SMED30021511

Overview
NameSMED30021511
Smed IDSMED30021511
Length (bp)1323
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30021511 (SMED30021511) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30021511 (SMED30021511) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30021511 (SMED30021511) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30021511 (SMED30021511) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021511

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30021511SMESG000038232.1 Contig5776GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30021511SMESG000038232.1 Contig5776GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30021511SMESG000038232.1 Contig5776GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30021511SMESG000038232.1 SMESG000010788.1 dd_Smed_v4_759_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021511SMESG000038232.1 SMESG000010788.1 dd_Smed_v4_759_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30021511SMESG000038232.1 SMESG000010788.1 dd_Smed_v6_759_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30021511SMESG000038232.1 SMESG000010788.1 dd_Smed_v6_759_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021511SMESG000038232.1 SMESG000010788.1 dd_Smed_v6_759_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30021511 vs. Ensembl Human
Match: TPM1 (tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010])

HSP 1 Score: 103.219 bits (256), Expect = 1.357e-24
Identity = 74/207 (35.75%), Postives = 121/207 (58.45%), Query Frame = 3
Query:  162 REHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            RE AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER    +   A+   EK+E  + +LK+AK     A+ K  EV++KL  +E++ E+ +++A   E K +ELE+E+ TV+N L SLE+   K   +E+ YE  I+ L   L++ E +    ERS  KL++ I+   + L++ + K   I +E+D  L D TSM
Sbjct:   42 RETAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSM 248          
BLAST of SMED30021511 vs. Ensembl Human
Match: TPM1 (tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010])

HSP 1 Score: 101.293 bits (251), Expect = 7.061e-24
Identity = 73/207 (35.27%), Postives = 121/207 (58.45%), Query Frame = 3
Query:  162 REHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            RE AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER    +   A+   EK+E  + +LK+AK     A+ K  EV++KL  +E++ E+ +++A   E K +ELE+E+ TV+N L SLE+   K   +E+ YE  I+ L   L++ E +    ERS  KL++ I+   + L++ + K   I +E+D  L D TS+
Sbjct:   42 RETAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI 248          
BLAST of SMED30021511 vs. Ensembl Human
Match: TPM1 (tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010])

HSP 1 Score: 100.523 bits (249), Expect = 3.002e-23
Identity = 78/240 (32.50%), Postives = 136/240 (56.67%), Query Frame = 3
Query:   63 TLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            +L+ K++  ++E+D+    L +    L+    +   AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER    +   A+   EK+E  + +LK+AK     A+ K  EV++KL  +E++ E+ +++A   E K +ELE+E+ TV+N L SLE+   K   +E+ YE  I+ L   L++ E +    ERS  KL++ I+   + L++ + K   I +E+D  L D TSM
Sbjct:   45 SLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSM 284          
BLAST of SMED30021511 vs. Ensembl Human
Match: TPM1 (tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010])

HSP 1 Score: 98.5969 bits (244), Expect = 1.257e-22
Identity = 77/240 (32.08%), Postives = 136/240 (56.67%), Query Frame = 3
Query:   63 TLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            +L+ K++  ++E+D+    L +    L+    +   AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER    +   A+   EK+E  + +LK+AK     A+ K  EV++KL  +E++ E+ +++A   E K +ELE+E+ TV+N L SLE+   K   +E+ YE  I+ L   L++ E +    ERS  KL++ I+   + L++ + K   I +E+D  L D TS+
Sbjct:   45 SLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284          
BLAST of SMED30021511 vs. Ensembl Human
Match: TPM1 (tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010])

HSP 1 Score: 95.9005 bits (237), Expect = 1.037e-21
Identity = 69/201 (34.33%), Postives = 117/201 (58.21%), Query Frame = 3
Query:  180 ELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER    +   A+   EK+E  + +LK+AK     A+ K  EV++KL  +E++ E+ +++A   E K +ELE+E+ TV+N L SLE+   K   +E+ YE  I+ L   L++ E +    ERS  KL++ I+   + L++ + K   I +E+D  L D TS+
Sbjct:   84 DVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284          
BLAST of SMED30021511 vs. Ensembl Celegans
Match: lev-11 (Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Swiss-Prot;Acc:Q22866])

HSP 1 Score: 99.3673 bits (246), Expect = 1.593e-23
Identity = 82/242 (33.88%), Postives = 136/242 (56.20%), Query Frame = 3
Query:   57 MDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            +D LK KM+Q +EE +      DE    L+E   +RE AE E+A+L R+  + E + ER+E        +LE+  K+ADE +R   +L+   +M +++  +L+ KL++ +      E K  EV++KL  VEA+ E+ +++A   E KI ELE+E+  V N L SLE +  K   RE+ YE  IR +   L++ E +    ERS QKL+++++   E   +   K  Q++ E+D M+ +  S+
Sbjct:   15 LDVLKKKMRQAREEAEAAKDEADEVKRQLEEERKKREDAEAEVAALNRRIVLVEEDLERTEDRLKTATSKLEQATKAADEADRSRRALSNQIDMDDDRCSDLERKLRECQSILHETENKAEEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSSRLKEAETRAEFAERSVQKLQKEVDRLEELRDAEVLKARQLQDELDHMVQELNSV 256          
BLAST of SMED30021511 vs. Ensembl Celegans
Match: lev-11 (Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Swiss-Prot;Acc:Q22866])

HSP 1 Score: 97.4413 bits (241), Expect = 8.932e-23
Identity = 80/236 (33.90%), Postives = 132/236 (55.93%), Query Frame = 3
Query:   57 MDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSML 764
            +D LK KM+Q +EE +      DE    L+E   +RE AE E+A+L R+  + E + ER+E        +LE+  K+ADE +R   +L+   +M +++  +L+ KL++ +      E K  EV++KL  VEA+ E+ +++A   E KI ELE+E+  V N L SLE +  K   RE+ YE  IR +   L++ E +    ERS QKL+++++   + L   + +   I +E+DS  
Sbjct:   15 LDVLKKKMRQAREEAEAAKDEADEVKRQLEEERKKREDAEAEVAALNRRIVLVEEDLERTEDRLKTATSKLEQATKAADEADRSRRALSNQIDMDDDRCSDLERKLRECQSILHETENKAEEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSSRLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKERYKTISEELDSTF 250          
BLAST of SMED30021511 vs. Ensembl Celegans
Match: lev-11 (Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Swiss-Prot;Acc:Q22866])

HSP 1 Score: 95.9005 bits (237), Expect = 2.457e-22
Identity = 84/245 (34.29%), Postives = 136/245 (55.51%), Query Frame = 3
Query:   57 MDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAE---MKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            +D LK KM+Q +EE +      DE    L+E   +RE AE E+A+L R+  + E + ER+E        +LE+  K+ADE +R   S+   ++   E+   L+ ++ +AK   V+AE    K  EV++KL  VEA+ E+ +++A   E KI ELE+E+  V N L SLE +  K   RE+ YE  IR +   L++ E +    ERS QKL+++++   E   +   K  Q++ E+D M+ +  S+
Sbjct:   15 LDVLKKKMRQAREEAEAAKDEADEVKRQLEEERKKREDAEAEVAALNRRIVLVEEDLERTEDRLKTATSKLEQATKAADEADRARKSMETRSQQDEERANFLETQVDEAK---VIAEDADRKYEEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSSRLKEAETRAEFAERSVQKLQKEVDRLEELRDAEVLKARQLQDELDHMVQELNSV 256          
BLAST of SMED30021511 vs. Ensembl Celegans
Match: lev-11 (Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Swiss-Prot;Acc:Q22866])

HSP 1 Score: 93.9745 bits (232), Expect = 1.338e-21
Identity = 82/239 (34.31%), Postives = 132/239 (55.23%), Query Frame = 3
Query:   57 MDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAE---MKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSML 764
            +D LK KM+Q +EE +      DE    L+E   +RE AE E+A+L R+  + E + ER+E        +LE+  K+ADE +R   S+   ++   E+   L+ ++ +AK   V+AE    K  EV++KL  VEA+ E+ +++A   E KI ELE+E+  V N L SLE +  K   RE+ YE  IR +   L++ E +    ERS QKL+++++   + L   + +   I +E+DS  
Sbjct:   15 LDVLKKKMRQAREEAEAAKDEADEVKRQLEEERKKREDAEAEVAALNRRIVLVEEDLERTEDRLKTATSKLEQATKAADEADRARKSMETRSQQDEERANFLETQVDEAK---VIAEDADRKYEEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSSRLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKERYKTISEELDSTF 250          
BLAST of SMED30021511 vs. Ensembl Celegans
Match: lev-11 (Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Swiss-Prot;Acc:Q22866])

