Serpin B6

Overview
NameSerpin B6
Smed IDSMED30021505
Length (bp)1382
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serpin B6 (SMED30021505) t-SNE clustered cells

Violin plots show distribution of expression levels for Serpin B6 (SMED30021505) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serpin B6 (SMED30021505) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serpin B6 (SMED30021505) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021505

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30021505SMESG000032448.1 SMESG000032440.1 SMESG000032430.1 dd_Smed_v4_1741_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021505SMESG000032448.1 SMESG000032440.1 SMESG000032430.1 dd_Smed_v4_1741_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021505SMESG000032448.1 SMESG000032440.1 SMESG000032430.1 Contig23491newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021505SMESG000032448.1 SMESG000032440.1 SMESG000032430.1 Contig23491uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021505SMESG000032430.1 Contig2294GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30021505SMESG000032448.1 SMESG000032440.1 SMESG000032430.1 dd_Smed_v4_1741_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serpin B6 vs. Ensembl Human
Match: SERPINB6 (serpin family B member 6 [Source:HGNC Symbol;Acc:HGNC:8950])

HSP 1 Score: 186.422 bits (472), Expect = 5.852e-54
Identity = 134/366 (36.61%), Postives = 202/366 (55.19%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNS-----ESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQ---EWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFT-DAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV 1222
            F L+LLKTL K D SKNV +SPMS+  AL M   GAKG+T+ +M + L +++        + F   L++  KT       Q  +R+AN+LF E   + L S+  +  KFY   +E++DF S  +KS + IN WV  +T GKI +LL P +++ LTRL+LVNA+YF+ +W  +F      ++ F +      P  M+ K  T+   K   +G    QI        + + +++LP E   L   E  L  +   EW  +    + +   V V++P+F++E S+ ++  L +LGM   F    ADFS M S+ +L +  VVHK+F++V E G EAAAATA +MM+RCA   P     F  DHPF+F +
Sbjct:   11 FALNLLKTLGK-DNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQGFQSLLTEVNKTGT-----QYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTF---KKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRL---DMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKADFSGM-SQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVP----RFCADHPFLFFI 359          
BLAST of Serpin B6 vs. Ensembl Human
Match: SERPINB6 (serpin family B member 6 [Source:HGNC Symbol;Acc:HGNC:8950])

HSP 1 Score: 186.422 bits (472), Expect = 5.852e-54
Identity = 134/366 (36.61%), Postives = 202/366 (55.19%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNS-----ESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQ---EWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFT-DAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV 1222
            F L+LLKTL K D SKNV +SPMS+  AL M   GAKG+T+ +M + L +++        + F   L++  KT       Q  +R+AN+LF E   + L S+  +  KFY   +E++DF S  +KS + IN WV  +T GKI +LL P +++ LTRL+LVNA+YF+ +W  +F      ++ F +      P  M+ K  T+   K   +G    QI        + + +++LP E   L   E  L  +   EW  +    + +   V V++P+F++E S+ ++  L +LGM   F    ADFS M S+ +L +  VVHK+F++V E G EAAAATA +MM+RCA   P     F  DHPF+F +
Sbjct:   11 FALNLLKTLGK-DNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQGFQSLLTEVNKTGT-----QYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTF---KKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRL---DMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKADFSGM-SQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVP----RFCADHPFLFFI 359          
BLAST of Serpin B6 vs. Ensembl Human
Match: SERPINB6 (serpin family B member 6 [Source:HGNC Symbol;Acc:HGNC:8950])

HSP 1 Score: 186.422 bits (472), Expect = 5.852e-54
Identity = 134/366 (36.61%), Postives = 202/366 (55.19%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNS-----ESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQ---EWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFT-DAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV 1222
            F L+LLKTL K D SKNV +SPMS+  AL M   GAKG+T+ +M + L +++        + F   L++  KT       Q  +R+AN+LF E   + L S+  +  KFY   +E++DF S  +KS + IN WV  +T GKI +LL P +++ LTRL+LVNA+YF+ +W  +F      ++ F +      P  M+ K  T+   K   +G    QI        + + +++LP E   L   E  L  +   EW  +    + +   V V++P+F++E S+ ++  L +LGM   F    ADFS M S+ +L +  VVHK+F++V E G EAAAATA +MM+RCA   P     F  DHPF+F +
Sbjct:   11 FALNLLKTLGK-DNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQGFQSLLTEVNKTGT-----QYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTF---KKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRL---DMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKADFSGM-SQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVP----RFCADHPFLFFI 359          
BLAST of Serpin B6 vs. Ensembl Human
Match: SERPINB6 (serpin family B member 6 [Source:HGNC Symbol;Acc:HGNC:8950])

HSP 1 Score: 186.422 bits (472), Expect = 5.852e-54
Identity = 134/366 (36.61%), Postives = 202/366 (55.19%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNS-----ESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQ---EWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFT-DAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV 1222
            F L+LLKTL K D SKNV +SPMS+  AL M   GAKG+T+ +M + L +++        + F   L++  KT       Q  +R+AN+LF E   + L S+  +  KFY   +E++DF S  +KS + IN WV  +T GKI +LL P +++ LTRL+LVNA+YF+ +W  +F      ++ F +      P  M+ K  T+   K   +G    QI        + + +++LP E   L   E  L  +   EW  +    + +   V V++P+F++E S+ ++  L +LGM   F    ADFS M S+ +L +  VVHK+F++V E G EAAAATA +MM+RCA   P     F  DHPF+F +
Sbjct:   11 FALNLLKTLGK-DNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQGFQSLLTEVNKTGT-----QYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTF---KKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRL---DMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKADFSGM-SQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVP----RFCADHPFLFFI 359          
BLAST of Serpin B6 vs. Ensembl Human
Match: SERPINB6 (serpin family B member 6 [Source:HGNC Symbol;Acc:HGNC:8950])

HSP 1 Score: 186.422 bits (472), Expect = 5.852e-54
Identity = 134/366 (36.61%), Postives = 202/366 (55.19%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNS-----ESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQ---EWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFT-DAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV 1222
            F L+LLKTL K D SKNV +SPMS+  AL M   GAKG+T+ +M + L +++        + F   L++  KT       Q  +R+AN+LF E   + L S+  +  KFY   +E++DF S  +KS + IN WV  +T GKI +LL P +++ LTRL+LVNA+YF+ +W  +F      ++ F +      P  M+ K  T+   K   +G    QI        + + +++LP E   L   E  L  +   EW  +    + +   V V++P+F++E S+ ++  L +LGM   F    ADFS M S+ +L +  VVHK+F++V E G EAAAATA +MM+RCA   P     F  DHPF+F +
Sbjct:   11 FALNLLKTLGK-DNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQGFQSLLTEVNKTGT-----QYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTF---KKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRL---DMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKADFSGM-SQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVP----RFCADHPFLFFI 359          
BLAST of Serpin B6 vs. Ensembl Celegans
Match: srp-6 (SeRPin; Serine or cysteine protease inhibitor [Source:UniProtKB/TrEMBL;Acc:G5EFH4])

HSP 1 Score: 159.458 bits (402), Expect = 3.235e-44
Identity = 118/374 (31.55%), Postives = 191/374 (51.07%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGT-IRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEF---SVVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERC----SLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLPLFIG 1255
            FGL LL+   +++ +++ ++SP+SI +AL +    AKG+T  E+ K L  +    E   Q  S+      V EK  GT + VAN +F    + +   Y+  V K YN G  +++F+ + + S   IN +V   T G IK ++ P++I+     +L NA YFK +W+ +F   S    + F   N       + S+    KY +N    F  + +P+K   +  ++  + LP  R     +L   ++V  QQ       ++L     V++ MPK++IE++  L   LM +G+ K FTD+AD S+      + I    HKA I+V E G  AAAAT +   L    +   +PIEF  DHPF+F ++ + + PLFIG
Sbjct:   20 FGLSLLR---QQNLTESFVFSPLSIALALSLVHVAAKGETRDEIRKAL-LNGATDEELEQHFSNISAGLLVAEK--GTEVNVANHIFSRKTFTIKKLYLNDVKKLYNAGASQLNFE-DQEASAEAINNFVSENTKGHIKKIINPDSISEELVAVLTNAFYFKANWQTKFKKESTYKREFFSSENSKRETEFLHSRNSNRKYSENGQ--FQVLSLPYK---DTSFALSIFLPKTRFGLSEALQNLDSVTIQQLMSNT-SNTL-----VNIAMPKWKIETALGLNRALMAVGIEKAFTDSADLSNFADG--IYISQAAHKALIEVDEDGTVAAAATTISFSLTSVFIPAEEPIEFTADHPFLF-ILSKDNHPLFIG 372          
BLAST of Serpin B6 vs. Ensembl Celegans
Match: srp-7 (SeRPin; Serine or cysteine protease inhibitor [Source:UniProtKB/TrEMBL;Acc:Q6QUQ6])

HSP 1 Score: 150.214 bits (378), Expect = 7.458e-41
Identity = 117/380 (30.79%), Postives = 193/380 (50.79%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGT-IRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDKTFHLLNGSSIPTTMISKTE---------TYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERC----SLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLPLFIG 1255
            FGL LL+   +++ S+++ +SP+SI +AL +    AKG+T  ++ + L     + E   Q  ++   ++ +   ++GT +++AN +F    +++  SY+  V K YN G   +DF  N + +   IN +V   T   IK ++  ++INS    +L NA+YFK  W+N+F    D TF     S   ++  SK E         +  Y +N    F  + +P+K   ++ ++  + LP  R     SL   ++   Q     V   S      V+V +PK++IE+   L+E L  LG+ K F + AD  +M     L +  V HKA I+V E G  AAAAT V  + + A    I PI F  DHPF+F ++ Q + P+F+G
Sbjct:   11 FGLGLLR---QQNISESLAFSPLSIALALSLVHVAAKGETRDQIREALVKGSTD-EQLEQHFANI--SAALLAAERGTEVKLANHVFTRAGFKIKQSYLDDVKKLYNAGASSLDFD-NKEATAEAINNFVRENTGDHIKKIIGSDSINSDLVAVLTNALYFKADWQNKFK--KDSTFK----SEFFSSADSKREIDFLHASSVSRDYAENDQ--FQVLSLPYK---DNTFALTIFLPKTRFGLTESLKTLDSATIQHLLSNVSSTS------VNVQIPKWKIETKLGLEEALQSLGIKKAFDNDADLGNMADG--LYVSKVTHKALIEVDEEGTTAAAATVVSFVRKSARPSAIKPIVFQADHPFLF-MLTQTNHPIFLG 363          
BLAST of Serpin B6 vs. Ensembl Celegans
Match: srp-7 (SeRPin; Serine or cysteine protease inhibitor [Source:UniProtKB/TrEMBL;Acc:Q6QUQ6])

