P++Y KTYSTPRRPFEKERLDAE+KLIGM+GL+NKREVWRVKYTLAKIRKAARELLTL+EKDP+RLFEGNALLRRLV+IGVL E++MKLDYVLGLKIEDFLERRLQTQV KLGLA+SIHHARVLI QRHIRVR+QMVNVPSF+VRLDS KHIDFS KSP GGGR GRVKRKNAR+
Sbjct:    1 MSRVPRIYSKTYSTPRRPFEKERLDAELKLIGMYGLKNKREVWRVKYTLAKIRKAARELLTLEEKDPRRLFEGNALLRRLVRIGVLQEDKMKLDYVLGLKIEDFLERRLQTQVLKLGLAKSIHHARVLIRQRHIRVRRQMVNVPSFMVRLDSQKHIDFSLKSPLGGGRPGRVKRKNARE 179          
BLAST of 40S ribosomal protein S9 vs. TrEMBL
Match: A0A267DXB6 (S4 RNA-binding domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003233g2 PE=3 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 6.181e-109
Identity = 156/179 (87.15%), Postives = 171/179 (95.53%), Query Frame = 2
Query:   77 MSRIPKVYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNARK 613
            MSR+P++Y KTYSTPRRPFEKERLDAE+KLIGM+GL+NKREVWRVKYTLAKIRKAARELLTL+EKDP+RLFEGNALLRRLV+IGVL E++MKLDYVLGLKIEDFLERRLQTQV KLGLA+SIHHARVLI QRHIRVR+QMVNVPSF+VRLDS KHIDFS KSP GGGR GRVKRKNAR+
Sbjct:    2 MSRVPRIYSKTYSTPRRPFEKERLDAELKLIGMYGLKNKREVWRVKYTLAKIRKAARELLTLEEKDPRRLFEGNALLRRLVRIGVLQEDKMKLDYVLGLKIEDFLERRLQTQVLKLGLAKSIHHARVLIRQRHIRVRRQMVNVPSFMVRLDSQKHIDFSLKSPLGGGRPGRVKRKNARE 180          
BLAST of 40S ribosomal protein S9 vs. TrEMBL
Match: A0A267FSI7 (S4 RNA-binding domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006462g5 PE=3 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 4.425e-108
Identity = 155/178 (87.08%), Postives = 170/178 (95.51%), Query Frame = 2
Query:   80 SRIPKVYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNARK 613
            SR+P++Y KTYSTPRRPFEKERLDAE+KLIGM+GL+NKREVWRVKYTLAKIRKAARELLTL+EKDP+RLFEGNALLRRLV+IGVL E++MKLDYVLGLKIEDFLERRLQTQV KLGLA+SIHHARVLI QRHIRVR+QMVNVPSF+VRLDS KHIDFS KSP GGGR GRVKRKNAR+
Sbjct:    1 SRVPRIYSKTYSTPRRPFEKERLDAELKLIGMYGLKNKREVWRVKYTLAKIRKAARELLTLEEKDPRRLFEGNALLRRLVRIGVLQEDKMKLDYVLGLKIEDFLERRLQTQVLKLGLAKSIHHARVLIRQRHIRVRRQMVNVPSFMVRLDSQKHIDFSLKSPLGGGRPGRVKRKNARE 178          
BLAST of 40S ribosomal protein S9 vs. TrEMBL
Match: A0A267E157 (S4 RNA-binding domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006462g3 PE=3 SV=1)

HSP 1 Score: 315.849 bits (808), Expect = 3.996e-107
Identity = 154/177 (87.01%), Postives = 169/177 (95.48%), Query Frame = 2
Query:   83 RIPKVYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNARK 613
            R+P++Y KTYSTPRRPFEKERLDAE+KLIGM+GL+NKREVWRVKYTLAKIRKAARELLTL+EKDP+RLFEGNALLRRLV+IGVL E++MKLDYVLGLKIEDFLERRLQTQV KLGLA+SIHHARVLI QRHIRVR+QMVNVPSF+VRLDS KHIDFS KSP GGGR GRVKRKNAR+
Sbjct:    1 RVPRIYSKTYSTPRRPFEKERLDAELKLIGMYGLKNKREVWRVKYTLAKIRKAARELLTLEEKDPRRLFEGNALLRRLVRIGVLQEDKMKLDYVLGLKIEDFLERRLQTQVLKLGLAKSIHHARVLIRQRHIRVRRQMVNVPSFMVRLDSQKHIDFSLKSPLGGGRPGRVKRKNARE 177          
BLAST of 40S ribosomal protein S9 vs. TrEMBL
Match: G8JKF2 (S4 RNA-binding domain-containing protein OS=Triatoma rubida OX=162364 PE=2 SV=1)