HSP 1 Score: 89.3521 bits (220), Expect = 5.573e-20
Identity = 77/214 (35.98%), Postives = 121/214 (56.54%), Query Frame = 3
Query:   57 MDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAE---MKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDI 689
            +D LK KM+Q +EE +      DE    L+E   +RE AE E+A+L R+  + E + ER+E        +LE+  K+ADE +R   S+   ++   E+   L+ ++ +AK   V+AE    K  EV++KL  VEA+ E+ +++A   E KI ELE+E+  V N L SLE +  K   RE+ YE  IR +   L++ E +    ERS QKL++++
Sbjct:   15 LDVLKKKMRQAREEAEAAKDEADEVKRQLEEERKKREDAEAEVAALNRRIVLVEEDLERTEDRLKTATSKLEQATKAADEADRARKSMETRSQQDEERANFLETQVDEAK---VIAEDADRKYEEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRTVSSRLKEAETRAEFAERSVQKLQKEV 225          
BLAST of SMED30021511 vs. Ensembl Fly
Match: Tm1 (gene:FBgn0003721 transcript:FBtr0333917)

HSP 1 Score: 105.531 bits (262), Expect = 9.521e-26
Identity = 84/233 (36.05%), Postives = 135/233 (57.94%), Query Frame = 3
Query:   57 MDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMD 755
            +D LK KM+Q KEE+++     +E +  L+  V  RE AE+E+A+L R+ ++ E + ERSE        +L E  ++ADE ER+  +L     M ++K+  L+ +L  AK     A+ K  EV++KL  VEA+ E+ +++A Q E KI ELE+E+  V N L SLE +  K   REEEY+  I+ L   L++ E +    ERS QKL+++++   + +   + K   I QE++
Sbjct:   11 LDVLKKKMRQTKEEMEKYKDECEEFHKRLQLEVVRREEAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERIRKALENRTNMEDDKVALLENQLAQAKLIAEEADKKYEEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDEVSKGKEKYKTIAQELE 243          
BLAST of SMED30021511 vs. Ensembl Fly
Match: Tm1 (gene:FBgn0003721 transcript:FBtr0089960)

HSP 1 Score: 100.138 bits (248), Expect = 8.450e-24
Identity = 83/242 (34.30%), Postives = 141/242 (58.26%), Query Frame = 3
Query:   57 MDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            +D LK KM+Q KEE+++     +E +  L+  V  RE AE+E+A+L R+ ++ E + ERSE        +L E  ++ADE ER+  +L     M ++K+  L+ +L  AK     A+ K  EV++KL  +E + E+ +++    E KI ELE+E+  V N L SLE +  K   +EE +ET I+ L  SL++ E +    ERS QKL+++++   ++L + + K   +++EM++ L D  +M
Sbjct:   11 LDVLKKKMRQTKEEMEKYKDECEEFHKRLQLEVVRREEAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERIRKALENRTNMEDDKVALLENQLAQAKLIAEEADKKYEEVARKLVLMEQDLERSEEKVELSESKIVELEEELRVVGNNLKSLEVSEEKATQKEETFETQIKVLDHSLKEAEARAEFAERSVQKLQKEVDRLEDDLLNVRGKNKLLQEEMEATLHDIQNM 252          
BLAST of SMED30021511 vs. Ensembl Fly
Match: Tm1 (gene:FBgn0003721 transcript:FBtr0305656)

HSP 1 Score: 95.1301 bits (235), Expect = 5.511e-22
Identity = 80/233 (34.33%), Postives = 132/233 (56.65%), Query Frame = 3
Query:   57 MDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMD 755
            +D LK KM+Q KEE+++     +E +  L+  V  RE AE+E+A+L R+ ++ E + ERSE        +L E  ++ADE ER+  +L     M ++K+  L+ +L  AK     A+ K  EV++KL  +E + E+ +++    E KI ELE+E+  V N L SLE +  K   REEEY+  I+ L   L++ E +    ERS QKL+++++   + +   + K   I QE++
Sbjct:   11 LDVLKKKMRQTKEEMEKYKDECEEFHKRLQLEVVRREEAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERIRKALENRTNMEDDKVALLENQLAQAKLIAEEADKKYEEVARKLVLMEQDLERSEEKVELSESKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDEVSKGKEKYKTIAQELE 243          
BLAST of SMED30021511 vs. Ensembl Fly
Match: Tm1 (gene:FBgn0003721 transcript:FBtr0333918)

HSP 1 Score: 95.5153 bits (236), Expect = 8.634e-22
Identity = 78/235 (33.19%), Postives = 136/235 (57.87%), Query Frame = 3
Query:   54 QMDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDS 758
            ++ T++ ++ Q +E +  + G L+EKN +L       ++AE+E+A+L R+ ++ E + ERSE        +L E  ++ADE ER+  +L     M ++K+  L+ +L  AK     A+ K  EV++KL  VEA+ E+ +++A Q E KI ELE+E+  V N L SLE +  K   REEEY+  I+ L   L++ E +    ERS QKL+++++   ++L   + +   I  ++D+
Sbjct:   49 KIQTVENELDQTQEALTLVTGKLEEKNKAL-------QNAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERIRKALENRTNMEDDKVALLENQLAQAKLIAEEADKKYEEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDIGDDLDT 276          
BLAST of SMED30021511 vs. Ensembl Fly
Match: Tm1 (gene:FBgn0003721 transcript:FBtr0305654)

HSP 1 Score: 93.9745 bits (232), Expect = 3.143e-21
Identity = 78/235 (33.19%), Postives = 136/235 (57.87%), Query Frame = 3
Query:   54 QMDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDS 758
            ++ T++ ++ Q +E +  + G L+EKN +L       ++AE+E+A+L R+ ++ E + ERSE        +L E  ++ADE ER    L   A    E+++ L+ +LK+A+     A+ K  EV++KL  VEA+ E+ +++A Q E KI ELE+E+  V N L SLE +  K   REEEY+  I+ L   L++ E +    ERS QKL+++++   ++L   + +   I  ++D+
Sbjct:   49 KIQTVENELDQTQEALTLVTGKLEEKNKAL-------QNAESEVAALNRRIQLLEEDLERSEERLGSATAKLSEASQAADESERARKILENRALADEERMDALENQLKEARFLAEEADKKYDEVARKLAMVEADLERAEERAEQGENKIVELEEELRVVGNNLKSLEVSEEKANQREEEYKNQIKTLNTRLKEAEARAEFAERSVQKLQKEVDRLEDDLVLEKERYKDIGDDLDT 276          
BLAST of SMED30021511 vs. Ensembl Zebrafish
Match: tpm1 (tropomyosin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-040426-854])

HSP 1 Score: 108.612 bits (270), Expect = 1.220e-26
Identity = 87/245 (35.51%), Postives = 138/245 (56.33%), Query Frame = 3
Query:   57 MDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTER---EHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            ++ +K K++  +E+ D   G  D+     KE+  ER   E AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER    +   A    EK+E  + +LK+AK     A+ K  EV++KL  VE E E+ +++A   E K SELE+E+ TV+N L SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L+S + K   I +E+D  L D TSM
Sbjct:    6 LEAVKRKIKLLQEQAD---GAEDKAEKLQKELAHERKARETAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELNESKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTSM 247          
BLAST of SMED30021511 vs. Ensembl Zebrafish
Match: tpm1 (tropomyosin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-040426-854])

HSP 1 Score: 106.686 bits (265), Expect = 5.165e-26
Identity = 86/245 (35.10%), Postives = 138/245 (56.33%), Query Frame = 3
Query:   57 MDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTER---EHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            ++ +K K++  +E+ D   G  D+     KE+  ER   E AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER    +   A    EK+E  + +LK+AK     A+ K  EV++KL  VE E E+ +++A   E K SELE+E+ TV+N L SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L+S + K   I +E+D  L D TS+
Sbjct:    6 LEAVKRKIKLLQEQAD---GAEDKAEKLQKELAHERKARETAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELNESKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTSI 247          
BLAST of SMED30021511 vs. Ensembl Zebrafish
Match: tpm1 (tropomyosin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-040426-854])