HSP 1 Score: 149.058 bits (375), Expect = 1.514e-40
Identity = 117/380 (30.79%), Postives = 194/380 (51.05%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGT-IRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDKTFHLLNGSSIPTTMISKTE---------TYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERC----SLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLPLFIG 1255
            FGL LL+   +++ S+++ +SP+SI +AL +    AKG+T  ++ + L     + E   Q  ++   ++ +   ++GT +++AN +F    +++  SY+  V K YN G   +DF  N + +   IN +V   T   IK ++  ++INS    +L NA+YFK  W+N+F    D TF     S   ++  SK E         +  Y +N    F  + +P+K   ++ ++  + LP  R     SL   ++   Q     V   S      V+V +PK++IE+   L+E L  LG+ K F + AD  +M     L +  V HKA I+V E G +AAAAT V + L+ A     +P +F  DHPF F V+ + + PLF+G
Sbjct:   11 FGLGLLR---QQNISESLAFSPLSIALALSLVHVAAKGETRDQIREALVKGSTD-EQLEQHFANI--SAALLAAERGTEVKLANHVFTRAGFKIKQSYLDDVKKLYNAGASSLDFD-NKEATAEAINNFVRENTGDHIKKIIGSDSINSDLVAVLTNALYFKADWQNKFK--KDSTFK----SEFFSSADSKREIDFLHASSVSRDYAENDQ--FQVLSLPYK---DNTFALTIFLPKTRFGLTESLKTLDSATIQHLLSNVSSTS------VNVQIPKWKIETKLGLEEALQSLGIKKAFDNDADLGNMADG--LYVSKVTHKALIEVDEEGTKAAAATTVSISLKSAMFVMEEPKDFTADHPFFF-VLSKDNHPLFVG 363          
BLAST of Serpin B6 vs. Ensembl Celegans
Match: srp-7 (SeRPin; Serine or cysteine protease inhibitor [Source:UniProtKB/TrEMBL;Acc:Q6QUQ6])

HSP 1 Score: 149.058 bits (375), Expect = 1.984e-40
Identity = 117/380 (30.79%), Postives = 194/380 (51.05%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGT-IRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDKTFHLLNGSSIPTTMISKTE---------TYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERC----SLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLPLFIG 1255
            FGL LL+   +++ S+++ +SP+SI +AL +    AKG+T  ++ + L     + E   Q  ++   ++ +   ++GT +++AN +F    +++  SY+  V K YN G   +DF  N + +   IN +V   T   IK ++  ++INS    +L NA+YFK  W+N+F    D TF     S   ++  SK E         +  Y +N    F  + +P+K   ++ ++  + LP  R     SL   ++   Q     V   S      V+V +PK++IE+   L+E L  LG+ K F + AD  +M     L +  V HKA I+V E G +AAAAT V + L+ A     +P +F  DHPF F V+ + + PLF+G
Sbjct:   18 FGLGLLR---QQNISESLAFSPLSIALALSLVHVAAKGETRDQIREALVKGSTD-EQLEQHFANI--SAALLAAERGTEVKLANHVFTRAGFKIKQSYLDDVKKLYNAGASSLDFD-NKEATAEAINNFVRENTGDHIKKIIGSDSINSDLVAVLTNALYFKADWQNKFK--KDSTFK----SEFFSSADSKREIDFLHASSVSRDYAENDQ--FQVLSLPYK---DNTFALTIFLPKTRFGLTESLKTLDSATIQHLLSNVSSTS------VNVQIPKWKIETKLGLEEALQSLGIKKAFDNDADLGNMADG--LYVSKVTHKALIEVDEEGTKAAAATTVSISLKSAMFVMEEPKDFTADHPFFF-VLSKDNHPLFVG 370          
BLAST of Serpin B6 vs. Ensembl Celegans
Match: srp-2 (SeRPin [Source:UniProtKB/TrEMBL;Acc:O17365])

HSP 1 Score: 140.969 bits (354), Expect = 1.257e-37
Identity = 124/394 (31.47%), Postives = 188/394 (47.72%), Query Frame = 2
Query:  146 SCQKFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGT-IRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEF---SVVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPF------KRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVG--------------VHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLPLFIG 1255
            S   F L LL TL     S +V+ SP+SI + L +   GA G T  E+      D L      ++ S  ++   V + D G   ++ N++F+   Y +   Y++ V+K Y    E +DF S  +++ + +N +VEN TNGKIKDL+  ++ N+     LVNA+YFK  W+++F   S  G + F             S+ E+              QIPF       R + +D  F V L L+    PKF   +F  + +    D+L +  G              V V +PKF+IE    LKE L  +G+ + F + AD S +  K  + I   +HKA I+V E G  AAAA+A  + L    M   +P +F  DHPF+FAV+ +    LF+G
Sbjct:    7 SQTDFALKLLATLPH---SGSVVLSPLSISLGLALIHAGACGSTQKEL-----EDVLGGSRIFEEFSGLMEA--VGDTDNGVETKIVNRVFVNQAYTIHQDYLETVEKLYKASGESLDF-SQTEQAAKTMNTFVENHTNGKIKDLIPADSANN-AFAFLVNAMYFKADWQSKFAKESTTGREFF------------TSEAESR-------------QIPFLTELDEHRDYTEDVLFQV-LSLKYAD-PKFTLAIFLPKQRFGLVDALEKINGEYIQNLLNDLKSSYVSVQIPKFKIEKELDLKETLEAIGIKEIFAEGADLSGIADK--VFISSGIHKAIIEVDEDGTTAAAASAFKVQLEMMIMA--EPTQFVADHPFLFAVLFENH-TLFLG 356          
BLAST of Serpin B6 vs. Ensembl Fly
Match: Spn42Da (gene:FBgn0265137 transcript:FBtr0086197)

HSP 1 Score: 207.223 bits (526), Expect = 5.600e-62
Identity = 128/373 (34.32%), Postives = 205/373 (54.96%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSE----SFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFS--VVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPE-LMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLPLFIG 1255
            F +++   L  +   +N+++SP SI     M   GA+ +T+ ++ + L     + E    SFHQ L+          +D   +R+ANK+F+ + Y+L   + + + K +    + +DF  N  ++   IN WVE +TN  IKDL+  + +NS +RL+LVNAI+FK +W+++F+  +    TFHL    ++   M+S  E ++Y   P L   A+++P+K   + D S ++VLP  +  LP  E  L       +   SL+E   V + +P+F+ E   +L E    LGM + F+D A+F  M   PE L +  ++HKAFI+V E G EAAAAT + +  + A M P +PIEF  DHPF + +V Q  LPLF G
Sbjct:   16 FSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQVLAAY--------QDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNV-QAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELPYK---DSDLSMLIVLPNTKTGLPALEEKLRLTTLSQI-TQSLYE-TKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQKDLPLFWG 374          
BLAST of Serpin B6 vs. Ensembl Fly
Match: Spn42Da (gene:FBgn0265137 transcript:FBtr0086201)

HSP 1 Score: 204.912 bits (520), Expect = 2.620e-61
Identity = 128/373 (34.32%), Postives = 203/373 (54.42%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSE----SFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFS--VVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPE-LMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLPLFIG 1255
            F +++   L  +   +N+++SP SI     M   GA+ +T+ ++ + L     + E    SFHQ L+          +D   +R+ANK+F+ + Y+L   + + + K +    + +DF  N  ++   IN WVE +TN  IKDL+  + +NS +RL+LVNAI+FK +W+++F+  +    TFHL    ++   M+S  E ++Y   P L   A+++P+K   + D S ++VLP  +  LP  E  L       +   SL+E   V + +P+F+ E   +L E    LGM + F+D A+F  M   PE L +  ++HKAFI+V E G EAAAAT + M L   PM   DPI FN DHPF F ++ + S  LF G
Sbjct:   16 FSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQVLAAY--------QDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNV-QAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELPYK---DSDLSMLIVLPNTKTGLPALEEKLRLTTLSQI-TQSLYE-TKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMFMSLTSLPMPKPDPIRFNVDHPFTFYILNKDSTALFAG 374          
BLAST of Serpin B6 vs. Ensembl Fly
Match: Spn42Da (gene:FBgn0265137 transcript:FBtr0086196)

HSP 1 Score: 206.068 bits (523), Expect = 2.761e-61
Identity = 128/373 (34.32%), Postives = 205/373 (54.96%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSE----SFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFS--VVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPE-LMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLPLFIG 1255
            F +++   L  +   +N+++SP SI     M   GA+ +T+ ++ + L     + E    SFHQ L+          +D   +R+ANK+F+ + Y+L   + + + K +    + +DF  N  ++   IN WVE +TN  IKDL+  + +NS +RL+LVNAI+FK +W+++F+  +    TFHL    ++   M+S  E ++Y   P L   A+++P+K   + D S ++VLP  +  LP  E  L       +   SL+E   V + +P+F+ E   +L E    LGM + F+D A+F  M   PE L +  ++HKAFI+V E G EAAAAT + +  + A M P +PIEF  DHPF + +V Q  LPLF G
Sbjct:   48 FSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQVLAAY--------QDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNV-QAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELPYK---DSDLSMLIVLPNTKTGLPALEEKLRLTTLSQI-TQSLYE-TKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMAVRRKRAIMSPEEPIEFFADHPFTYVLVHQKDLPLFWG 406          
BLAST of Serpin B6 vs. Ensembl Fly
Match: Spn42Da (gene:FBgn0265137 transcript:FBtr0086198)

HSP 1 Score: 203.756 bits (517), Expect = 1.612e-60
Identity = 128/373 (34.32%), Postives = 203/373 (54.42%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSE----SFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFS--VVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPE-LMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLPLFIG 1255
            F +++   L  +   +N+++SP SI     M   GA+ +T+ ++ + L     + E    SFHQ L+          +D   +R+ANK+F+ + Y+L   + + + K +    + +DF  N  ++   IN WVE +TN  IKDL+  + +NS +RL+LVNAI+FK +W+++F+  +    TFHL    ++   M+S  E ++Y   P L   A+++P+K   + D S ++VLP  +  LP  E  L       +   SL+E   V + +P+F+ E   +L E    LGM + F+D A+F  M   PE L +  ++HKAFI+V E G EAAAAT + M L   PM   DPI FN DHPF F ++ + S  LF G
Sbjct:   48 FSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQVLAAY--------QDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNV-QAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELPYK---DSDLSMLIVLPNTKTGLPALEEKLRLTTLSQI-TQSLYE-TKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMFMSLTSLPMPKPDPIRFNVDHPFTFYILNKDSTALFAG 406          
BLAST of Serpin B6 vs. Ensembl Fly
Match: Spn42Da (gene:FBgn0265137 transcript:FBtr0300336)