HSP 1 Score: 312.768 bits (800), Expect = 6.816e-106
Identity = 154/178 (86.52%), Postives = 166/178 (93.26%), Query Frame = 2
Query:   80 SRIPKVYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNARK 613
            SR+P V+ KTY TPRRP+EK RLD E+K+IG +GLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLV+IGVL E RMKLDYVLGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSFIVRLDS KHIDFS KSP+GGGR GRVKRKN+RK
Sbjct:    4 SRVPSVHSKTYVTPRRPYEKARLDQELKIIGEYGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVRIGVLEEGRMKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQKHIDFSLKSPFGGGRHGRVKRKNSRK 181          
BLAST of 40S ribosomal protein S9 vs. Ensembl Cavefish
Match: rps9 (ribosomal protein S9 [Source:ZFIN;Acc:ZDB-GENE-010724-15])

HSP 1 Score: 226.483 bits (576), Expect = 4.617e-76
Identity = 112/129 (86.82%), Postives = 120/129 (93.02%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIR 481
            V  KTY TPRRPFEK RLD E+KLIG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKDPKRLFEGNALLRRLV+IGVL E +MKLDY+LGLK+EDFLERRLQTQVFKLGLA+SIHHARVLI QRHIR
Sbjct:    8 VCSKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVRIGVLDESKMKLDYILGLKVEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIR 136          
BLAST of 40S ribosomal protein S9 vs. Ensembl Cavefish
Match: imp3 (IMP U3 small nucleolar ribonucleoprotein 3 [Source:ZFIN;Acc:ZDB-GENE-040426-1062])

HSP 1 Score: 48.9062 bits (115), Expect = 4.845e-7
Identity = 35/122 (28.69%), Postives = 62/122 (50.82%), Query Frame = 2
Query:  155 EMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIV 520
            E+K++  + +  + +  +       IR+ A+++  LDEKD  R    +  L +L  IG++   +  L     +    F  RRL T + KL +A+++  A   I Q HIRV  ++V  P+F+V
Sbjct:   29 EVKILRKYHIEKREDYTKYNKLSRNIRELAQKIRDLDEKDGFRAQSTSQFLEKLYCIGLIPT-KQNLALADAVSASCFCRRRLPTIMLKLRMAQNLKAAVTFIEQGHIRVGPEVVTDPAFLV 149          
BLAST of 40S ribosomal protein S9 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000223.1 (pep scaffold:Pmarinus_7.0:GL477823:202328:205341:1 gene:ENSPMAG00000000193.1 transcript:ENSPMAT00000000223.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 296.975 bits (759), Expect = 9.152e-104
Identity = 146/173 (84.39%), Postives = 160/173 (92.49%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNARK 613
            V  KTY TPRRPFEK RLD E+KLIG +GLRNKREVWRVK+TLAKIRKAAR+LLTLDEKDP+RLFEGNALLRRLV+IGVL E +MKLDYVLGLKIEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PS++VRLDS KHIDFS +SPYGGGR GRVKRKN +K
Sbjct:    8 VCSKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARDLLTLDEKDPRRLFEGNALLRRLVRIGVLDESKMKLDYVLGLKIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSYMVRLDSQKHIDFSLRSPYGGGRPGRVKRKNMKK 180          
BLAST of 40S ribosomal protein S9 vs. Ensembl Yeast
Match: RPS9B (Protein component of the small (40S) ribosomal subunit; homologous to mammalian ribosomal protein S9 and bacterial S4; RPS9B has a paralog, RPS9A, that arose from the whole genome duplication [Source:SGD;Acc:S000000393])