HSP 1 Score: 104.76 bits (260), Expect = 5.654e-25
Identity = 83/230 (36.09%), Postives = 131/230 (56.96%), Query Frame = 3
Query:  102 DELHGVLDEKNNSLKEIVTERE---HAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            DE   VL+E  +  ++++T  E    AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER    +   A    EK+E  + +LK+AK     A+ K  EV++KL  VE E E+ +++A   E K SELE+E+ TV+N L SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L+S + K   I +E+D  L D TSM
Sbjct:   55 DERDKVLEEYQSVEEKLLTAEEVATKAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELNESKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTSM 284          
BLAST of SMED30021511 vs. Ensembl Zebrafish
Match: tpm1 (tropomyosin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-040426-854])

HSP 1 Score: 103.219 bits (256), Expect = 1.833e-24
Identity = 76/204 (37.25%), Postives = 118/204 (57.84%), Query Frame = 3
Query:  171 AENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER    +   A    EK+E  + +LK+AK     A+ K  EV++KL  VE E E+ +++A   E K SELE+E+ TV+N L SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L+S + K   I +E+D  L D TSM
Sbjct:   81 AEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELNESKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTSM 284          
BLAST of SMED30021511 vs. Ensembl Zebrafish
Match: tpm1 (tropomyosin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-040426-854])

HSP 1 Score: 101.679 bits (252), Expect = 6.669e-24
Identity = 75/204 (36.76%), Postives = 118/204 (57.84%), Query Frame = 3
Query:  171 AENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER    +   A    EK+E  + +LK+AK     A+ K  EV++KL  VE E E+ +++A   E K SELE+E+ TV+N L SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L+S + K   I +E+D  L D TS+
Sbjct:   81 AEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELNESKCSELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTSI 284          
BLAST of SMED30021511 vs. Ensembl Xenopus
Match: tpm1 (tropomyosin 1 [Source:NCBI gene;Acc:448541])

HSP 1 Score: 99.3673 bits (246), Expect = 9.321e-23
Identity = 72/205 (35.12%), Postives = 121/205 (59.02%), Query Frame = 3
Query:  171 AENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQ-AKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER  + + E   + +E+  ELQ  +LK+AK     A+ K  EV++KL  +E + E+ +++A   E K +ELE+E+ TV+N L SLE+   K   +E++YE  I+ L   L++ E +    ER+  KL++ I+   + L++ + K   I +E+D  L D TSM
Sbjct:   93 AEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESER-GMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERAEERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERTVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSM 296          
BLAST of SMED30021511 vs. Ensembl Xenopus
Match: tpm1 (tropomyosin 1 [Source:NCBI gene;Acc:448541])

HSP 1 Score: 97.4413 bits (241), Expect = 3.277e-22
Identity = 71/205 (34.63%), Postives = 121/205 (59.02%), Query Frame = 3
Query:  171 AENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQ-AKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER  + + E   + +E+  ELQ  +LK+AK     A+ K  EV++KL  +E + E+ +++A   E K +ELE+E+ TV+N L SLE+   K   +E++YE  I+ L   L++ E +    ER+  KL++ I+   + L++ + K   I +E+D  L D TS+
Sbjct:   81 AEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESER-GMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERAEERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERTVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284          
BLAST of SMED30021511 vs. Ensembl Xenopus
Match: gucy2d (guanylate cyclase 2D, membrane (retina-specific) [Source:Xenbase;Acc:XB-GENE-1014102])

HSP 1 Score: 87.8113 bits (216), Expect = 6.245e-19
Identity = 78/241 (32.37%), Postives = 137/241 (56.85%), Query Frame = 3
Query:   63 TLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQ-AKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
             L+ K++  ++E+D+    L +    L++   +   AE E+A+L R+ ++ E   +R++      L++LEE  K+ADE ER  + + E   M +E+  E+Q  +LK+AK     A+ K  EV++KL  +E E E+ +++A   E K S+LE+E+  V+N L SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L++ + K   I +E+D  L D TS+
Sbjct:   45 ALQKKLKGTEDELDKYSEALKDAQEKLEQADKKATDAEGEVAALNRRIQLVEEELDRAQERLATALQKLEEAEKAADESER-GMKVIENRAMKDEEKMEIQELQLKEAKHIAEEADRKYEEVARKLVILEGELERAEERAEVSELKCSDLEEELKNVTNNLKSLEAQSEKYSEKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSL 284          
BLAST of SMED30021511 vs. Ensembl Xenopus
Match: tpm1 (tropomyosin 1 [Source:NCBI gene;Acc:448541])

HSP 1 Score: 87.4261 bits (215), Expect = 1.207e-18
Identity = 65/189 (34.39%), Postives = 111/189 (58.73%), Query Frame = 3
Query:  159 EREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQ-AKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQ 722
            +RE AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER  + + E   + +E+  ELQ  +LK+AK     A+ K  EV++KL  +E + E+ +++A   E K +ELE+E+ TV+N L SLE+   K   +E++YE  I+ L   L++ E +    ER+  KL++ I+   + +   Q
Sbjct:   41 QREAAEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESER-GMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERAEERAELSESKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERTVAKLEKTIDDLEDKMLCLQ 228          
BLAST of SMED30021511 vs. Ensembl Xenopus
Match: tpm1 (tropomyosin 1 [Source:NCBI gene;Acc:448541])

HSP 1 Score: 87.0409 bits (214), Expect = 1.418e-18
Identity = 69/205 (33.66%), Postives = 116/205 (56.59%), Query Frame = 3
Query:  171 AENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQ-AKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER  + + E   + +E+  ELQ  +LK+AK     A+ K  EV++KL  +E + E      ++    I+ LE+E+ TV+N L SLE+   K   +E++YE  I+ L   L++ E +    ER+  KL++ I+   + L++ + K   I +E+D  L D TSM
Sbjct:   81 AEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESER-GMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLELCFSSFSE----INTLEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERTVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSM 280          
BLAST of SMED30021511 vs. Ensembl Mouse
Match: Tpm3 (tropomyosin 3, gamma [Source:MGI Symbol;Acc:MGI:1890149])

HSP 1 Score: 100.523 bits (249), Expect = 8.281e-24
Identity = 74/207 (35.75%), Postives = 118/207 (57.00%), Query Frame = 3
Query:  162 REHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            RE AE E+ASL R+ ++ E   +R++      L++LEE  K+ADE ER    +   A    EK+E  + +LK+AK     A+ K  EV++KL  +E + E+ +++A   E K SELE+E+  V+N L SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L++ + K   I  E+D  L D TS+
Sbjct:   42 REQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISDELDHALNDMTSI 248          
BLAST of SMED30021511 vs. Ensembl Mouse
Match: Tpm1 (tropomyosin 1, alpha [Source:MGI Symbol;Acc:MGI:98809])

HSP 1 Score: 100.523 bits (249), Expect = 1.744e-23
Identity = 78/240 (32.50%), Postives = 137/240 (57.08%), Query Frame = 3
Query:   63 TLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            +L+ K++  ++E+D+    L +    L+    +   AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER    +   A+   EK+E  + +LK+AK     A+ K  EV++KL  +E++ E+ +++A   E K +ELE+E+ TV+N L SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L++ + K   I +E+D  L D TSM
Sbjct:   45 SLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSM 284          
BLAST of SMED30021511 vs. Ensembl Mouse
Match: Tpm1 (tropomyosin 1, alpha [Source:MGI Symbol;Acc:MGI:98809])

HSP 1 Score: 98.9821 bits (245), Expect = 7.235e-23
Identity = 77/240 (32.08%), Postives = 137/240 (57.08%), Query Frame = 3
Query:   63 TLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            +L+ K++  ++E+D+    L +    L+    +   AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER    +   A+   EK+E  + +LK+AK     A+ K  EV++KL  +E++ E+ +++A   E K +ELE+E+ TV+N L SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L++ + K   I +E+D  L D TS+
Sbjct:   45 SLQKKLKGTEDELDKYSEALKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAEERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284          
BLAST of SMED30021511 vs. Ensembl Mouse
Match: Tpm3 (tropomyosin 3, gamma [Source:MGI Symbol;Acc:MGI:1890149])