HSP 1 Score: 186.422 bits (472), Expect = 2.554e-54
Identity = 120/375 (32.00%), Postives = 200/375 (53.33%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSE----SFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFS--VVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPE-LMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLPLFIGHC 1261
            F +++   L  +   +N+++SP SI     M   GA+ +T+ ++ + L     + E    SFHQ L+          +D   +R+ANK+F+ + Y+L   + + + K +    + +DF  N  ++   IN WVE +TN  IKDL+  + +NS +RL+LVNAI+FK +W+++F+  +    TFHL    ++   M+S  E ++Y   P L   A+++P+K   + D S ++VLP  +  LP  E  L       +   SL+E   V + +P+F+ E   +L E    LGM + F+D A+F  M   PE L +  ++HKAFI+V E G EAAAAT ++M           P++F+  HPF + ++ + S  LF G  
Sbjct:   16 FSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQIAHSFHQVLAAY--------QDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNV-QAAATINNWVEQRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKERFRYADLPALDAMALELPYK---DSDLSMLIVLPNTKTGLPALEEKLRLTTLSQI-TQSLYE-TKVALKLPRFKAEFQVELSEVFQKLGMSRMFSDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAAAATGMVMCYASMLTFEPQPVQFHVQHPFNYYIINKDSTILFAGRI 376          
BLAST of Serpin B6 vs. Ensembl Zebrafish
Match: serpinb1l1 (serpin peptidase inhibitor, clade B (ovalbumin), member 1, like 1 [Source:ZFIN;Acc:ZDB-GENE-040715-5])

HSP 1 Score: 175.252 bits (443), Expect = 6.139e-50
Identity = 118/365 (32.33%), Postives = 194/365 (53.15%), Query Frame = 2
Query:  155 KFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQG--TIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEF--SVVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLP----LERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPF-TDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV 1222
            +F L+L K +   + S NV YSP+SI  AL M   GAKG+T+ +M K L ++    +   Q  S+  K  +   K +    + +AN+L+ E  Y+L++ ++    ++Y+ G+EK+DF +  + +  +IN WVE  T  KIKDLL    I+++TRL+LVNAIYFK +W+ +F      D  F L    + P  M+ +   +       +    +++P+      + S +++LP     E   L K E  L  ++        +     V V++PKF+ E ++ +K  L+ +GM   F     + + M+S  +L++   +HKAF++V E G EAAAATA +  L C     I P+ FN DHPF+F +
Sbjct:   10 QFSLNLFKKISGGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFNSQAHQPVEQIHSNFKKFMSELNKPEAPYVLSLANRLYGEQTYQLIEKFLNDTKRYYDAGLEKVDFINKSEDARVNINTWVEKNTQEKIKDLLPSGAIDAMTRLVLVNAIYFKGNWEEKFPKEATRDGVFRLNKNQTKPVKMMHQKAEFPSGYIEEMKSHVLELPYA---GKNLSMLIILPDEIEDETTGLQKLERALTYEKLMEWTKPEVMHQREVQVSLPKFKTEQTYDMKSLLVSMGMEDVFDPQKVNLTGMSSSNDLVLSKAIHKAFVEVNEEGTEAAAATAAIEKLMCY----IPPLSFNADHPFLFFI 367          
BLAST of Serpin B6 vs. Ensembl Zebrafish
Match: serpinb1l1 (serpin peptidase inhibitor, clade B (ovalbumin), member 1, like 1 [Source:ZFIN;Acc:ZDB-GENE-040715-5])

HSP 1 Score: 175.252 bits (443), Expect = 6.139e-50
Identity = 118/365 (32.33%), Postives = 194/365 (53.15%), Query Frame = 2
Query:  155 KFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQG--TIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEF--SVVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLP----LERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPF-TDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV 1222
            +F L+L K +   + S NV YSP+SI  AL M   GAKG+T+ +M K L ++    +   Q  S+  K  +   K +    + +AN+L+ E  Y+L++ ++    ++Y+ G+EK+DF +  + +  +IN WVE  T  KIKDLL    I+++TRL+LVNAIYFK +W+ +F      D  F L    + P  M+ +   +       +    +++P+      + S +++LP     E   L K E  L  ++        +     V V++PKF+ E ++ +K  L+ +GM   F     + + M+S  +L++   +HKAF++V E G EAAAATA +  L C     I P+ FN DHPF+F +
Sbjct:   10 QFSLNLFKKISGGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFKVLGFNSQAHQPVEQIHSNFKKFMSELNKPEAPYVLSLANRLYGEQTYQLIEKFLNDTKRYYDAGLEKVDFINKSEDARVNINTWVEKNTQEKIKDLLPSGAIDAMTRLVLVNAIYFKGNWEEKFPKEATRDGVFRLNKNQTKPVKMMHQKAEFPSGYIEEMKSHVLELPYA---GKNLSMLIILPDEIEDETTGLQKLERALTYEKLMEWTKPEVMHQREVQVSLPKFKTEQTYDMKSLLVSMGMEDVFDPQKVNLTGMSSSNDLVLSKAIHKAFVEVNEEGTEAAAATAAIEKLMCY----IPPLSFNADHPFLFFI 367          
BLAST of Serpin B6 vs. Ensembl Zebrafish
Match: serpini1 (serpin peptidase inhibitor, clade I (neuroserpin), member 1 [Source:ZFIN;Acc:ZDB-GENE-060503-390])

HSP 1 Score: 173.711 bits (439), Expect = 6.233e-49
Identity = 116/392 (29.59%), Postives = 197/392 (50.26%), Query Frame = 2
Query:  155 KFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDKTFHLL--NGSSIPTTMISKTETYKYLK---NPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVL---FQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSK----PELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV--VKQGSLPLFIGHCAQC*LFD*F 1288
            +F + L   L      +N+I+SP+S+ +ALGM   GA+G +  E+ + + +     +     L +  +  + DE +Q  +R+AN LFL++     + +++ + K++   +E +DF  +   + R IN WV N T  KI++L+   + +S T ++LVNA+YF+ SWKN+F     +TF     +GS + T M+ +   + Y +     T      Q+       +D S M+VLP +   L   E ++     +EW             V V +P+F++E    L+E L  LG+   F+  AD S+MT++     +L I   V KA+++VTE G E AA + ++ + R   + P    +   DHPF F +   K GS+ LF+G      L D F
Sbjct:   30 EFSVRLYHQLQISSGEENIIFSPLSVALALGMVELGARGSSLQEIRQAVGYSHFREDEEFSLLRNLSQALSTDE-EQYVVRLANSLFLQSGVHFNEDFLQLMKKYFRAEVETVDFSQSTAVAER-INSWVLNHTESKIQNLVSAEDFSSSTMIMLVNAVYFRGSWKNQFRPENTRTFSFTRDDGSEVQTLMMYQQGDFYYGEFSDGTTEAGGVYQVLEMLYEGEDMSMMIVLPRQEVPLASLEPIIKAPLLEEWANNVKRQ-----KVEVYLPRFKVEQKIDLRESLQQLGIRSIFSKDADLSAMTAQMTDGQDLFIGKAVQKAYLEVTEEGAEGAAGSGMIALTRTLVLYP----QVMADHPFFFIIRNRKTGSI-LFMGRVMNPELIDPF 409          
BLAST of Serpin B6 vs. Ensembl Zebrafish
Match: serpini1 (serpin peptidase inhibitor, clade I (neuroserpin), member 1 [Source:ZFIN;Acc:ZDB-GENE-060503-390])

HSP 1 Score: 173.711 bits (439), Expect = 6.233e-49
Identity = 116/392 (29.59%), Postives = 197/392 (50.26%), Query Frame = 2
Query:  155 KFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDKTFHLL--NGSSIPTTMISKTETYKYLK---NPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVL---FQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSK----PELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV--VKQGSLPLFIGHCAQC*LFD*F 1288
            +F + L   L      +N+I+SP+S+ +ALGM   GA+G +  E+ + + +     +     L +  +  + DE +Q  +R+AN LFL++     + +++ + K++   +E +DF  +   + R IN WV N T  KI++L+   + +S T ++LVNA+YF+ SWKN+F     +TF     +GS + T M+ +   + Y +     T      Q+       +D S M+VLP +   L   E ++     +EW             V V +P+F++E    L+E L  LG+   F+  AD S+MT++     +L I   V KA+++VTE G E AA + ++ + R   + P    +   DHPF F +   K GS+ LF+G      L D F
Sbjct:   30 EFSVRLYHQLQISSGEENIIFSPLSVALALGMVELGARGSSLQEIRQAVGYSHFREDEEFSLLRNLSQALSTDE-EQYVVRLANSLFLQSGVHFNEDFLQLMKKYFRAEVETVDFSQSTAVAER-INSWVLNHTESKIQNLVSAEDFSSSTMIMLVNAVYFRGSWKNQFRPENTRTFSFTRDDGSEVQTLMMYQQGDFYYGEFSDGTTEAGGVYQVLEMLYEGEDMSMMIVLPRQEVPLASLEPIIKAPLLEEWANNVKRQ-----KVEVYLPRFKVEQKIDLRESLQQLGIRSIFSKDADLSAMTAQMTDGQDLFIGKAVQKAYLEVTEEGAEGAAGSGMIALTRTLVLYP----QVMADHPFFFIIRNRKTGSI-LFMGRVMNPELIDPF 409          
BLAST of Serpin B6 vs. Ensembl Zebrafish
Match: serpinb1l2 (serpin peptidase inhibitor, clade B (ovalbumin), member 1, like 2 [Source:ZFIN;Acc:ZDB-GENE-041001-117])

HSP 1 Score: 171.785 bits (434), Expect = 1.178e-48
Identity = 127/365 (34.79%), Postives = 188/365 (51.51%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDKT--FHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLE----RCSLPKFETVLFQQ---EWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDA-ADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV 1222
            F LDL + L       N+ +SP+SI  AL M   GA+GDT+GEM K L +  ++   FH      I + N        +R+AN+L+ E  +  L  YV +  K Y+   + +DF    D S + IN WVE QT  +IKDLLQP  +N +TRL+LVNAIYFK +W + F     K   F +    S P  M+ + E + Y   P      +++P+ +    + S +++LP E       L K E+ L  Q   +W +     +  +  + V +PKF++E    L E L  +GM   F +  AD + M+S   L +  V+HKAF++V E G EAAAATA+++ +        D   F  DHPFMF +
Sbjct:   11 FALDLYRALSASSAEGNIFFSPLSISAALSMVYLGARGDTAGEMEKVLCFSSVSD--FHAHFKTLISSINSPSASY-ILRLANRLYGEKTFSFLPMYVDSTMKLYHAEPQTVDFIRAADDSRQFINKWVEKQTENQIKDLLQPGVVNEMTRLLLVNAIYFKGNWMHTFDAHATKEMPFKINQNESRPVQMMDQVENFPYRCIPEYKLQVLELPYTQ---QELSMLILLPDEIKYGSDPLLKLESELNLQKLLDWTS--RGKMDTWRKIIVRLPKFKLEIESCLSETLEKMGMSSVFQETKADLTGMSSNGGLFLSAVIHKAFVEVNEEGTEAAAATALLLPISACQGAFHD---FIADHPFMFFI 364          
BLAST of Serpin B6 vs. Ensembl Xenopus
Match: atp5mc1 (ATP synthase membrane subunit c locus 1 [Source:Xenbase;Acc:XB-GENE-5907814])