HSP 1 Score: 276.944 bits (707), Expect = 4.791e-96
Identity = 128/177 (72.32%), Postives = 155/177 (87.57%), Query Frame = 2
Query:   77 MSRIPKVYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNA 607
            M R P+ Y KTYSTP+RP+E  RLDAE+KL G FGL+NKRE++R+ + L+KIR+AAR+LLT DEKDPKRLFEGNAL+RRLV++GVLSE++ KLDYVL LK+EDFLERRLQTQV+KLGLA+S+HHARVLI QRHI V KQ+VN+PSF+VRLDS KHIDF+  SP+GG R GRV R+NA
Sbjct:    1 MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKREIYRISFQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRVGVLSEDKKKLDYVLALKVEDFLERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAPTSPFGGARPGRVARRNA 177          
BLAST of 40S ribosomal protein S9 vs. Ensembl Yeast
Match: RPS9A (Protein component of the small (40S) ribosomal subunit; homologous to mammalian ribosomal protein S9 and bacterial S4; RPS9A has a paralog, RPS9B, that arose from the whole genome duplication [Source:SGD;Acc:S000006002])

HSP 1 Score: 276.174 bits (705), Expect = 1.128e-95
Identity = 127/177 (71.75%), Postives = 155/177 (87.57%), Query Frame = 2
Query:   77 MSRIPKVYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNA 607
            M R P+ Y KTYSTP+RP+E  RLDAE+KL G FGL+NK+E++R+ + L+KIR+AAR+LLT DEKDPKRLFEGNAL+RRLV++GVLSE++ KLDYVL LK+EDFLERRLQTQV+KLGLA+S+HHARVLI QRHI V KQ+VN+PSF+VRLDS KHIDF+  SP+GG R GRV R+NA
Sbjct:    1 MPRAPRTYSKTYSTPKRPYESSRLDAELKLAGEFGLKNKKEIYRISFQLSKIRRAARDLLTRDEKDPKRLFEGNALIRRLVRVGVLSEDKKKLDYVLALKVEDFLERRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLDSEKHIDFAPTSPFGGARPGRVARRNA 177          
BLAST of 40S ribosomal protein S9 vs. Ensembl Yeast
Match: IMP3 (Component of the SSU processome; SSU processome is required for pre-18S rRNA processing, essential protein that interacts with Mpp10p and mediates interactions of Imp4p and Mpp10p with U3 snoRNA [Source:SGD;Acc:S000001191])

HSP 1 Score: 48.521 bits (114), Expect = 1.027e-7
Identity = 32/136 (23.53%), Postives = 64/136 (47.06%), Query Frame = 2
Query:  155 EMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKS 562
            + +++  + ++N+ +  +       IR+ A +L  L   DP R      LL +L  +GVL+ +    D    + +     RRL   + +L +A +I  A   I Q H+RV   ++N P+++V  +   ++ +   S
Sbjct:   29 DTQVMRTYHIQNREDYHKYNRICGDIRRLANKLSLLPPTDPFRRKHEQLLLDKLYAMGVLTTKSKISDLENKVTVSAICRRRLPVIMHRLKMAETIQDAVKFIEQGHVRVGPNLINDPAYLVTRNMEDYVTWVDNS 164          
BLAST of 40S ribosomal protein S9 vs. Ensembl Nematostella
Match: EDO33468 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS49])

HSP 1 Score: 298.13 bits (762), Expect = 5.909e-104
Identity = 147/173 (84.97%), Postives = 160/173 (92.49%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNARK 613
            V  KTY+TPRRPFEKERL+ E+K+IG +GLRNKREVWRVK TLAKIRKAARELLTL+EKDP+RLFEGNALLRRLV+IGVL E RMKLDYVLGL+IEDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VNVPSF+VRLDS KHIDFS  SPYGGGR GRVKRKN +K
Sbjct:    5 VCSKTYTTPRRPFEKERLNQELKIIGEYGLRNKREVWRVKLTLAKIRKAARELLTLEEKDPRRLFEGNALLRRLVRIGVLDESRMKLDYVLGLRIEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQLVNVPSFVVRLDSQKHIDFSLNSPYGGGRPGRVKRKNMKK 177          
BLAST of 40S ribosomal protein S9 vs. Ensembl Nematostella
Match: EDO28709 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5Q2])