HSP 1 Score: 93.2041 bits (230), Expect = 6.988e-21
Identity = 79/244 (32.38%), Postives = 138/244 (56.56%), Query Frame = 3
Query:   54 QMDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQ-AKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            ++ T++ K++  ++E+D+    L +    L+    +   AE E+ASL R+ ++ E   +R++      L++LEE  K+ADE ER  + + E   + +E+  ELQ  +LK+AK     A+ K  EV++KL  +E + E+ +++A   E K SELE+E+  V+N L SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L++ + K   I  E+D  L D TS+
Sbjct:   42 ELATMQKKLKGTEDELDKYSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESER-GMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISDELDHALNDMTSI 284          
BLAST of SMED30021511 vs. Ensembl Mouse
Match: Tpm3 (tropomyosin 3, gamma [Source:MGI Symbol;Acc:MGI:1890149])

HSP 1 Score: 92.4337 bits (228), Expect = 7.586e-21
Identity = 69/186 (37.10%), Postives = 110/186 (59.14%), Query Frame = 3
Query:  162 REHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQ-AKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHS 716
            RE AE E+ASL R+ ++ E   +R++      L++LEE  K+ADE ER  + + E   + +E+  ELQ  +LK+AK     A+ K  EV++KL  +E + E+ +++A   E K SELE+E+  V+N L SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   E L+S
Sbjct:   42 REQAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESER-GMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEERLYS 226          
BLAST of SMED30021511 vs. UniProt/SwissProt
Match: sp|Q9NFZ4|TPM_LEPDS (Tropomyosin OS=Lepidoglyphus destructor OX=36936 PE=1 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 8.105e-26
Identity = 84/238 (35.29%), Postives = 136/238 (57.14%), Query Frame = 3
Query:   66 LKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATS 779
            L+ K+QQ + E+D++   L + N  L+E     + AE ++A+L R+ ++ E + ERSE    I   +LEE  +SADE ER+   L   +    E++E L+++LK+A+     A+ K  EV++KL  VEA+ E+ +++A   E KI ELE+E+  V N L SLE +  K + REE YE  IR +   L++ E +    ERS QKL+++++   + L   + K   I  E+D   A+ T 
Sbjct:   46 LQKKIQQIENELDQVQESLTQANTKLEEKEKSLQTAEGDVAALNRRIQLIEEDLERSEGRLKIATSKLEEASQSADESERMRKMLEHRSITDEERMEGLESQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTTKLKEAEARAEFAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTG 283          
BLAST of SMED30021511 vs. UniProt/SwissProt
Match: sp|Q23939|TPM_DERFA (Tropomyosin OS=Dermatophagoides farinae OX=6954 PE=1 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 3.079e-24
Identity = 83/239 (34.73%), Postives = 134/239 (56.07%), Query Frame = 3
Query:   63 TLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATS 779
             L+ K+QQ + E+D++   L   N  L+E     + AE ++A+L R+ ++ E + ERSE    I   +LEE  +SADE ER+   L   +    E+++ L+ +LK+A+     A+ K  EV++KL  VEA+ E+ +++A   E KI ELE+E+  V N L SLE +  K + REE YE  IR +   L++ E +    ERS QKL+++++   + L   + K   I  E+D   A+ T 
Sbjct:   45 ALQKKIQQIENELDQVQEQLSAANTKLEEKEKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSADESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYEQQIRIMTAKLKEAEARAEFAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTG 283          
BLAST of SMED30021511 vs. UniProt/SwissProt
Match: sp|Q95VA8|TPM_TRISP (Tropomyosin OS=Trichinella spiralis OX=6334 PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 6.794e-24
Identity = 82/232 (35.34%), Postives = 135/232 (58.19%), Query Frame = 3
Query:   60 DTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMD 755
            DT K KM Q + E+D+    L   N  L+E   + + AE E+A+L R+ ++ E +FER+E   +I  ++L E  ++ADE ER+   +   +    E++ +L+A+LK+A+     A+ K  EV++KL  VEA+ E+ +++A   E KI ELE+E+  V N L SLE +  K   RE+ YE  IR L + L++ E +    ERS QKL+++++   + L   + K   I +E+D
Sbjct:   45 DTQK-KMMQVENELDKAQEELTGANAQLEEKEKKVQEAEAEVAALNRRIQLLEEDFERAEERLIIATEKLGEASQTADESERVRKVMENRSLQDEERVYQLEAQLKEAQLLAEEADRKYDEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRLLTQRLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKEKYKAISEELD 275          
BLAST of SMED30021511 vs. UniProt/SwissProt
Match: sp|Q8WR63|TPM_TRIPS (Tropomyosin OS=Trichinella pseudospiralis OX=6337 PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 6.862e-24
Identity = 83/232 (35.78%), Postives = 135/232 (58.19%), Query Frame = 3
Query:   60 DTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMD 755
            DT K KM Q + E+D+    L   N  L+E   + + AE E+A+L R+ ++ E +FER+E    I  ++LEE  ++ADE ER+   +   +    E++ +L+A+LK+A+     A+ K  EV++KL  VEA+ E+ +++A   E KI ELE+E+  V N L SLE +  K   RE+ YE  IR L + L++ E +    ERS QKL+++++   + L   + K   I +E+D
Sbjct:   45 DTQK-KMMQVENELDKAQEELTGANAQLEEKEKKVQEAEAEVAALNRRIQLLEEDFERAEERLKIATEKLEEASQTADESERVRKVMENRSLQDEERVYQLEAQLKEAQLLAEEADRKYDEVARKLAMVEADLERAEERAEAGENKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRLLTQRLKEAETRAEFAERSVQKLQKEVDRLEDELVHEKEKYKAISEELD 275          
BLAST of SMED30021511 vs. UniProt/SwissProt
Match: sp|Q3BJY7|TPM_PSOOV (Tropomyosin OS=Psoroptes ovis OX=83912 PE=1 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.074e-23
Identity = 82/238 (34.45%), Postives = 134/238 (56.30%), Query Frame = 3
Query:   66 LKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATS 779
            L+ K+QQ + E+D++   L   N  L+E     + AE ++A+L R+ ++ E + ERSE    I   +LEE  +SADE ER+   L   +    E+++ L+ +LK+A+     A+ K  EV++KL  VEA+ E+ +++A   E KI ELE+E+  V N L SLE +  K + REE +E  IR +   L++ E +    ERS QKL+++++   + L   + K   I  E+D   A+ T 
Sbjct:   46 LQKKIQQIENELDQVQEQLSAANTKLEEKKKALQTAEGDVAALNRRIQLIEEDLERSEERLKIATAKLEEASQSADESERMRKMLEHRSITDEERMDGLENQLKEARMMAEDADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAHEQQIRIMTAKLKEAEARAEFAERSVQKLQKEVDRLEDELVHEKEKYKSISDELDQTFAELTG 283          
BLAST of SMED30021511 vs. TrEMBL
Match: A0A1D1UW49 (Uncharacterized protein OS=Ramazzottius varieornatus OX=947166 GN=RvY_05755 PE=3 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 5.337e-25
Identity = 86/250 (34.40%), Postives = 142/250 (56.80%), Query Frame = 3
Query:   39 HFNIIQMDTLKIKMQQFKEEIDELHGVLD--EKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            H     +D LK KM+Q KEE++      +  EK ++L+  +  RE AE E+A+L R+ ++ E + ER+E        +LEE   +ADE ER   +L   + + ++++ +L+ +L  A+     A+ K  EV++KL  VEA+ E+ +++A   E KI ELE+E+  V N L SLE +  K   RE+ YE  IR +   L++ E +    ERS QKL+++++   + L + + KC  + +EM+S L D  SM
Sbjct:    4 HTQGSMLDILKKKMRQAKEEMENARDSAEEAEKRHALE--IRRREDAEAEVAALNRRIQLLEEDLERTEERLKSATSKLEEACAAADESERARRALENRSNIEDDRITQLETQLAQARALAEEADRKYEEVARKLVMVEADLERAEERAEAGEMKIVELEEELRVVGNNLKSLEVSEEKALQREDSYEEQIRVMTTRLKEAETRAEFAERSVQKLQKEVDRLEDELVAEKEKCKALTEEMESTLQDIQSM 251          
BLAST of SMED30021511 vs. TrEMBL
Match: A0A3B3CVC9 (Tropomyosin 1 OS=Oryzias melastigma OX=30732 GN=TPM1 PE=3 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.095e-24
Identity = 86/247 (34.82%), Postives = 138/247 (55.87%), Query Frame = 3
Query:   45 NIIQMDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQ-AKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
             I  +D +K K++  +E+ D      +     L E    REHAE E+ASL R+ ++ E   +R++      L +LEE  K+ADE ER  + + E   M +E+  E+Q  +LK+AK     A+ K  EV++KL  +E + E+ +++A   E K SELE+E+ TV+N L SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L+S + K   I +E+D  L D TS+
Sbjct:    3 GIGSLDAVKRKIRSLQEQADGAEERAERLQKELLEYRKAREHAEGEVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAADESER-GMKVIENRAMKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSLKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTSI 248          
BLAST of SMED30021511 vs. TrEMBL
Match: A0A293MYJ1 (CRE-LEV-11 protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=3 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.491e-24
Identity = 80/239 (33.47%), Postives = 138/239 (57.74%), Query Frame = 3
Query:   63 TLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATS 779
            +L+ K+QQ + ++D++   L + NN L+E     + AE ++A+L R+ ++ E + ERSE    +  ++LEE  ++ADE ER+   L   +    E+++ L+ +LK+A+     A+ K  EV++KL  VEA+ E+ +++A   E KI ELE+E+  V N L SLE +  K + REE YET I  +   L++ E +    ERS QKL+++++   + L   + K   I  E+D   ++ T 
Sbjct:   45 SLQKKIQQIENDLDQVQEQLSQANNKLEEKDKALQQAEADVAALNRRIQLLEEDLERSEERLKVATQKLEEASQAADESERMRKMLEHRSITDEERMDGLEGQLKEARLMAEDADRKYDEVARKLAMVEADLERAEERAETGETKIVELEEELRVVGNNLKSLEVSEEKAQQREESYETQIVTMTAKLKEAEARAEFSERSVQKLQKEVDRLEDELVQEKEKYKAISDELDQTFSELTG 283          
BLAST of SMED30021511 vs. TrEMBL
Match: A5D6I0 (Tropomyosin OS=Ammothea hilgendorfi OX=258330 PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 1.536e-24
Identity = 80/231 (34.63%), Postives = 137/231 (59.31%), Query Frame = 3
Query:   63 TLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMD 755
            TL+ K+QQ + E+D+    L + NN+L E     + AE E+A+L R+ ++ E + ERSE+  +   ++L E  ++ADE ER+   L   +    E+++ L+ +LK+A+     A+ K  EV++KL  VEA+ E+ +++A   E KI ELE+E+  V N L SLE +  K   REE YE +IR L   L++ E +    ERS QKL+++++   ++L + + K  ++  ++D
Sbjct:   45 TLQKKIQQIENELDQAQEGLLQANNNLDEKDKALQTAEGEVAALNRRIQLIEDDLERSETRLVSATEKLAEASQAADESERMRKMLEHRSITDEERMDGLENQLKEARGMAEEADRKYDEVARKLAMVEADLERAEERAEGGETKIVELEEELRVVGNNLKSLEVSEEKAIQREEGYEMSIRTLTSKLKEAEARAEFSERSVQKLQKEVDRLEDDLVNEKEKYKEVSDDLD 275          
BLAST of SMED30021511 vs. TrEMBL
Match: A0A2I9LPV7 (Tropomyosin OS=Centruroides hentzi OX=88313 PE=3 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 2.055e-24
Identity = 84/239 (35.15%), Postives = 140/239 (58.58%), Query Frame = 3
Query:   63 TLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATS 779
             L+ K+QQ + E+D++   L + N+ L+E     ++AE E+A+L R+ ++ E + ERSE    IT ++LEE  ++ADE ER+   L   +    E+++ L+ +LK+A+     A+ K  EV++KL  VEA+ E+ +++A   E KI ELE+E+  V N L SLE +  K + REE YET IR +   L++ E +    ERS QKL+++++   + L   + K   I  ++D   A+ T 
Sbjct:   45 ALQKKIQQIENELDQVQEQLAQANSKLEEKDKALQNAEGEVAALNRRIQLIEEDLERSEEKLKITTQKLEEVSQAADESERMRKMLEHRSITDEERMDGLECQLKEARVMAEDADRKYDEVARKLAMVEADLERAEERAETGESKIVELEEELRVVGNNLKSLEVSEEKAQQREEAYETQIRSMTSRLKEAEARAEFAERSVQKLQKEVDRLEDELIHEKEKYKAISDDLDQTFAELTG 283          
BLAST of SMED30021511 vs. Ensembl Cavefish
Match: tpm1 (tropomyosin 1 [Source:NCBI gene;Acc:103046255])