HSP 1 Score: 193.356 bits (490), Expect = 1.191e-56
Identity = 124/361 (34.35%), Postives = 198/361 (54.85%), Query Frame = 2
Query:  155 KFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFS--VVGDKTFHLLNGSSIPTTMISKTETY--KYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDA-ADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV 1222
            +F +D+L+ + K    +NV++S MSI ++L M   GA G+T+ +M K LH+D++  E  H Q    +K    +  D  T+   NKLF E KY  L +++KA++ FY   +EK+DF SNP+ +   IN W++ +T GKI++LL  N+I+  T L++ N +YF  +W  +FS        F L+    I   M++   T+  K +KNP  G + +++P+      D S +++LP     L K       +  ++    S +    + V +P+FR+E SF LK+ L  LGM   F+ + A+FS M  + +L + DV HK FI+V E G EAA+AT  +M +R      +   EF  D PF F +
Sbjct:    9 EFTIDVLREISKTAAGQNVVFSSMSIMISLAMVYLGAHGNTAADMGKALHFDEV--EDVHAQFRVLLKELMKNGNDY-TLTTVNKLFGEKKYYFLPTFLKAINAFYGAPLEKVDFSSNPEATRSYINAWIQEKTKGKIQNLLPENSISPNTVLMVANTLYFLANWTTQFSEHATSKAPFTLITNEQIKVNMMATMNTFNMKRIKNP--GMSVLELPYG--DTKDLSMVIMLPDNSTVLTKISYENLSKWTRSENMSSNY----LAVYLPRFRMEKSFSLKKVLSSLGMSSAFSQSRANFSGMGKQKQLYVSDVHHKTFIEVNEKGTEAASATGSVMSIRS-----LANEEFKADRPFHFFI 353          
BLAST of Serpin B6 vs. Ensembl Xenopus
Match: ENSXETT00000024938.1 (serpin peptidase inhibitor, clade B (ovalbumin), member 4 [Source:NCBI gene;Acc:100490314])

HSP 1 Score: 188.734 bits (478), Expect = 1.071e-54
Identity = 120/376 (31.91%), Postives = 191/376 (50.80%), Query Frame = 2
Query:  146 SCQKFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHW---------------DQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV 1222
            S  +F LDL K L K    KN+++SP+SI  A+G+ L G+KGDT+ E+ K  H+                   ++  H    D     N    D   + +AN+ + E  +   + Y+  +++ YN  +E +DF++  D   + IN WVE++T GKI++L    +++S T L LVNA+YFK SWK +F      D  F L         M+S+   YK   NP L    +++P++    + +S  ++LP +   L + ET L  + +  +        V V V +P+F+   ++ L E L  +GM   F   A+ S ++ K  L I  VVHK++I+V E G EAAAAT + + +  AP+    P EF  D PF+F +
Sbjct:    7 SFSEFSLDLCKELKKNPEKKNILFSPLSICSAMGLVLLGSKGDTAAEIEKVFHFPAAAGSRSSKPSCQQQTCQAQGVHLLFKDLFSALN-KPNDHYELSIANRAYGEKSFPFSEQYLLCIEQLYNATLESVDFKTKADDVIQQINAWVESKTKGKIQNLFAKGSLDSTTALALVNAVYFKGSWKKQFKKENTTDAPFFLNKNDKTSVKMMSQKGKYKLGSNPELKCRILKLPYE----EGFSMKIILPDDIDGLAELETHLTYETFTKLMDLQRTREVQVVVKLPQFKFGETYSLTEVLQSMGMTSAF-HGANLSGISDKAGLAISTVVHKSYIEVNEEGTEAAAATGIGITVTSAPL---PPQEFIVDRPFLFCI 373          
BLAST of Serpin B6 vs. Ensembl Xenopus
Match: slc7a5 (solute carrier family 7 member 5 [Source:Xenbase;Acc:XB-GENE-480035])

HSP 1 Score: 183.341 bits (464), Expect = 6.967e-53
Identity = 129/384 (33.59%), Postives = 204/384 (53.12%), Query Frame = 2
Query:  146 SCQKFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNS-ESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDY--SFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEF------VGVHVTMPKFRIESSFKLKEELMHLGMVKPF-TDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLP-LFIGH 1258
            +C  F  DL + + + + + NV +SP+SI  AL M L GA+G+T+ ++ + LH+D +    S  Q L+  I   NV       + +AN+LF E  ++ L  ++ +V K YN  +  +DF S  + + ++IN WV  QT GKI ++L    +NS T+L+LVNAIYFK  W  +F      D  F L         M+ + E   +   P +    +++P+      DY  S ++VLP         +T   QQ  K +  + + E+      + VHV +PKF++E S+KLK +L  +GM   F   +AD S M+   +L + +V+HK+F++V E G EAAAA+A + M+ C  MR     EFN +HPF+F +    +   LF G 
Sbjct:    7 ACTHFSFDLFRKINENNATGNVFFSPISISTALAMVLLGARGNTAQQISRILHFDAVKDLHSNFQTLNAEINKKNVSSY---ALNLANRLFGEKSFKFLPDFLSSVKKQYNADLGTVDFISAAEDARKEINTWVSEQTKGKIPEVLSAGAVNSFTKLVLVNAIYFKGDWAKKFKAEHTKDMPFQLNKKEQKTVKMMYQMEKLPFNYIPEINCRVLELPYV-----DYELSMVIVLPDNIND----DTTGLQQLEKELSLEKINEWTENMMPIDVHVHLPKFKLEDSYKLKSQLAGMGMADLFEAGSADLSGMSGSNDLYLSEVIHKSFVEVNEEGTEAAAASAGIAMM-CL-MR---EEEFNANHPFLFFIRHNATKSILFFGR 373          
BLAST of Serpin B6 vs. Ensembl Xenopus
Match: ENSXETT00000024879.1 (serpin peptidase inhibitor, clade B (ovalbumin), member 4 [Source:NCBI gene;Acc:100490314])

HSP 1 Score: 181.03 bits (458), Expect = 6.859e-52
Identity = 121/372 (32.53%), Postives = 194/372 (52.15%), Query Frame = 2
Query:  146 SCQKFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMK------TLHWD-----QLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV 1222
            S  +F LDL K L K    KN+++SP+SI  A+G+ L G+KGDT+ E+ K      T+  +     +  S+  H    D     N    D   + +AN+ + E  +   + Y+  +++ YN  +E +DF++  D   + IN WVE++T GKI++L    +++S T L LVNA+YFK SWK +F      D  F L    +    M+S+   YK   NP L    +++P++    + +S  ++LP +   L + ET L  + +  +        V V V +P+F+   ++ L E L  +GM   F   A+ S ++ K  L I  VVHK++I+V E G EAAAAT + + +  AP+    P EF  D PF+F +
Sbjct:    7 SFSEFSLDLCKELKKNPEKKNILFSPLSICSAMGLVLLGSKGDTAAEIEKVRKIYCTIRGNFGKSPKKTSQGVHLLFKDLFSALN-KPNDHYELSIANRAYGEKSFPFSEQYLLCIEQLYNATLESVDFKTKADDVIQQINAWVESKTKGKIQNLFAKGSLDSTTALALVNAVYFKGSWKKQFKKENTTDAPFFL----NKVLKMMSQKGKYKLGSNPELKCRILKLPYE----EGFSMKIILPDDIDGLAELETHLTYETFTKLMDLQRTREVQVVVKLPQFKFGETYSLTEVLQSMGMTSAF-HGANLSGISDKAGLAISTVVHKSYIEVNEEGTEAAAATGIGITVTSAPL---PPQEFIVDRPFLFCI 365          
BLAST of Serpin B6 vs. Ensembl Xenopus
Match: serpinb6 (serpin family B member 6 [Source:NCBI gene;Acc:493311])

HSP 1 Score: 179.489 bits (454), Expect = 2.296e-51
Identity = 127/379 (33.51%), Postives = 207/379 (54.62%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSE--SFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLE----RCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTD-AADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLP-LFIGHCA 1264
            F ++ LK + + + + N+  SP+SI  AL M L GAKG+T+ +M + L  D+++    +F   +S+  K+          +R AN+L+ E  Y  L+ ++ +  K Y+  ++ +DF    ++S  +IN WV  +T GKIKDLL   +++SLTRL+LVNAIYFK +W N+F+     +  F L    + P  M+ K   +       L    V+IP+    +++ S +++LP +       L   E  L  +++       + +   + +++PKF++E  + L+  L  +GM   F    ADFS M+S  +L +  V+HK+F+DV E G EAAAATA +MMLRCA + P       CDHPF+F ++ + S   LF G  A
Sbjct:   11 FAINFLKKINESNKTGNIFVSPLSISSALSMVLLGAKGNTATQMSQVLKLDKVDDAHCNFQSLISEINKSGT-----NYLLRTANRLYGEKSYTFLEEFLGSTQKHYHADLKAVDFSRKAEESRGEINEWVAQKTEGKIKDLLSSGSVDSLTRLVLVNAIYFKGNWANKFNPDHTHESPFRLNKNETKPVQMMFKKAKFPMTYIGELFTKVVEIPYV---DNELSMIILLPDDINDGTTGLEALEKELTYEKFLKWTNPEMMDITEMELSLPKFKLEDDYDLESFLSTMGMSDAFDQRRADFSGMSSANDLFLSKVLHKSFVDVNEEGTEAAAATAAIMMLRCAMIIP----RIVCDHPFLFFILHRPSQSILFCGRFA 377          
BLAST of Serpin B6 vs. Ensembl Mouse
Match: Serpinb9f (serine (or cysteine) peptidase inhibitor, clade B, member 9f [Source:MGI Symbol;Acc:MGI:894671])

HSP 1 Score: 204.142 bits (518), Expect = 7.630e-61
Identity = 128/359 (35.65%), Postives = 199/359 (55.43%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEF--SVVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDA-ADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVV 1225
            F + LLK LC+++ SKNV YSPMSI  AL M L GAKGDT+ ++ + LH +    E  HQ     +   N     +  +R+AN+LF+EN  ELL ++ ++  KFY+  +E++ F    ++S + IN WV  QTNGKI DLL  +++NS TRLIL NA+YF  +W   F  +   +  F +    + P  M+ + +T  +     +    + +P++ I   D +F+V+LP E   + K E  L  ++               HV +PKF+++  + +   L HLG++  F  + AD S M++K  L + + VHK  ++V E G EAAAA+AV  +  C  + P DP  F  DHPF+F ++
Sbjct:   11 FAIHLLKVLCQDNPSKNVCYSPMSISSALAMVLLGAKGDTAVQICQALHLNP--DEDVHQGFQLLLHNLNKQNNQKYCLRMANRLFVENTCELLPTFKESCLKFYHSEMEQLSFAKAAEESRQHINMWVSKQTNGKIPDLLSKDSVNSQTRLILANALYFHGTWCKRFEKNRTKEMPFKINKKETRPVQMMWREDTLFHAYVKEIQAQVLVMPYEGI---DLNFVVLLPDEGVDISKVENNLTFEKLTAWTKPEFMNRTEFHVYLPKFQLQEDYDMNSLLQHLGILNVFDGSKADLSGMSTKENLCLSEFVHKCVVEVNEEGTEAAAASAVEFIFLC--LGP-DPETFCADHPFLFFIM 361          
BLAST of Serpin B6 vs. Ensembl Mouse
Match: Serpinb9g (serine (or cysteine) peptidase inhibitor, clade B, member 9g [Source:MGI Symbol;Acc:MGI:1919260])