HSP 1 Score: 77.0258 bits (188), Expect = 4.317e-19
Identity = 36/44 (81.82%), Postives = 39/44 (88.64%), Query Frame = 2
Query:  482 VRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNARK 613
            VRKQ+VNVPSF+VRLDS KHIDFS  SPYGGGR GRVKRKN +K
Sbjct:    3 VRKQLVNVPSFVVRLDSQKHIDFSLNSPYGGGRPGRVKRKNMKK 46          
BLAST of 40S ribosomal protein S9 vs. Ensembl Nematostella
Match: EDO28708 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5Q2])

HSP 1 Score: 77.0258 bits (188), Expect = 4.317e-19
Identity = 36/44 (81.82%), Postives = 39/44 (88.64%), Query Frame = 2
Query:  482 VRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNARK 613
            VRKQ+VNVPSF+VRLDS KHIDFS  SPYGGGR GRVKRKN +K
Sbjct:    3 VRKQLVNVPSFVVRLDSQKHIDFSLNSPYGGGRPGRVKRKNMKK 46          
BLAST of 40S ribosomal protein S9 vs. Ensembl Nematostella
Match: EDO45146 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTU1])

HSP 1 Score: 44.2838 bits (103), Expect = 7.898e-6
Identity = 28/97 (28.87%), Postives = 50/97 (51.55%), Query Frame = 2
Query:  230 IRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIV 520
            I+  A ++  LD KDP R+     +L +L  +G++S ++  L     +    F  RRL   +  L +A+ +  A   I Q H+RV  +++  P+F+V
Sbjct:   54 IKSLANKIKDLDPKDPYRVEATEQILEKLHNMGLISTKK-NLGQCNKVNASSFCRRRLPVVMVNLKMAQVVKDAVKYIEQGHVRVGPEVIMDPAFLV 149          
BLAST of 40S ribosomal protein S9 vs. Ensembl Medaka
Match: rps9 (ribosomal protein S9 [Source:NCBI gene;Acc:101162867])

HSP 1 Score: 293.893 bits (751), Expect = 8.915e-102
Identity = 144/170 (84.71%), Postives = 157/170 (92.35%), Query Frame = 2
Query:   95 VYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKN 604
            V  KTY TPRRPFEK RLD E+KLIG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKD +RLFEGNALLRRLV+IGVL E +MKLDY+LGLK+EDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSF+VRLDS KHIDFS +SPYGGGR GRVKRKN
Sbjct:    8 VCSKTYVTPRRPFEKSRLDQELKLIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDSRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKVEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLRSPYGGGRPGRVKRKN 177          
BLAST of 40S ribosomal protein S9 vs. Ensembl Medaka
Match: rps9 (ribosomal protein S9 [Source:NCBI gene;Acc:101162867])

HSP 1 Score: 258.07 bits (658), Expect = 2.004e-87
Identity = 126/147 (85.71%), Postives = 138/147 (93.88%), Query Frame = 2
Query:  164 LIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKN 604
             IG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKD +RLFEGNALLRRLV+IGVL E +MKLDY+LGLK+EDFLERRLQTQVFKLGLA+SIHHARVLI QRHIRVRKQ+VN+PSF+VRLDS KHIDFS +SPYGGGR GRVKRKN
Sbjct:   47 FIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDSRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKVEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFVVRLDSQKHIDFSLRSPYGGGRPGRVKRKN 193          
BLAST of 40S ribosomal protein S9 vs. Ensembl Medaka
Match: rps9 (ribosomal protein S9 [Source:NCBI gene;Acc:101162867])