HSP 1 Score: 102.449 bits (254), Expect = 3.454e-24
Identity = 75/205 (36.59%), Postives = 122/205 (59.51%), Query Frame = 3
Query:  171 AENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQ-AKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER  + + E   + +E+  ELQ  +LK+AK     A+ K  EV++KL  VE E E+ +++A   E K +ELE+E+ TV+NTL SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L++ + K   I +E+D  L D TS+
Sbjct:   81 AEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESER-GMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELSESKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284          
BLAST of SMED30021511 vs. Ensembl Cavefish
Match: tpm1 (tropomyosin 1 [Source:NCBI gene;Acc:103046255])

HSP 1 Score: 102.449 bits (254), Expect = 3.454e-24
Identity = 75/205 (36.59%), Postives = 122/205 (59.51%), Query Frame = 3
Query:  171 AENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQ-AKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER  + + E   + +E+  ELQ  +LK+AK     A+ K  EV++KL  VE E E+ +++A   E K +ELE+E+ TV+NTL SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L++ + K   I +E+D  L D TS+
Sbjct:   81 AEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESER-GMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELSESKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSI 284          
BLAST of SMED30021511 vs. Ensembl Cavefish
Match: tpma (tropomyosin alpha-1 chain [Source:NCBI gene;Acc:103040917])

HSP 1 Score: 101.679 bits (252), Expect = 6.423e-24
Identity = 75/204 (36.76%), Postives = 118/204 (57.84%), Query Frame = 3
Query:  171 AENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER    +   A    EK+E  + +LK+AK     A+ K  EV++KL  VE E E+ +++A   E K SELE+E+ TV+N L SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L+S + K   I +E+D  L D TS+
Sbjct:   81 AEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELNEGKCSELEEELKTVTNLLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTSI 284          
BLAST of SMED30021511 vs. Ensembl Cavefish
Match: tpm2 (tropomyosin 2 (beta) [Source:ZFIN;Acc:ZDB-GENE-040625-114])

HSP 1 Score: 92.0485 bits (227), Expect = 1.431e-20
Identity = 73/239 (30.54%), Postives = 135/239 (56.49%), Query Frame = 3
Query:   66 LKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            L+ K++  ++E+D+    L +    L++   +   AE E+ASL R+ ++ E   +R++      L++LEE  K+ADE ER    +   A    EK+E  + +LK+AK     A+ K  EV++KL  +E + E+ +++A   E K  +LE+E+  V+N L SLE+   K  ++E++YE  I+ L + L++ E +    ERS  KL++ I+   + +++ + K   + +E+D  L D T++
Sbjct:   46 LQKKLKGVEDELDKYSESLKDAQEKLEQAEKKATDAEAEVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRATKDEEKMELQEMQLKEAKHIAEEADRKYEEVARKLVILEGDLERSEERAEVAEAKSGDLEEELKNVTNNLKSLEAQAEKYSTKEDKYEEEIKVLTEKLKEAETRAEFAERSVAKLEKTIDDLEDEVYAQKLKGKALSEELDLALNDMTTL 284          
BLAST of SMED30021511 vs. Ensembl Cavefish
Match: tpm1 (tropomyosin 1 [Source:NCBI gene;Acc:103046255])

HSP 1 Score: 88.9669 bits (219), Expect = 1.463e-19
Identity = 69/204 (33.82%), Postives = 115/204 (56.37%), Query Frame = 3
Query:  171 AENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER    +   A    EK+E  + +LK+AK     A+ K  EV++KL  VE E E+ +++A   E K +ELE+E+ TV+NTL SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L   + +   + Q ++  L +  +M
Sbjct:   81 AEGDVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELSESKCAELEEELKTVTNTLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDKLSHAKEENLDMNQMLEQTLLELNNM 284          
BLAST of SMED30021511 vs. Ensembl Sea Lamprey
Match: tpm3 (tropomyosin 3 [Source:ZFIN;Acc:ZDB-GENE-030826-16])