HSP 1 Score: 200.29 bits (508), Expect = 2.398e-59
Identity = 125/363 (34.44%), Postives = 198/363 (54.55%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEF--SVVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDA-ADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGS 1237
            F + LLK LC+++ SKNV YSPMSI  AL M L GAKGDT+ ++ + LH +    E  HQ     +   N     +  + +AN+LF+EN  ELL ++ ++  KFY+  +E++ F    ++S + IN WV  QTNGKI DLL  +++NS TRLIL NA+YF  +W   F  +   +  F +    + P  M+ + +T  +     +    + +P++ I   D +F+V+LP E   + K E  L  ++               HV +PKF+++  + +   L HLG++  F  + AD S M++K  L + +  HK  ++V E G EAAAA+AV  +  C+     DP  F  DHPF+F ++ + +
Sbjct:   11 FAIHLLKVLCQDNPSKNVCYSPMSISSALAMVLLGAKGDTAVQICQALHLNP--DEDVHQGFQLLLHNLNKQNNQKYCLTMANRLFVENTCELLPTFKESCLKFYHSEMEQLSFAEAAEESRQHINMWVSKQTNGKIPDLLSKDSVNSQTRLILANALYFHGTWCKRFEKNRTKEMPFKINKKETRPVQMMWREDTLFHAYVKEIQAQVLVMPYEGI---DLNFVVLLPDEGVDISKVENNLTFEKLTAWTKPEFMNRTEFHVYLPKFQLQEDYDMNSLLQHLGILNVFDGSKADLSGMSTKENLCLSEFAHKCVVEVNEEGTEAAAASAVKFIFLCS---GPDPETFCADHPFLFFIMHRTT 365          
BLAST of Serpin B6 vs. Ensembl Mouse
Match: Serpinb9h (serine (or cysteine) peptidase inhibitor, clade B, member 9h [Source:MGI Symbol;Acc:MGI:3709608])

HSP 1 Score: 199.904 bits (507), Expect = 3.224e-59
Identity = 126/359 (35.10%), Postives = 196/359 (54.60%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEF--SVVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDA-ADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVV 1225
            F + LLK LC+++ SKNV YSPMSI  AL M L GAKGDT+ ++ + LH +    E  HQ     +   N     +  + +AN+LF+EN  ELL ++ ++  KFY+  +E++ F    ++S + IN WV  QTNGKI DLL  +++NS TRLIL NA+YF  +W   F  +   +  F +    + P  M+ + +T  +     +    + +P++ I   D +F+V+LP E   + K E  L  ++               HV  PKF+++  + +   L HLG++  F  + AD S M++K  L + + VHK  ++V E G EAAAA+AV  +  C+     DP  F  DHPF+F ++
Sbjct:   11 FAIHLLKVLCQDNPSKNVCYSPMSISSALAMVLLGAKGDTAVQICQALHLNP--DEDVHQGFQLLLHNLNKQNNQKYCLTMANRLFVENTCELLPTFKESCLKFYHSEMEQLSFAEAAEESRQHINMWVSKQTNGKIPDLLSKDSVNSQTRLILANALYFHGTWCKRFEKNRTKEMPFKINKKETRPVQMMWREDTLFHAYVKEIQAQVLVMPYEGI---DLNFVVLLPDEGVDISKVENNLTFEKLTAWTKPEFMNRTEFHVYYPKFQLQEDYDMNSLLQHLGILNVFDGSKADLSGMSTKENLCLSEFVHKCVVEVNEEGTEAAAASAVEFIFLCS---GPDPETFCADHPFLFFIM 361          
BLAST of Serpin B6 vs. Ensembl Mouse
Match: Serpinb9e (serine (or cysteine) peptidase inhibitor, clade B, member 9e [Source:MGI Symbol;Acc:MGI:894672])

HSP 1 Score: 199.519 bits (506), Expect = 4.617e-59
Identity = 126/360 (35.00%), Postives = 198/360 (55.00%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDKT--FHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDA-ADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRC-APMRPIDPIEFNCDHPFMFAVV 1225
            F + LLK LC+++ S+NV YSPMSI  AL M L GAKGDT+ ++ + LH +    E  HQ     +   N     +  + +AN+LF+EN  ELL ++ K+  KFY+  IE++ F    ++S + IN WV  QT GKI DLL  ++++S TRLIL NA+YF+ +W   F     K   F +    + P  M+ + +T+ +     +    + +P++ I   D +F+V+LP +   + K E  L  ++              +HV +PKF+++  + +   L HLG++  F  + ADFS M++K  L +   VHK  ++V E G EA AA+A  ++L C  P    DP  F  DHPF+F ++
Sbjct:   11 FAIHLLKVLCQDNPSENVCYSPMSISSALAMVLLGAKGDTAVQICQALHLNP--DEDVHQGFQLLLHNLNKPNNQKYCLTMANRLFVENTCELLPTFKKSCLKFYHSEIEQLSFAEAAEESRQHINMWVSKQTKGKIPDLLSEDSVDSQTRLILANALYFQGTWCKFFEKDSTKEVPFKINKKETRPVQMMWQEDTFFHAYVKEIQAQVLVMPYEGI---DLNFVVLLPDQGVDISKVENNLTFEKLTAWTKPEFMNRTELHVYLPKFKLQEDYDMNSLLQHLGILDVFNGSKADFSGMSTKENLCLSKFVHKCVVEVNEEGTEAVAASAGKIILFCDGP----DPEVFCADHPFLFFIM 361          
BLAST of Serpin B6 vs. Ensembl Mouse
Match: Serpinb3d (serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 3D [Source:MGI Symbol;Acc:MGI:2683295])

HSP 1 Score: 191.815 bits (486), Expect = 4.715e-56
Identity = 125/397 (31.49%), Postives = 207/397 (52.14%), Query Frame = 2
Query:  134 LMEISCQKFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQL------------NSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQ---EWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPF-TDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLP--LFIGHCA 1264
            L  ++  KF L+L + L + D   N+ YSP+S+   L M L GAK +T  ++ K LH+++             + E+ HQQ    +   N    +   ++V N ++    +  L +++K + K+Y   +E +DF    ++S + IN W+  QTNGKIKDL    ++NS T L+LVNA+YFK  W ++F      ++ F L   +S P  M+ +   + ++    +    V+IP+K     + S  V+LP+E   L KFE  L      +W       + E   +++++P+F++E  + L+  L H+GMV  F    ADFS M++   L++  V+HK+F++V E G EAA A +V       P     P +F+C+HPF+F V+KQ      LF G  +
Sbjct:    3 LFAVATTKFTLELYRQLRESD--NNIFYSPISMMRTLAMLLLGAKANTEQQIKKVLHFNETTKKTTEKSAESHDEENVHQQFQMLMTQLN-KFNNAYDLKVPNSIYGAKDFPFLQTFLKDIRKYYQANVESLDFAHAAEESQKKINSWMARQTNGKIKDLFPSGSLNSSTILVLVNAVYFKGQWNHKFDEKHTREEKFWLNKNTSKPVQMMKQRNKFNFIFLENVQAKIVEIPYK---GKELSMFVLLPVEIDGLKKFEEQLTADKLLQWTRAENMHMTE---LYLSLPQFKVEEKYDLRVPLEHMGMVDAFDPQKADFSGMSNSQGLVVSKVLHKSFVEVNEEGAEAATAMSVESRSLSVP----KPNDFSCNHPFLF-VMKQNKTNSILFFGRVS 385          
BLAST of Serpin B6 vs. UniProt/SwissProt
Match: sp|O02739|SPB6_BOVIN (Serpin B6 OS=Bos taurus OX=9913 GN=SERPINB6 PE=2 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 9.022e-57
Identity = 140/375 (37.33%), Postives = 210/375 (56.00%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNS--ESFHQQLSDCIKTSNVDEKD-QGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDA-ADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV--VKQGSLPLFIGH 1258
            F L LLK L  E  SKNV  SP+SI  AL M L GAKG+T+ +M +TL  ++ +   E  HQ   + +  S V+ +D Q  +R AN+LF E  Y+ L S+  +  KFY   +E++DF S  ++S + IN WV  +T GKI+DLL  N++N +TRL+LVNAIYFK +W  +F+     ++ F +      P  M+ K  T K      +G  + QI        + + +++LP E   L   E  L  +++       + +   V V +P+F +E S+ ++E L  LGM   F +  ADFS M+S   L +  V+HK+F++VTE G EAAAAT  ++M+RC  + P     FN +HPF+F +   K G++ LF G 
Sbjct:   11 FALTLLKKL-GEGNSKNVFISPLSISSALAMVLLGAKGNTAAQMCQTLSLNKSSGGGEDVHQGFQNLL--SEVNRRDTQYLLRTANRLFGEKTYDFLSSFKDSCHKFYQAEMEELDFVSATEQSRKHINTWVAEKTEGKIRDLLPANSVNPMTRLVLVNAIYFKGNWDTQFNKEHTEERPFRVSKNVEKPVQMMFKKSTCKI---TYIGEISTQILVLPYVGQELNMVILLPSESTDLNTVEKALTYEKFIAWTKPDVMDEEEVEVFLPRFTLEESYDMEEFLQELGMTDAFEETRADFSGMSSGRGLHLSKVMHKSFVEVTEEGTEAAAATGAVVMMRCLMVVP----RFNANHPFLFFIQHSKTGAI-LFCGR 374          
BLAST of Serpin B6 vs. UniProt/SwissProt
Match: sp|Q5JJ64|Y1782_THEKO (Uncharacterized serpin-like protein TK1782 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) OX=69014 GN=TK1782 PE=3 SV=1)