HSP 1 Score: 184.111 bits (466), Expect = 5.470e-59
Identity = 92/106 (86.79%), Postives = 100/106 (94.34%), Query Frame = 2
Query:  164 LIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIR 481
             IG +GLRNKREVWRVK+TLAKIRKAARELLTLDEKD +RLFEGNALLRRLV+IGVL E +MKLDY+LGLK+EDFLERRLQTQVFKLGLA+SIHHARVLI QRHIR
Sbjct:   47 FIGEYGLRNKREVWRVKFTLAKIRKAARELLTLDEKDSRRLFEGNALLRRLVRIGVLDEGKMKLDYILGLKVEDFLERRLQTQVFKLGLAKSIHHARVLIRQRHIR 152          
BLAST of 40S ribosomal protein S9 vs. Ensembl Medaka
Match: imp3 (IMP U3 small nucleolar ribonucleoprotein 3 [Source:NCBI gene;Acc:101155298])

HSP 1 Score: 50.447 bits (119), Expect = 1.628e-7
Identity = 35/122 (28.69%), Postives = 60/122 (49.18%), Query Frame = 2
Query:  155 EMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIV 520
            E+K++  F + N+ +  +       IR  A+++  LDEKD  R    + LL +L  IG++   R  L     +    F  RRL   +  L +A+++  A   + Q H+RV   +V  P+F+V
Sbjct:   29 EVKVLRRFRIENREDYTKYNKLSRNIRDLAQKIRDLDEKDGFRAQSSHRLLEKLYSIGLIPT-RQNLSLTEKVTASSFCRRRLPCIMLSLRMAQNLKTAITFVQQGHVRVGPDIVTDPAFLV 149          
BLAST of 40S ribosomal protein S9 vs. Planmine SMEST
Match: SMESG000058106.1 (SMESG000058106.1)