HSP 1 Score: 91.2781 bits (225), Expect = 1.169e-21
Identity = 67/205 (32.68%), Postives = 117/205 (57.07%), Query Frame = 3
Query:  168 HAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
             AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER    +   A    EK+E  + +LK+AK     ++ K  EV++KL  +E + E+ +++A   + K SELE+E+  V+N L SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + +++ + K   + +E+D  L D TS+
Sbjct:    1 QAEADVASLNRRIQLVEEELDRAQERLSTALQKLEEAEKAADESERGMKVIENRASKDEEKMELQEIQLKEAKHIAEESDRKYEEVARKLVILEGDLERTEERAEVADAKCSELEEELKVVTNNLKSLEAQSDKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKSIDDLEDEVYAQKLKYKSVSEELDLALNDMTSI 205          
BLAST of SMED30021511 vs. Ensembl Sea Lamprey
Match: TPM4 (tropomyosin 4 [Source:HGNC Symbol;Acc:HGNC:12013])

HSP 1 Score: 83.9593 bits (206), Expect = 4.381e-19
Identity = 65/206 (31.55%), Postives = 116/206 (56.31%), Query Frame = 3
Query:  168 HAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQ-AKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
             AE ++ASL R+ ++ E   +R++      L++LEE  K+ADE ER  + + E   + +E+  ELQ  +LK+AK     A+ K  EV++KL  +E E E+ +++A   E ++ +LE+E+  +   + SL     +   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L+S + K   I +E+D  L D T++
Sbjct:    2 QAEADVASLNRRIQLVEEELDRAQERLATALQKLEEATKAADESER-GMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGELERTEERAEVGETRVRQLEEELRVMDQNMKSLLVAEEQYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTAI 206          
BLAST of SMED30021511 vs. Ensembl Sea Lamprey
Match: TPM4 (tropomyosin 4 [Source:HGNC Symbol;Acc:HGNC:12013])

HSP 1 Score: 68.9366 bits (167), Expect = 4.426e-14
Identity = 54/175 (30.86%), Postives = 98/175 (56.00%), Query Frame = 3
Query:  168 HAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIE 692
             AE ++ASL R+ ++ E   +R++      L++LE+  K+ADE ER    +   A    EK+E  + +LK+AK     A+ K  EV++KL  +E + E+ +++A   E ++ ++E E+  V   L SL ++  +   +E++YE  I+ L   L++ E +    ERS  KL++ I+
Sbjct:    1 QAEADVASLNRRIQLVEEELDRAQERLTTALQKLEDAEKAADESERGMKVIENRAGKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIEGDLERTEERAEISETRVRQMEDELRHVQEELRSLFASEEQYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTID 175          
BLAST of SMED30021511 vs. Ensembl Nematostella
Match: EDO37230 (Predicted protein; Tropomyosin [Source:UniProtKB/TrEMBL;Acc:Q6S5G5])

HSP 1 Score: 75.0998 bits (183), Expect = 2.042e-15
Identity = 75/242 (30.99%), Postives = 127/242 (52.48%), Query Frame = 3
Query:   57 MDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            M+T+K KM   ++ +++      +  + LK      + AE E+A+L +Q +  E + + +ES    T  +L E  K ADE ER    L        E+L  L+ +  DA +    AE +  E+S++L  +E E E+ +++A   E ++ ELE+E+  V N L SLE +  K   RE+ YE  IR+L   L+D EE+    E+  Q+L+   E+    L   + +  ++K+E+DS LA+ + M
Sbjct:    1 METIKKKMATLRQTLEDAEARAAKAEDELKNANDRADSAETEVAALTKQLQQLEDDLDAAESKLADTQGQLTEAEKQADESERARKVLENRGASDEERLASLERQYNDALERTEEAEKQYEEISERLQELENELEEAEQKADAAEARVKELEEEVTLVGNNLRSLEISEGKASEREDTYENQIRELETKLQDAEERAEKAEQKVQELEAQAEAMEAELEKAKEQYEKVKEELDSTLAELSEM 242          
BLAST of SMED30021511 vs. Ensembl Medaka
Match: TPM1 (tropomyosin 1 [Source:NCBI gene;Acc:101168205])

HSP 1 Score: 108.997 bits (271), Expect = 6.964e-27
Identity = 84/247 (34.01%), Postives = 140/247 (56.68%), Query Frame = 3
Query:   45 NIIQMDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQ-AKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
             +  +D +K K++  +E+ D      +     L E    REHAE+++ASL R+ ++ E   +R++      L +LEE  K+ADE ER  + + E   M +E+  E+Q  +LK+AK     A+ K  EV++KL  +E++ E+ +++A   E K SELE+E+ TV+N L SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L+S + K   I +E+D  L D TS+
Sbjct:    3 GVSSVDAVKRKIRSLQEQADGAEERAERLQKELLEYRKAREHAESDVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAADESER-GMKVIENRAMKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTEERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSLKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTSI 248          
BLAST of SMED30021511 vs. Ensembl Medaka
Match: ENSORLT00000046199.1 (tropomyosin alpha-1 chain [Source:NCBI gene;Acc:101164789])

HSP 1 Score: 103.219 bits (256), Expect = 8.356e-25
Identity = 82/243 (33.74%), Postives = 137/243 (56.38%), Query Frame = 3
Query:   57 MDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQ-AKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            ++ +K K++  +E+ D       +    L +  + RE AE ++ASL R+ ++ E   +R++      L +LEE  K+ADE ER  + + E   M +E+  ELQ  +LK+AK     A+ K  EV++KL  +E++ E+ +++A   E K SELE+E+ TV N L SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L+S + K   I +E+D  L D TS+
Sbjct:    7 LEAVKKKIKSLQEQADAAEERAAQLQRDLNQERSAREAAEGDVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAADESER-GMKVIENRAMKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTEERAELSEGKCSELEEELKTVQNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTSI 248          
BLAST of SMED30021511 vs. Ensembl Medaka
Match: ENSORLT00000015429.2 (tropomyosin alpha-1 chain [Source:NCBI gene;Acc:101164789])

HSP 1 Score: 99.3673 bits (246), Expect = 3.493e-23
Identity = 75/205 (36.59%), Postives = 120/205 (58.54%), Query Frame = 3
Query:  171 AENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQ-AKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            AE ++ASL R+ ++ E   +R++      L +LEE  K+ADE ER  + + E   M +E+  ELQ  +LK+AK     A+ K  EV++KL  +E++ E+ +++A   E K SELE+E+ TV N L SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L+S + K   I +E+D  L D TS+
Sbjct:   81 AEGDVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAADESER-GMKVIENRAMKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTEERAELSEGKCSELEEELKTVQNNLKSLEAQAEKYSQKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTSI 284          
BLAST of SMED30021511 vs. Ensembl Medaka
Match: TPM1 (tropomyosin 1 [Source:NCBI gene;Acc:101168205])

HSP 1 Score: 98.2117 bits (243), Expect = 8.687e-23
Identity = 74/205 (36.10%), Postives = 122/205 (59.51%), Query Frame = 3
Query:  171 AENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQ-AKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            AE+++ASL R+ ++ E   +R++      L +LEE  K+ADE ER  + + E   M +E+  E+Q  +LK+AK     A+ K  EV++KL  +E++ E+ +++A   E K SELE+E+ TV+N L SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L+S + K   I +E+D  L D TS+
Sbjct:   81 AESDVASLNRRIQLVEEELDRAQERLATALTKLEEAEKAADESER-GMKVIENRAMKDEEKMEIQEIQLKEAKHIAEEADRKYEEVARKLVIIESDLERTEERAELSEGKCSELEEELKTVTNNLKSLEAQAEKYSLKEDKYEEEIKVLTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYSQKLKYKAISEELDHALNDMTSI 284          
BLAST of SMED30021511 vs. Ensembl Medaka
Match: ENSORLT00000013757.2 (tropomyosin 3 [Source:NCBI gene;Acc:101175579])