HSP 1 Score: 196.823 bits (499), Expect = 1.003e-56
Identity = 134/374 (35.83%), Postives = 211/374 (56.42%), Query Frame = 2
Query:  146 SCQKFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEF--SVVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVV-KQGSLPLFIGH 1258
            +   F  DL K L   +   NV +SP SI  AL M   GA+G T+ EM + LH  + + ++        + +    E     +R  N L+++  Y L + Y+  V +FY G  +++DFQ NP ++ R+IN WVE QTNG+IKD++  + ++ LTRL++ NA+YFK +W + F  S   ++TFH  NG+ I   M+ +T  + Y +N  L   A+++P++    +    +++LP E     K E  L     + +  +   E   V V +PKFR E+S+KL++ LM +GM + F    DFS +++   L I+DVVHK+FI V E+G EAAAATAV + +  APM+  +P  F  DHPF+F +  ++    LF+G 
Sbjct:   62 AINSFTFDLYKELAGNN--NNVFFSPFSIETALAMAYEGARGKTAEEMKRVLHLPE-DDDARWTGFRYLLLSLKSPEGSPFILRSVNALWVQRGYSLREEYLGIVKEFYLGEAKEVDFQGNPAEAAREINEWVEEQTNGRIKDIV--SGLSPLTRLVITNAVYFKANWSSRFRASDTRNETFHAPNGTVI-VPMMHQTGEFPYFENDDL--QALELPYE---GERLGMLIILPKE-GKFEKVEGNLSAGSIENILKNMREE--KVKVALPKFRFEASYKLRDVLMDMGMKRAFL-VPDFSGISNGENLAIEDVVHKSFISVAENGTEAAAATAVTLTMN-APMQEKEPKIFKADHPFIFFIYDRETGTILFMGR 419          
BLAST of Serpin B6 vs. UniProt/SwissProt
Match: sp|Q5R899|SPB6_PONAB (Serpin B6 OS=Pongo abelii OX=9601 GN=SERPINB6 PE=2 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 7.964e-54
Identity = 135/366 (36.89%), Postives = 202/366 (55.19%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNS-----ESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQ---EWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFT-DAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV 1222
            F L+LLKTL K D SKNV +SPMS+  AL M   GAKG+T+ +M + L +++  S     + F   L++  KT       Q  +R AN+LF E   + L S+  +  KFY   +E++DF S  +KS + IN WV  +T GKI +LL P +++ LTRL+LVNA+YF+ +W  +F      ++ F +      P  M+ K  T+   K   +G    QI        + + +++LP E   L   E  L  +   EW  +    + +   V V++P+F++E S+ ++  L +LGM   F    ADFS M S+ +L +  VVHK+F++V E G EAAAATA +MM+RCA   P     F  DHPF+F +
Sbjct:   11 FALNLLKTLGK-DNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQVLSFNKSGSGGDIHQGFQSLLTEVNKTGT-----QYLLRTANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTF---KKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRL---DMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKADFSGM-SQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVP----RFCADHPFLFFI 359          
BLAST of Serpin B6 vs. UniProt/SwissProt
Match: sp|P35237|SPB6_HUMAN (Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3)

HSP 1 Score: 186.422 bits (472), Expect = 2.810e-53
Identity = 134/366 (36.61%), Postives = 202/366 (55.19%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNS-----ESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQ---EWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFT-DAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV 1222
            F L+LLKTL K D SKNV +SPMS+  AL M   GAKG+T+ +M + L +++        + F   L++  KT       Q  +R+AN+LF E   + L S+  +  KFY   +E++DF S  +KS + IN WV  +T GKI +LL P +++ LTRL+LVNA+YF+ +W  +F      ++ F +      P  M+ K  T+   K   +G    QI        + + +++LP E   L   E  L  +   EW  +    + +   V V++P+F++E S+ ++  L +LGM   F    ADFS M S+ +L +  VVHK+F++V E G EAAAATA +MM+RCA   P     F  DHPF+F +
Sbjct:   11 FALNLLKTLGK-DNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQGFQSLLTEVNKTGT-----QYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQSTF---KKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRL---DMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKADFSGM-SQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVP----RFCADHPFLFFI 359          
BLAST of Serpin B6 vs. UniProt/SwissProt
Match: sp|Q60854|SPB6_MOUSE (Serpin B6 OS=Mus musculus OX=10090 GN=Serpinb6 PE=1 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 7.842e-53
Identity = 141/381 (37.01%), Postives = 205/381 (53.81%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNS-------ESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFET-VLFQQ--EWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV--VKQGSLPLFIGH 1258
            F L+LLK L  ED SKNV  SPMSI  AL M   GAKG T+ +M + L  D+ +        + F   L++  KT       Q  +R AN+LF +   +LL S+  +  KFY   +E++DFQ   ++S + IN WV  +T  KIK++L P  +NS T L+LVNAIYFK +W+ +F+     +  F +      P  M+ K  T+K      +    + +P+    + + + +++LP E   L   E  V +++  EW  +  D + E   V V +PKF++E ++ + + L  LGM   F   ADFS M+SK  L +  VVHKAF++V E G EAAAATA MM +RC    P     F  DHPF+F +  VK   + LF G 
Sbjct:   11 FALNLLKIL-GEDSSKNVFLSPMSISSALAMVFMGAKGTTASQMAQALALDKCSGNGGGDVHQGFQSLLTEVNKTGT-----QYLLRTANRLFGDKTCDLLASFKDSCLKFYEAELEELDFQGATEESRQHINTWVAKKTEDKIKEVLSPGTVNSDTSLVLVNAIYFKGNWEKQFNKEHTREMPFKVSKNEEKPVQMMFKKSTFKMTYIGEIFTKILLLPYV---SSELNMIIMLPDEHVELSTVEKEVTYEKFIEWTRL--DKMDE-EEVEVFLPKFKLEENYNMNDALYKLGMTDAFGGRADFSGMSSKQGLFLSKVVHKAFVEVNEEGTEAAAATAGMMTVRCMRFTP----RFCADHPFLFFIHHVKTNGI-LFCGR 374          
BLAST of Serpin B6 vs. TrEMBL
Match: A0A1V5YH80 (Serpin (Serine protease inhibitor) OS=Chloroflexi bacterium ADurb.Bin180 OX=1852857 GN=BWY10_01432 PE=3 SV=1)

HSP 1 Score: 220.32 bits (560), Expect = 3.213e-63
Identity = 133/381 (34.91%), Postives = 207/381 (54.33%), Query Frame = 2
Query:  155 KFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHW---DQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEF--SVVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVG------VHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGS-LPLFIGHC 1261
            +  LDL +TL      +N   SP SI +AL MT  GA+ +T+ EM +TLHW   D L +      L    +  ++ + ++  + +AN ++ +  +   D ++  + ++YN G+  +DF  +PD + + IN WVE QT  KIKDLL   +I+SL R++L NAIYF  +W+  F      D  FH L+GS++   ++ ++E   Y   P  G+ AV++P+      D S +++LP E           F    K +  D+L   VG      V +++P+F  +S  +LK  L  LGM +PFT  ADFS MT + +L IDDV HKAF+ V E G E  AA A  +++R + M P++P+    D PF+F +   G+   LF+GH 
Sbjct:   61 RLALDLYRTLFNA--GENQFASPYSISLALAMTYAGARNETAAEMARTLHWMSVDDLPAAFNALDLLLRSRGQDLTKDERFRLNIANAIWGQQGFGFQDEFLDTLAQYYNSGLRLLDFSHSPDAARKVINQWVEEQTEDKIKDLLPEGSIDSLVRMVLTNAIYFNAAWQYPFDQQATHDGVFHRLDGSTVTVPLMHQSELLGYAAGP--GYQAVELPYV---GGDLSMLILLPDEGT---------FADWAKKLDADTLAGIVGSLEHQQVQLSLPRFSFDSEVQLKAALQKLGMSQPFTAEADFSGMTGRRDLFIDDVYHKAFVAVDESGTE--AAAATAVVIRLSGM-PLEPVAVTVDRPFLFLIRDTGTGAVLFLGHV 422          
BLAST of Serpin B6 vs. TrEMBL
Match: A0A517PTF1 (Serpin (Serine protease inhibitor) OS=Planctomycetes bacterium HG66A1 OX=2527967 GN=HG66A1_44640 PE=3 SV=1)