HSP 1 Score: 358.992 bits (920), Expect = 7.480e-128
Identity = 179/179 (100.00%), Postives = 179/179 (100.00%), Query Frame = 2
Query:   77 MSRIPKVYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNARK 613
            MSRIPKVYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNARK
Sbjct:    1 MSRIPKVYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLAKIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLKIEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRLDSGKHIDFSTKSPYGGGRAGRVKRKNARK 179          
The following BLAST results are available for this feature:
BLAST of 40S ribosomal protein S9 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPS91.385e-10286.47ribosomal protein S9 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPS91.385e-10286.47ribosomal protein S9 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPS91.385e-10286.47ribosomal protein S9 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPS91.385e-10286.47ribosomal protein S9 [Source:HGNC Symbol;Acc:HGNC:... [more]
RPS91.385e-10286.47ribosomal protein S9 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of 40S ribosomal protein S9 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rps-93.604e-10280.4540S ribosomal protein S9 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of 40S ribosomal protein S9 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RpS92.412e-10584.18gene:FBgn0010408 transcript:FBtr0076425[more]
RpS92.412e-10584.18gene:FBgn0010408 transcript:FBtr0076423[more]
RpS92.412e-10584.18gene:FBgn0010408 transcript:FBtr0342577[more]
RpS93.388e-7785.71gene:FBgn0010408 transcript:FBtr0076424[more]
CG48664.458e-626.23gene:FBgn0034232 transcript:FBtr0086940[more]
back to top
BLAST of 40S ribosomal protein S9 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps91.343e-10484.97ribosomal protein S9 [Source:ZFIN;Acc:ZDB-GENE-010... [more]
rps91.343e-10484.97ribosomal protein S9 [Source:ZFIN;Acc:ZDB-GENE-010... [more]
rps96.111e-7586.05ribosomal protein S9 [Source:ZFIN;Acc:ZDB-GENE-010... [more]
rps92.920e-7485.94ribosomal protein S9 [Source:ZFIN;Acc:ZDB-GENE-010... [more]
rps92.920e-7485.94ribosomal protein S9 [Source:ZFIN;Acc:ZDB-GENE-010... [more]
back to top
BLAST of 40S ribosomal protein S9 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSXETT00000002668.11.936e-6181.58ribosomal protein S9 [Source:NCBI gene;Acc:448529][more]
ENSXETT00000026300.14.390e-944.44pep primary_assembly:Xenopus_tropicalis_v9.1:7:101... [more]
imp38.759e-832.52IMP3, U3 small nucleolar ribonucleoprotein [Source... [more]
back to top
BLAST of 40S ribosomal protein S9 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rps99.509e-10386.47ribosomal protein S9 [Source:MGI Symbol;Acc:MGI:19... [more]
Rps99.509e-10386.47ribosomal protein S9 [Source:MGI Symbol;Acc:MGI:19... [more]
Rps91.727e-7486.82ribosomal protein S9 [Source:MGI Symbol;Acc:MGI:19... [more]
Rps95.504e-7486.72ribosomal protein S9 [Source:MGI Symbol;Acc:MGI:19... [more]
Rps96.281e-7486.72ribosomal protein S9 [Source:MGI Symbol;Acc:MGI:19... [more]
back to top
BLAST of 40S ribosomal protein S9 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B4PEU8|RS9_DROYA2.418e-10484.1840S ribosomal protein S9 OS=Drosophila yakuba OX=7... [more]
sp|P55935|RS9_DROME2.418e-10484.1840S ribosomal protein S9 OS=Drosophila melanogaste... [more]
sp|P29314|RS9_RAT6.651e-10286.4740S ribosomal protein S9 OS=Rattus norvegicus OX=1... [more]
sp|A9L913|RS9_PAPAN6.651e-10286.4740S ribosomal protein S9 OS=Papio anubis OX=9555 G... [more]
sp|Q6ZWN5|RS9_MOUSE6.651e-10286.4740S ribosomal protein S9 OS=Mus musculus OX=10090 ... [more]
back to top
BLAST of 40S ribosomal protein S9 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8H9255.713e-10987.15S4 RNA-binding domain-containing protein OS=Macros... [more]
A0A267DXB66.181e-10987.15S4 RNA-binding domain-containing protein (Fragment... [more]
A0A267FSI74.425e-10887.08S4 RNA-binding domain-containing protein (Fragment... [more]
A0A267E1573.996e-10787.01S4 RNA-binding domain-containing protein (Fragment... [more]
G8JKF26.816e-10686.52S4 RNA-binding domain-containing protein OS=Triato... [more]
back to top
BLAST of 40S ribosomal protein S9 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rps94.617e-7686.82ribosomal protein S9 [Source:ZFIN;Acc:ZDB-GENE-010... [more]
imp34.845e-728.69IMP U3 small nucleolar ribonucleoprotein 3 [Source... [more]
back to top
BLAST of 40S ribosomal protein S9 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000223.19.152e-10484.39pep scaffold:Pmarinus_7.0:GL477823:202328:205341:1... [more]
back to top
BLAST of 40S ribosomal protein S9 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
RPS9B4.791e-9672.32Protein component of the small (40S) ribosomal sub... [more]
RPS9A1.128e-9571.75Protein component of the small (40S) ribosomal sub... [more]
IMP31.027e-723.53Component of the SSU processome; SSU processome is... [more]
back to top
BLAST of 40S ribosomal protein S9 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO334685.909e-10484.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO287094.317e-1981.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO287084.317e-1981.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451467.898e-628.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 40S ribosomal protein S9 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rps98.915e-10284.71ribosomal protein S9 [Source:NCBI gene;Acc:1011628... [more]
rps92.004e-8785.71ribosomal protein S9 [Source:NCBI gene;Acc:1011628... [more]
rps95.470e-5986.79ribosomal protein S9 [Source:NCBI gene;Acc:1011628... [more]
imp31.628e-728.69IMP U3 small nucleolar ribonucleoprotein 3 [Source... [more]
back to top
BLAST of 40S ribosomal protein S9 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000058106.17.480e-128100.00SMESG000058106.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021513 ID=SMED30021513|Name=40S ribosomal protein S9|organism=Schmidtea mediterranea sexual|type=transcript|length=681bp
AAACATTATTGTGTTTGAAAATATTTGTTTAAATATACTGTTTAGTTATA
GATTTAAAAGTTCAAATTAATTGAAAATGAGTAGAATTCCAAAAGTTTAT
GGCAAGACTTATTCAACACCACGTCGTCCCTTTGAAAAAGAACGATTGGA
TGCTGAAATGAAATTAATCGGCATGTTTGGTTTAAGAAACAAGAGAGAAG
TATGGAGAGTAAAATATACTCTTGCTAAAATTCGAAAAGCTGCCAGAGAA
TTGCTTACTCTTGATGAAAAAGATCCTAAGAGATTATTTGAAGGTAACGC
TTTATTAAGAAGATTAGTCAAAATTGGTGTTTTGAGTGAAGAACGTATGA
AGCTCGATTATGTTCTTGGTCTTAAAATCGAAGATTTCTTGGAAAGGCGT
TTACAAACTCAAGTTTTCAAATTGGGACTTGCGCGATCAATCCATCATGC
TCGAGTATTAATTTTACAGCGACATATTAGAGTTCGTAAGCAAATGGTTA
ATGTACCAAGCTTTATTGTTCGATTGGACAGTGGTAAACACATCGATTTC
TCCACCAAATCACCATACGGTGGAGGAAGAGCTGGTCGTGTTAAGAGGAA
GAATGCCAGAAAAGAAACTGAAGTTGAAGAAGATGAGGAATGATTTATTT
AATTAATAAATTTTTGGATCAATAAAAAAAA
back to top