HSP 1 Score: 96.6709 bits (239), Expect = 3.274e-22
Identity = 72/201 (35.82%), Postives = 116/201 (57.71%), Query Frame = 3
Query:  183 LASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQ-AKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            +ASL R+ ++ E   +R++      L++LEE  K+ADE ER    + E   + +E+  ELQ  +LK+AK     A+ K  EV++KL  VE E E+ +++A   E K +ELE+E+  V+N L SLE+   K   +E++YE  I+ L   L++ E +    ERS  KL++ I+   + L++ + K   I +E+D  L D TSM
Sbjct:   85 VASLNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERRKEIVIENRALKDEEKMELQEIQLKEAKHIAEEADRKYEEVARKLVIVEGELERTEERAELAEAKCAELEEELKNVTNNLKSLEAQAEKYSQKEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISEELDHALNDMTSM 285          
BLAST of SMED30021511 vs. Planmine SMEST
Match: SMESG000038232.1 (SMESG000038232.1)

HSP 1 Score: 477.633 bits (1228), Expect = 2.261e-170
Identity = 242/242 (100.00%), Postives = 242/242 (100.00%), Query Frame = 3
Query:   57 MDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            MDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM
Sbjct:    1 MDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 242          
BLAST of SMED30021511 vs. Planmine SMEST
Match: SMESG000038232.1 (SMESG000038232.1)

HSP 1 Score: 464.151 bits (1193), Expect = 4.232e-165
Identity = 235/235 (100.00%), Postives = 235/235 (100.00%), Query Frame = 3
Query:   78 MQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 782
            MQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM
Sbjct:    1 MQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM 235          
BLAST of SMED30021511 vs. Planmine SMEST
Match: SMESG000074053.1 (SMESG000074053.1)

HSP 1 Score: 95.5153 bits (236), Expect = 6.614e-22
Identity = 79/242 (32.64%), Postives = 133/242 (54.96%), Query Frame = 3
Query:   57 MDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSN-EKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATS 779
            M  L+  +Q  + E DE    L E N  L+        AE E+A+L R+ ++ E++ E++ES +     +LEE  K+A+E E+ N  + ET  +++ EKL +L+ ++K+AK     A+ K  EV++KL   E + E+ + +    E K  ELE+E+  V N + SLE +  +   REE YE TIRDL + L+  E++    ER   KL+ +++   ++L S + K   +  E+D+  A+ T 
Sbjct:   43 MQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQEASAKLEEASKNAEESEK-NRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTLELEEELKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKAAEQRATEAERQVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 283          
BLAST of SMED30021511 vs. Planmine SMEST
Match: SMESG000074053.1 (SMESG000074053.1)

HSP 1 Score: 95.1301 bits (235), Expect = 7.113e-22
Identity = 79/242 (32.64%), Postives = 133/242 (54.96%), Query Frame = 3
Query:   57 MDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSN-EKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATS 779
            M  L+  +Q  + E DE    L E N  L+        AE E+A+L R+ ++ E++ E++ES +     +LEE  K+A+E E+ N  + ET  +++ EKL +L+ ++K+AK     A+ K  EV++KL   E + E+ + +    E K  ELE+E+  V N + SLE +  +   REE YE TIRDL + L+  E++    ER   KL+ +++   ++L S + K   +  E+D+  A+ T 
Sbjct:   36 MQELQKALQTAQTECDEAQEALAEANTKLEATEKRATDAEAEVAALTRRIQLIEADLEQTESRFQEASAKLEEASKNAEESEK-NRKILETRSIADDEKLAQLEEQVKEAKYIAEDADRKYDEVARKLAIAEVDLERTEARLENCESKTLELEEELKVVGNNMKSLEISEQEAAQREESYEDTIRDLTERLKAAEQRATEAERQVSKLQSEVDRLEDDLLSEKEKYKALSDELDTAFAELTG 276          
BLAST of SMED30021511 vs. Planmine SMEST
Match: SMESG000000190.1 (SMESG000000190.1)