HSP 1 Score: 218.009 bits (554), Expect = 1.922e-62
Identity = 140/402 (34.83%), Postives = 214/402 (53.23%), Query Frame = 2
Query:  155 KFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNS---ESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEF--SVVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIH-----------------------NDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFT-DAADFSSMTSKPE-LMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVV-KQGSLPLFIGHCAQ 1267
            +F   L   L + + S N+ +SP SI  AL MTL GA+G+T+ EM + L   Q      ESFH  L++  +T  V+      + VAN+L+ +  Y+ L  ++  V ++Y GG++ +DFQ NP  +   IN WV  +T GKI ++  P + N LTRL+LVNAIYFK +W+ EF   +  D+ FH+      P  M+ +T T+ Y +N  +    +++P+++ +                         D+S  ++LP E+ +L   E+ L  +        +  E +   V++P+F++E  ++L   L  LGM + F  D ADFS MT  PE L I  V+HK F++V E G EAAAAT V++   CA M P  PI F  DHPF+F +  +Q  L  F+G   Q
Sbjct:   25 RFACALFAELSRVN-SGNLFFSPASISTALAMTLAGARGETAKEMKQALRLTQEGQQLHESFHHLLTET-RTGGVE------LNVANQLWGQADYQFLTPFLDTVREYYGGGLQSVDFQGNPGDAAAQINQWVSQETRGKITEVASPLSFNELTRLVLVNAIYFKGTWEEEFDPELTRDEPFHISAEQQTPVPMMHQTNTFGYYENELV--QVLELPYRQQNVVMQPVEAEDGSFYMTAQEIPGGGSDFSMCIILPREQGTLQTVESELNSETLDQWLSTNHREVI---VSLPRFQLELEYELNAPLEALGMKQAFGPDTADFSGMTDDPEGLFIGSVLHKTFVEVNEQGTEAAAATGVIIAAGCA-MEPEPPIVFRADHPFLFLIRDRQTRLIYFMGRYQQ 412          
BLAST of Serpin B6 vs. TrEMBL
Match: F1L1S5 (Serpin-like protein OS=Ascaris suum OX=6253 PE=2 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 2.994e-62
Identity = 145/380 (38.16%), Postives = 223/380 (58.68%), Query Frame = 2
Query:  137 MEISCQKFGLDLL-KTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQG-TIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEF--SVVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVL-FQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLPLFIGHC 1261
            ++I+   F L+LL K+   E   K+ I SP SI +AL MT  GA+G+T  +M   L    +++E F++  +  ++   V + ++G  +  ANKLF++  ++L +SY+  +   Y+G +E++DF S       +IN WVENQTN KI +L++ +    LTR+IL+NAIYFK +W N F  S    KTF+  +G +    M+S  E + Y +N  +    + +P+K   N D    V LP+E+  L  FE  L  QQ  + ++  +  E +   V +PKF++E  F+L   L  LG++  F + A+FS ++ +P L+I DV+HKAFI+V E G EAAAAT V +ML  A +   +P  F  DHPF+FA+VK G+  LFIGH 
Sbjct:   33 LDIAQADFALNLLSKSGSDEAAHKSAILSPFSIAVALAMTYAGAEGNTYKQMNDVLAAG-VSNEEFNEYFAKILQ--EVSQPNEGYQLSSANKLFVKEGFDLKESYLNIIRSIYDGQLEQVDF-SQAIAVANEINEWVENQTNSKITNLVRADMFTPLTRMILINAIYFKGTWSNVFSESRTRKKTFYEADGVTRQVDMMSIKEDFPYYENEKV--QVLGLPYK---NSDVYMYVFLPIEKYGLAAFEESLNGQQMLEMIYNATEQEVI---VELPKFKLERQFQLVNSLKKLGIIDAFDENANFSGISDQP-LVISDVIHKAFIEVNEKGTEAAAATGVQIMLLSARIPLHEPRRFIADHPFLFAIVK-GNTILFIGHI 398          
BLAST of Serpin B6 vs. TrEMBL
Match: A0A518IGV0 (Serpin (Serine protease inhibitor) OS=Planctomycetes bacterium Enr17 OX=2527976 GN=Enr17x_43550 PE=3 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 1.690e-61
Identity = 141/406 (34.73%), Postives = 212/406 (52.22%), Query Frame = 2
Query:  149 CQKFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQ---QLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFS--VVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIH--------NDDYSFM---------------VVLPLERCSLPKFETVLFQ---QEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFT-DAADFSSMTSKPE-LMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVV-KQGSLPLFIGHCA 1264
            C +F  +L   L  E    N+ +SP SI MAL MTL GAKG+T+ EM +TL +  L     H+   +L    +T  V+      + VAN+L+ +  Y  L  Y+K  + +Y  G+E +DFQ+ P ++   IN WV  QTNGKI  L+ P   N LTRL+L NAIYF   W++EF      +++F L         ++ +T ++ Y ++  +    +++P++R           D +S+M               ++LP E   LP  E+ L     Q+W             V+V++P+FR+E+S  L ++L  LGM +PF+ D ADFS+M+  PE L I  ++HKAF++V E G EAA  T V+M   CA      P EF  DHPF+F +  +Q  L  F+G  A
Sbjct:   21 CNQFACELFSKLAGES-EGNLFFSPGSISMALAMTLAGAKGETAREMQETLGFS-LEPARVHEAFRRLRTETRTGGVE------LNVANRLWGQAGYHFLPEYLKTTEHYYAAGLETVDFQNAPGETASQINAWVTKQTNGKIDSLVSPLQFNELTRLVLTNAIYFLGGWEDEFQPEATKEQSFQLSRSEETIVPLMHQTNSFGYGEDEEM--QVLELPYRRHEYTTRLVESEDGFSYMEHEEIPGGGSDFVMNILLPREPDGLPAIESQLHSATLQKWMKTRSHE------VNVSLPRFRVEASMDLDQQLQSLGMQRPFSRDYADFSNMSDDPEGLFIGAILHKAFVEVNEKGTEAAGVTGVIMAGGCA-RDEEPPKEFRADHPFLFLIRDRQTRLIHFMGRLA 409          
BLAST of Serpin B6 vs. TrEMBL
Match: U3EQV8 (Serpin B6 OS=Micrurus fulvius OX=8637 PE=2 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 3.078e-61
Identity = 140/383 (36.55%), Postives = 219/383 (57.18%), Query Frame = 2
Query:  137 MEISCQKFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLE----RCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDA-ADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLP-LFIGHC 1261
            + ++   F L+L K L   D +KN+ +SP+SI  AL M   GAKG+T  +M K L   +      HQ+    I   N    +   + +AN+LF E  Y+ L S++++ +KFY+ G+EK++F+ + + S R IN WVE +T+GKI+DLL P  INSLT+L+LVNAIYFK +W ++F+     +K F +    S    M+ K   Y          + ++IP+    +++ S +++LP +       L K E  +  ++          +   + ++ PKF++E  + LK  L ++GM+  F +  ADFS M++K +L+I +VVHK+FI+V E G EAAAATA +MMLRCA   P    EF  DHPF+F V+++ +   LF G C
Sbjct:    4 LSVANTTFALNLFKKLSANDPTKNLFFSPLSISSALLMVSLGAKGNTEAQMSKVLSVSK--DREVHQKFEKLISEINKPGANY-ILSLANRLFGETSYDFLASFIESTEKFYHAGLEKLNFKVSAEDSRRHINAWVEEKTSGKIQDLLLPGIINSLTKLVLVNAIYFKGNWADKFNKDHTAEKPFRINKNESKTVQMMFKKAKYNMTYISDYRTSILEIPYV---DNELSMIILLPEKIEDNSTGLEKLEREITYEKLMDWINPEAMDLREIELSFPKFKLEEKYDLKPVLKNMGMMDAFDEGKADFSGMSTKNDLVISEVVHKSFIEVNEEGTEAAAATAAVMMLRCAMFVP----EFKIDHPFLFFVIRRSTKSILFFGRC 376          
BLAST of Serpin B6 vs. Ensembl Cavefish
Match: SERPINB8 (leukocyte elastase inhibitor-like [Source:NCBI gene;Acc:103033961])

HSP 1 Score: 183.341 bits (464), Expect = 4.868e-53
Identity = 126/372 (33.87%), Postives = 203/372 (54.57%), Query Frame = 2
Query:  137 MEISCQKFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSE---SFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDKT--FHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERC----SLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDA-ADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV 1222
            + ++   F LDL K +   +   N+ YSP+SI  AL M   GA G+T  +M +TL + + N +    F++ +S   K          ++ +AN+L+ E  Y+ ++ ++    + Y+  +E +DF+SN + +   IN WVE QT  KIKDLL    ++ LTRL+LVNAIYFK SW+ +F+  G +   F L    + P  M+++   +     P +    +++P+      D S +++LP E       L K E  L  +         + + V V V++P+F++E ++ +K  L+ +GMV  F     DFS M+   +L++  VVHK+F++V E G EAAAATA +MM+RCA M P  P  F  DHPF+F +
Sbjct:    4 LSVANTSFALDLFKKIRDGNKQGNLFYSPLSISSALAMVSLGAAGNTEAQMSETLQFSKANDDVHTGFNKLMSQLNKAGA-----PYSLSLANRLYGEQTYQFVEKFLGDTKQHYSAELEAVDFKSNAEAARVKINKWVEKQTQEKIKDLLAKGVVDELTRLVLVNAIYFKGSWEKKFNSNGTREVPFRLNKKDTKPVQMMNQKAKFPLAFTPDMNCQILEMPYA---GKDLSMLIILPTEMADDTTGLEKIEKNLTYENLMEWTRPDMMDNVEVQVSLPRFKLEDTYDMKGLLVSMGMVDAFDRVKCDFSRMSPCDDLVLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCA-MLP--PERFVADHPFLFFI 364          
BLAST of Serpin B6 vs. Ensembl Cavefish
Match: serpinb1l3 (leukocyte elastase inhibitor-like [Source:NCBI gene;Acc:103029950])

HSP 1 Score: 175.252 bits (443), Expect = 5.551e-50
Identity = 128/386 (33.16%), Postives = 205/386 (53.11%), Query Frame = 2
Query:  137 MEISCQKFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSE---SFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDK--TFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLE----RCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDA-ADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQ--GSLPLFIGH 1258
            + ++   F LDL K + + +   N+ YSP+SI  AL M   GA G+T  +M +TL +++   +    F+Q L++  K          ++ +AN+L+ E  Y+ ++ ++    + Y+  +E  DF+SN + +   IN WVE QT  KIKDLL    ++ LTRL+LVNAIYFK +W+  F     +   F L    + P  M+++ E +     P +    +++P++    +D S + +LP E       L K E  L  + +       + E V V V++P+F++E ++ +KE L+ +GMV  F     DFS M+    L++  VVHK+F++V E G EAAAATA +M L C     I    F  DHPF+F +     GS+ LF G 
Sbjct:    4 LSVANTSFALDLFKKIREGNKQGNMFYSPLSISSALAMVSLGAAGNTEAQMSETLQFNKAKVDIHIGFNQLLNELNKAG-----APYSLTLANRLYGEQTYQFVEKFLADTKQHYHAELETADFKSNSEAARVHINTWVEKQTQEKIKDLLAEGVVDELTRLVLVNAIYFKCNWEKRFLSFETREVQFKLNKKETKPVQMMNQEERFHLALIPDINCQILEMPYE---GNDLSMLFILPNEIQDDTTGLEKLEQSLTYENFMEWTRPDMMETVNVEVSLPRFKLEQTYDMKELLVSMGMVDAFDQVKCDFSRMSPCDNLVLSKVVHKSFVEVNEEGTEAAAATAAIMTLDCL---LICQRRFVADHPFLFFIRHNATGSI-LFCGR 377          
BLAST of Serpin B6 vs. Ensembl Cavefish
Match: serpini1 (serpin family I member 1 [Source:NCBI gene;Acc:103031312])

HSP 1 Score: 172.17 bits (435), Expect = 1.506e-48
Identity = 114/386 (29.53%), Postives = 199/386 (51.55%), Query Frame = 2
Query:  155 KFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDKTFHLL--NGSSIPTTMISKTETYKYLK----NPTLG--FAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQ---EWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPE----LMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV--VKQGSLPLFIGHC 1261
            +F + L   L      +N+I+SP+S+ +ALGM   GA+G +  E+ + + +     +     L +     + DE  Q  +R+AN LFL++       +++ + ++++  +E +DF S      + IN WV+N T  KI DL+  ++ +S+TR+ LVNA+YF+ SWKN+F     +TF     +GS + T M+ +   + Y +    +   G  +  +++P++    +D S M+VLP +   L   E ++  Q   +W             V V +P+F++E    L++ L  LG+   FT  AD S+MT++ E    L I   V K++++VTE G E AA + ++ + R   + P    +   DHPF F +   + GSL LF+G  
Sbjct:   29 EFSVRLYHQLQTAGGEENIIFSPLSVALALGMVELGARGSSLQEIRQAVGYSNFREDEEFSVLRNLTLALSGDEA-QYVVRLANSLFLQSGVHFNADFLRLMKQYFHAQVETVDF-SESAAVAQHINTWVQNHTESKIHDLVSADDFSSVTRITLVNAMYFRGSWKNQFRPENTRTFSFSKDDGSEVQTLMMYQQGDFYYGEFSDGSAEAGGVYQVLEMPYE---GEDVSMMIVLPRQEVPLATLEPIIRPQLLDDWANNVKKQ-----KVEVYLPRFKVEQKIDLRDTLQQLGIKNIFTKDADLSAMTAEREDGSDLFIGKAVQKSYLEVTEEGAEGAAGSGMIALTRTLVLYP----QVMADHPFFFVIRNRRTGSL-LFMGRV 399          
BLAST of Serpin B6 vs. Ensembl Cavefish
Match: SERPINB8 (leukocyte elastase inhibitor-like [Source:NCBI gene;Acc:103033961])