protein sequence of SMED30021513-orf-1

>SMED30021513-orf-1 ID=SMED30021513-orf-1|Name=SMED30021513-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=189bp
MSRIPKVYGKTYSTPRRPFEKERLDAEMKLIGMFGLRNKREVWRVKYTLA
KIRKAARELLTLDEKDPKRLFEGNALLRRLVKIGVLSEERMKLDYVLGLK
IEDFLERRLQTQVFKLGLARSIHHARVLILQRHIRVRKQMVNVPSFIVRL
DSGKHIDFSTKSPYGGGRAGRVKRKNARKETEVEEDEE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000039gamma neoblast
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036986S4_RNA-bd_sf
IPR005710Ribosomal_S4/S9_euk/arc
IPR022801Ribosomal_S4/S9
IPR001912Ribosomal_S4/S9_N
IPR002942S4_RNA-bd
IPR018079Ribosomal_S4_CS
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0000228nuclear chromosome
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005840ribosome
GO:0015935small ribosomal subunit
GO:0022626cytosolic ribosome
GO:0030529intracellular ribonucleoprotein complex
Vocabulary: molecular function
TermDefinition
GO:0019843rRNA binding
GO:0003723RNA binding
GO:0003735structural constituent of ribosome
Vocabulary: biological process
TermDefinition
GO:0006412translation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 169..188
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 163..188
NoneNo IPR availablePANTHERPTHR11831:SF2440S RIBOSOMAL PROTEIN S9coord: 7..180
NoneNo IPR availableSUPERFAMILYSSF55174Alpha-L RNA-binding motifcoord: 10..164
IPR002942RNA-binding S4 domainSMARTSM00363s4_6coord: 107..171
e-value: 0.0034
score: 26.6
IPR002942RNA-binding S4 domainPFAMPF01479S4coord: 107..149
e-value: 1.4E-8
score: 34.3
IPR002942RNA-binding S4 domainPROSITEPS50889S4coord: 107..187
score: 9.02
IPR002942RNA-binding S4 domainCDDcd00165S4coord: 107..149
e-value: 1.44834E-5
score: 39.5402
IPR001912Ribosomal protein S4/S9, N-terminalSMARTSM01390Ribosomal_S4_2coord: 6..106
e-value: 2.7E-22
score: 90.0
IPR001912Ribosomal protein S4/S9, N-terminalPFAMPF00163Ribosomal_S4coord: 15..62
e-value: 1.1E-5
score: 26.3
IPR036986RNA-binding S4 domain superfamilyGENE3DG3DSA:3.10.290.10coord: 108..185
e-value: 3.5E-11
score: 45.1
IPR005710Ribosomal protein S4/S9, eukaryotic/archaealTIGRFAMTIGR01018TIGR01018coord: 6..164
e-value: 1.5E-69
score: 231.0
IPR022801Ribosomal protein S4/S9PANTHERPTHR1183130S 40S RIBOSOMAL PROTEINcoord: 7..180
IPR018079Ribosomal protein S4, conserved sitePROSITEPS00632RIBOSOMAL_S4coord: 105..129