HSP 1 Score: 84.3445 bits (207), Expect = 4.624e-18
Identity = 71/241 (29.46%), Postives = 126/241 (52.28%), Query Frame = 3
Query:   57 MDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQFKVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLEELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISELEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNFERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATS 779
            M  L+ K+QQ + + +     L E N++L+        AE E+ ++ ++ ++ E + E++E+       + EE  K+ADE ER    L   +    E+L +L+ +LK+AK     A+ K  E ++KL   E + E+ + +    + K+ ELE+E+  V N + SLE +  +   REE YE TIRD    L+ TE++    ER    L+ +++   + L + + K  Q+ +E+DS  A+ T 
Sbjct:   43 MQELQKKLQQVQTDCETAKEALKEVNSNLEATEKRAAEAEGEVQAMTKRTRLLEDDLEQTETRLQEATVKYEEASKAADESERGRKVLETRSIADEERLAQLEEQLKEAKYIAEDADRKYDEAARKLAITEVDLERAESRLESADNKVLELEEELRVVGNNMKSLEISEQEAVQREEVYEETIRDFTDKLKSTEQRATEAERQVATLQTEVDRIEDELLAEKEKYKQLSEELDSAFAELTG 283          
The following BLAST results are available for this feature:
BLAST of SMED30021511 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TPM11.357e-2435.75tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010][more]
TPM17.061e-2435.27tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010][more]
TPM13.002e-2332.50tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010][more]
TPM11.257e-2232.08tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010][more]
TPM11.037e-2134.33tropomyosin 1 [Source:HGNC Symbol;Acc:HGNC:12010][more]
back to top
BLAST of SMED30021511 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lev-111.593e-2333.88Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Sw... [more]
lev-118.932e-2333.90Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Sw... [more]
lev-112.457e-2234.29Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Sw... [more]
lev-111.338e-2134.31Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Sw... [more]
lev-115.573e-2035.98Tropomyosin isoforms a/b/d/f [Source:UniProtKB/Sw... [more]
back to top
BLAST of SMED30021511 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tm19.521e-2636.05gene:FBgn0003721 transcript:FBtr0333917[more]
Tm18.450e-2434.30gene:FBgn0003721 transcript:FBtr0089960[more]
Tm15.511e-2234.33gene:FBgn0003721 transcript:FBtr0305656[more]
Tm18.634e-2233.19gene:FBgn0003721 transcript:FBtr0333918[more]
Tm13.143e-2133.19gene:FBgn0003721 transcript:FBtr0305654[more]
back to top
BLAST of SMED30021511 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpm11.220e-2635.51tropomyosin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
tpm15.165e-2635.10tropomyosin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
tpm15.654e-2536.09tropomyosin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
tpm11.833e-2437.25tropomyosin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
tpm16.669e-2436.76tropomyosin 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-04... [more]
back to top
BLAST of SMED30021511 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpm19.321e-2335.12tropomyosin 1 [Source:NCBI gene;Acc:448541][more]
tpm13.277e-2234.63tropomyosin 1 [Source:NCBI gene;Acc:448541][more]
gucy2d6.245e-1932.37guanylate cyclase 2D, membrane (retina-specific) [... [more]
tpm11.207e-1834.39tropomyosin 1 [Source:NCBI gene;Acc:448541][more]
tpm11.418e-1833.66tropomyosin 1 [Source:NCBI gene;Acc:448541][more]
back to top
BLAST of SMED30021511 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Tpm38.281e-2435.75tropomyosin 3, gamma [Source:MGI Symbol;Acc:MGI:18... [more]
Tpm11.744e-2332.50tropomyosin 1, alpha [Source:MGI Symbol;Acc:MGI:98... [more]
Tpm17.235e-2332.08tropomyosin 1, alpha [Source:MGI Symbol;Acc:MGI:98... [more]
Tpm36.988e-2132.38tropomyosin 3, gamma [Source:MGI Symbol;Acc:MGI:18... [more]
Tpm37.586e-2137.10tropomyosin 3, gamma [Source:MGI Symbol;Acc:MGI:18... [more]
back to top
BLAST of SMED30021511 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9NFZ4|TPM_LEPDS8.105e-2635.29Tropomyosin OS=Lepidoglyphus destructor OX=36936 P... [more]
sp|Q23939|TPM_DERFA3.079e-2434.73Tropomyosin OS=Dermatophagoides farinae OX=6954 PE... [more]
sp|Q95VA8|TPM_TRISP6.794e-2435.34Tropomyosin OS=Trichinella spiralis OX=6334 PE=2 S... [more]
sp|Q8WR63|TPM_TRIPS6.862e-2435.78Tropomyosin OS=Trichinella pseudospiralis OX=6337 ... [more]
sp|Q3BJY7|TPM_PSOOV2.074e-2334.45Tropomyosin OS=Psoroptes ovis OX=83912 PE=1 SV=1[more]
back to top
BLAST of SMED30021511 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1D1UW495.337e-2534.40Uncharacterized protein OS=Ramazzottius varieornat... [more]
A0A3B3CVC91.095e-2434.82Tropomyosin 1 OS=Oryzias melastigma OX=30732 GN=TP... [more]
A0A293MYJ11.491e-2433.47CRE-LEV-11 protein (Fragment) OS=Ornithodoros erra... [more]
A5D6I01.536e-2434.63Tropomyosin OS=Ammothea hilgendorfi OX=258330 PE=2... [more]
A0A2I9LPV72.055e-2435.15Tropomyosin OS=Centruroides hentzi OX=88313 PE=3 S... [more]
back to top
BLAST of SMED30021511 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tpm13.454e-2436.59tropomyosin 1 [Source:NCBI gene;Acc:103046255][more]
tpm13.454e-2436.59tropomyosin 1 [Source:NCBI gene;Acc:103046255][more]
tpma6.423e-2436.76tropomyosin alpha-1 chain [Source:NCBI gene;Acc:10... [more]
tpm21.431e-2030.54tropomyosin 2 (beta) [Source:ZFIN;Acc:ZDB-GENE-040... [more]
tpm11.463e-1933.82tropomyosin 1 [Source:NCBI gene;Acc:103046255][more]
back to top
BLAST of SMED30021511 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tpm31.169e-2132.68tropomyosin 3 [Source:ZFIN;Acc:ZDB-GENE-030826-16][more]
TPM44.381e-1931.55tropomyosin 4 [Source:HGNC Symbol;Acc:HGNC:12013][more]
TPM44.426e-1430.86tropomyosin 4 [Source:HGNC Symbol;Acc:HGNC:12013][more]
back to top
BLAST of SMED30021511 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021511 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO372302.042e-1530.99Predicted protein; Tropomyosin [Source:UniProtKB/... [more]
back to top
BLAST of SMED30021511 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TPM16.964e-2734.01tropomyosin 1 [Source:NCBI gene;Acc:101168205][more]
ENSORLT00000046199.18.356e-2533.74tropomyosin alpha-1 chain [Source:NCBI gene;Acc:10... [more]
ENSORLT00000015429.23.493e-2336.59tropomyosin alpha-1 chain [Source:NCBI gene;Acc:10... [more]
TPM18.687e-2336.10tropomyosin 1 [Source:NCBI gene;Acc:101168205][more]
ENSORLT00000013757.23.274e-2235.82tropomyosin 3 [Source:NCBI gene;Acc:101175579][more]
back to top
BLAST of SMED30021511 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000038232.12.261e-170100.00SMESG000038232.1[more]
SMESG000038232.14.232e-165100.00SMESG000038232.1[more]
SMESG000074053.16.614e-2232.64SMESG000074053.1[more]
SMESG000074053.17.113e-2232.64SMESG000074053.1[more]
SMESG000000190.14.624e-1829.46SMESG000000190.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021511 ID=SMED30021511|Name=SMED30021511|organism=Schmidtea mediterranea sexual|type=transcript|length=1323bp
CTAAATTTTAAAGTACTTTTAACTTATTGAAAAAATTACATTTTAATATA
ATACAAATGGATACCTTAAAAATAAAAATGCAACAATTTAAAGAGGAAAT
TGATGAACTTCATGGGGTTCTTGATGAAAAAAACAATTCTCTTAAAGAAA
TTGTTACAGAAAGAGAACATGCTGAAAATGAGTTAGCAAGTTTAAGACGC
CAGTTTAAAGTCTCTGAATCCAATTTTGAAAGAAGTGAAAGTAATTATTT
GATTACTCTAAAGCGACTAGAAGAAACCAGAAAGTCTGCGGATGAATGTG
AAAGACTCAATGTATCACTGACTGAAACTGCCGAAATGAGCAATGAAAAA
CTCGAAGAGTTGCAAGCAAAGTTAAAAGACGCAAAAGATGACGAGGTTGT
CGCGGAAATGAAATGCCACGAAGTAAGTAAAAAGTTAACTAATGTTGAAG
CAGAATTTGAAAAGGTTGATAAACAAGCTACACAATATGAAAAAAAGATA
TCCGAACTGGAAAAAGAAATGAACACCGTGAGCAATACACTTCATTCATT
GGAGAGCACTGGTGCAAAGCTGGAATCCAGAGAAGAAGAGTATGAAACAA
CGATAAGGGATCTCATGAAATCACTAGAAGACACAGAAGAAAAACGAAAT
AATTTTGAGAGATCTTCACAGAAATTGAAACGTGACATTGAATCGGCGAA
TGAGAATCTTCATTCCTGGCAATCGAAATGTGCTCAAATTAAACAGGAAA
TGGATTCAATGCTTGCTGATGCTACGAGCATGTAATATGCAGCTTGGAGC
TTATTAATACTAGGCAAACATTGACCGAATAAATCCAAACTATTTTCTGT
GTGTGTGAGAGCGTGTTCTGCGATAAAATTTGAGTTACATTATTTGAAAT
AATAATTTTTTATACTAATCAGTCGCTGCCTTGATAGAATTAGAAATATT
TTTTGAGTTAGAGAATATGAAGGAAATTTAGTAAATTATATAATAATTTG
TCTGGAGCTATTGATTTCAATCTGTTTCGTTGATCATTGCAATTATTTTA
TCTTTGTTGATTTTATTTGCTTAGTTGTTAATTTAATTTATCCAACGACG
AAAAGATAACCTGAATTATCATATTGTTATTATTATTATTATTACGCTGC
TTACGAGAACCTCAGTCGAAATTTTGTGAACATGAGGATTTGTTGAATTT
TTAGAAATTATTTTAGAAAGTATTTATTCCCTATTTGTCTGTATGTGCAT
AAAATTATTTGATTGTTTATATGATTATGAGACTATTTATTTGTTGTTAA
TTATATTTGTTAATTTATTGTCA
back to top

protein sequence of SMED30021511-orf-1

>SMED30021511-orf-1 ID=SMED30021511-orf-1|Name=SMED30021511-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=243bp
MDTLKIKMQQFKEEIDELHGVLDEKNNSLKEIVTEREHAENELASLRRQF
KVSESNFERSESNYLITLKRLEETRKSADECERLNVSLTETAEMSNEKLE
ELQAKLKDAKDDEVVAEMKCHEVSKKLTNVEAEFEKVDKQATQYEKKISE
LEKEMNTVSNTLHSLESTGAKLESREEEYETTIRDLMKSLEDTEEKRNNF
ERSSQKLKRDIESANENLHSWQSKCAQIKQEMDSMLADATSM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000533Tropomyosin
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
GO:0008307structural constituent of muscle
GO:0051015actin filament binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005862muscle thin filament tropomyosin
GO:0005884actin filament
Vocabulary: biological process
TermDefinition
GO:0006936muscle contraction
GO:0007015actin filament organization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 85..119
NoneNo IPR availableCOILSCoilCoilcoord: 176..231
NoneNo IPR availableCOILSCoilCoilcoord: 1..56
NoneNo IPR availableCOILSCoilCoilcoord: 127..168
NoneNo IPR availableGENE3DG3DSA:1.20.5.340coord: 119..217
e-value: 1.9E-10
score: 42.7
coord: 1..93
e-value: 3.8E-8
score: 35.3
NoneNo IPR availablePANTHERPTHR19269TROPOMYOSINcoord: 2..237
NoneNo IPR availablePANTHERPTHR19269:SF45TROPOMYOSIN-1, ISOFORMS 33/34coord: 2..237
NoneNo IPR availableSUPERFAMILYSSF57997Tropomyosincoord: 2..242
IPR000533TropomyosinPRINTSPR00194TROPOMYOSINcoord: 78..98
score: 35.6
coord: 103..131
score: 36.93
coord: 42..59
score: 34.79
coord: 189..214
score: 28.86
coord: 133..156
score: 32.0
IPR000533TropomyosinPFAMPF00261Tropomyosincoord: 7..240
e-value: 5.8E-41
score: 140.4