HSP 1 Score: 170.629 bits (431), Expect = 7.936e-48
Identity = 126/404 (31.19%), Postives = 208/404 (51.49%), Query Frame = 2
Query:  137 MEISCQKFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQL---------------NSESFHQ-QLSDCIKTSNV------DEKDQG---------------TIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDKT--FHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERC----SLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDA-ADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMF 1216
            + ++   F LDL K +   +   N+ YSP+SI  AL M   GA G+T  +M + L +++                 +++F + QL + ++   +      D+   G               ++ +AN+L+ E  Y+ ++ ++    + Y+  +E +DF+SN + +   IN WVE QT  KIKDLL    ++ LTRL+LVNAIYFK SW+ +F+  G +   F L    + P  M+++   +     P +    +++P+      D S +++LP E       L K E  L  +         + + V V V++P+F++E ++ +K  L+ +GMV  F     DFS M+   +L++  VVHK+F++V E G EAAAATA +MM+RCA M P  P  F  DHPF+F
Sbjct:    4 LSVANTSFALDLFKKIRDGNKQGNLFYSPLSISSALAMVSLGAAGNTEAQMSEVLGFNKRVKAKPAQAATVQHAQKAQTFQKAQLPEALQKKTLQFSKANDDVHTGFNKLMSQLNKAGAPYSLSLANRLYGEQTYQFVEKFLGDTKQHYSAELEAVDFKSNAEAARVKINKWVEKQTQEKIKDLLAKGVVDELTRLVLVNAIYFKGSWEKKFNSNGTREVPFRLNKKDTKPVQMMNQKAKFPLAFTPDMNCQILEMPYA---GKDLSMLIILPTEMADDTTGLEKIEKNLTYENLMEWTRPDMMDNVEVQVSLPRFKLEDTYDMKGLLVSMGMVDAFDRVKCDFSRMSPCDDLVLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCA-MLP--PERFVADHPFLF 401          
BLAST of Serpin B6 vs. Ensembl Cavefish
Match: serpinb1l2 (serpin family B member 1 [Source:NCBI gene;Acc:103035487])

HSP 1 Score: 149.443 bits (376), Expect = 2.537e-40
Identity = 116/365 (31.78%), Postives = 182/365 (49.86%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDKT--FHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCS----LPKFETVLFQQ---EWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFT-DAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV 1222
            F LDL + L  ++   N+ +SP+SI  AL M   G++G T+ EM + + +  +     H Q        N   K    +R+AN+L+ E  ++ L  +V++  K Y   ++ +DF    D+S + IN WVE QT  KIKDLL+P  +  +TRL LVNAIYFK +W   F+    K   F +         M+ + + + +   P      +++P+ +    + S +V+LP E       L K E+ L      +W     D +     + V +PKF++E    L+  L  +GM   F   AAD + M+S+  L +  V HKAF++V E G EAAAATA ++   C     +    F  DHPF+F +
Sbjct:   11 FALDLYRALSADNSVGNMFFSPLSISAALSMVYLGSRGATAKEMAEVMSFTSV--PDVHTQFKSLNSAIN-SPKASYILRLANRLYGEKTFKFLSEFVESTQKLYEADLQAVDFIGASDESRKLINHWVEEQTENKIKDLLKPGMVTGMTRLALVNAIYFKGNWLQRFNAQDTKEMPFKINKNEKKSVQMMYQMKKFPFNYIPDYNLQVLELPYVQ---KELSMLVLLPPEAEDGSDPLQKLESELTLDKLLDWTN--PDHMDTGTDIIVHLPKFKLEWESSLEGLLSKMGMSSVFQPGAADLTGMSSEGGLYLSAVAHKAFVEVNEEGTEAAAATAGIIAF-CM----LREEHFMADHPFLFFI 362          
BLAST of Serpin B6 vs. Ensembl Sea Lamprey
Match: SERPINB1 (serpin family B member 1 [Source:HGNC Symbol;Acc:HGNC:3311])

HSP 1 Score: 189.504 bits (480), Expect = 5.207e-56
Identity = 132/379 (34.83%), Postives = 206/379 (54.35%), Query Frame = 2
Query:  155 KFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTI-RVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPL----ERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTD-AADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCA-PMRPIDPIEFNCDHPFMFAVV--KQGSLPLFIGH 1258
            +F +D+ +TL   +   NV +SP+SI  AL M L GAKG TS +M K L ++ ++    H+     + T  +     G + RVAN+L+ E  +  L  +++A  KFY+  +  +DF  + D   + IN WVE +T+GKIKDLL+   ++ +TRL++VNA+YFK  W  +F+        FHL    +    M+S+  T+++     +    +++P+     +  S +++LP     E   L K E  L  Q  +T    +      V + +P+FR+E S+ L + L  LGM   F+   AD S M    +L +  V H+AF++V E G EAAAATAV M LRCA P +P  P +F  DHPF+F +   + GS+ LF+G 
Sbjct:   10 EFAIDVFRTLGAREVGGNVFFSPLSISAALAMVLLGAKGQTSEQMSKVLCYEGVSD--VHEAFKGLLGT--LKSPGAGCVLRVANRLYGEKSFGFLKGFLQATQKFYDAKLAAVDFTKSFDGVRKKINAWVEEKTDGKIKDLLEEGTLDVMTRLVIVNAVYFKGKWTKKFNSQNTTQSNFHLNQRETKQVQMMSQKNTFQHGFVQNMNLNVLELPYV---GNALSMIILLPAAIEDETNGLEKLERELNLQNLQTWTSPTTMRSGDVLLHLPRFRLEQSYTLNKPLSILGMGDLFSPLTADLSGMDGNRDLFVSHVAHRAFVEVNEEGTEAAAATAVTMKLRCAMPTQP--PFKFCADHPFVFLIRDNRNGSV-LFLGR 378          
BLAST of Serpin B6 vs. Ensembl Sea Lamprey
Match: SERPINB1 (serpin family B member 1 [Source:HGNC Symbol;Acc:HGNC:3311])

HSP 1 Score: 167.548 bits (423), Expect = 3.860e-48
Identity = 113/306 (36.93%), Postives = 168/306 (54.90%), Query Frame = 2
Query:  383 QGTI-RVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEF--SVVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPL----ERCSLPKFETVLF---QQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDA-ADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLP-LFIGHCA 1264
            QG++ R+AN+L+ E  Y  L  ++ +  KFY   +  ++F+   +++ ++IN WVE QT GKI+DLL    +NSLTRL+LVNA+YFK SW  +F   V  D  F +      P  M+ K   Y +     L    V++P++       S ++++PL    E   L K E+ L     ++W +    S  E   V + +P+FR+E S+ L E L  LGM   FT   ADFS +    +L +  V HKAF++V E G EAAAATA ++M+RCA M P+       DHPF+F + +  S   LF+G  A
Sbjct:   44 QGSVLRMANRLYGEKGYNFLQDFLDSSAKFYRAELAAVNFKGAFEEARKEINAWVEGQTEGKIQDLLASGVVNSLTRLVLVNAVYFKGSWDAKFDPEVTRDAEFKINKNEKKPVKMMYKKAKYNFSHVEELNVNIVELPYE---GHKLSMVILVPLAIEDETTGLEKLESALTLKSLRQWTSPENMSKLE---VELHLPRFRLEKSYTLNEHLQRLGMASVFTQGEADFSGINGARDLYVSHVAHKAFVEVNEEGTEAAAATAAIVMMRCARMGPV----VRADHPFIFFIRENSSGSVLFLGRFA 339          
BLAST of Serpin B6 vs. Ensembl Sea Lamprey
Match: SERPINB1 (serpin family B member 1 [Source:HGNC Symbol;Acc:HGNC:3311])

HSP 1 Score: 152.525 bits (384), Expect = 1.099e-42
Identity = 100/299 (33.44%), Postives = 159/299 (53.18%), Query Frame = 2
Query:  392 IRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPL----ERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTD-AADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCA-PMRPIDPIEFNCDHPFMFAVV--KQGSLPLFIGH 1258
            +R+AN+L+ E  +  L  ++   +KFY   +  +DF    +   ++IN WVE  T GKIKD+L    + S TRL++VNA+YFK  W   F++      TF+L    + P  M+ + + +++   P +    +++P+     ++ S +++LP     E   L K E  L     +T    +      V + +P+FR+E S+ L E L  LGM   F+   AD S M    +L +  V H+AF++V E G EAAAAT + +ML CA P +P  P  F  DHPF+F +   + GS+ LF+G 
Sbjct:   29 LRLANRLYGEKTFGFLKEFLDMTEKFYEAELAAVDFTGAFNDVRKEINSWVEGNTEGKIKDILAEGTVGSTTRLVVVNAVYFKGKWTTPFNLQNTAQTTFYLSKRETKPVQMMFQEKKFRHGFVPHMNLKVLELPYV---GNELSMIILLPAAIEDETTGLEKLERELNLLNLQTWTSPTTMRSGDVLLHLPRFRLEQSYTLNEPLSSLGMGDLFSPLTADLSGMDGNRDLFVSHVAHRAFVEVNEEGTEAAAATTISVMLMCAMPTQP--PFTFCADHPFVFLIRDNRNGSV-LFLGR 321          
BLAST of Serpin B6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008982.1 (pep scaffold:Pmarinus_7.0:GL477391:47974:54419:1 gene:ENSPMAG00000008124.1 transcript:ENSPMAT00000008982.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 124.02 bits (310), Expect = 2.102e-31
Identity = 103/384 (26.82%), Postives = 183/384 (47.66%), Query Frame = 2
Query:  137 MEISCQKFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQ--PNNINSLTRLILVNAIYFKNSWKNEFSVVGDKT----FHL-LNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV--VKQGSLPLFIGHC 1261
            + +S   FG DL + + +E   +N+  SP++  + L M   GA G T   + + L++  L + + H    D I+        +   ++A ++F     ++   ++  V++ Y+   E ++     +K  + IN WVE +T+GKIKD L+  P+N+    R++L++AIYFK  W+ +F    D T    FH+     ++   M       K  ++P L +   Q+ F+     D + ++ LP E  +           +      +S  +     V +P+ R++    L   L HLG+   F  A DF+ ++ +P L++  V H A +D+TE G EAAA T V +  R  P+ P+    F  D PF+F +     G++ LF+G  
Sbjct:   42 LAMSQANFGFDLYRAVAQESPGENIFMSPLTTSLVLAMLTAGAHGATEQALARALYFTHLRNPNLHGTFRDLIQKIT---SGKSVSKMAARIFAARNIKIKKDFLDVVEQNYHAKPENLN--GPEEKDLKRINSWVEEKTDGKIKDFLKELPSNL----RMLLLSAIYFKGKWEQQF--YKDNTSPVWFHINEENKTMVDMMYDSIYPVKAGRHPYLPYKVAQLEFQ----GDKNMLIFLPDEVTTNLTALEQSLSSDLLLNLTESELKSGNRIVYLPRLRLKMKKDLSTALNHLGLDDLFM-APDFNKISEEP-LLVSAVTHVATMDLTEEGAEAAAVTGVFLS-RTNPIYPV----FKVDRPFLFLIRDTSTGTV-LFLGRV 402          
BLAST of Serpin B6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006795.1 (pep scaffold:Pmarinus_7.0:GL479006:3227:9631:1 gene:ENSPMAG00000006108.1 transcript:ENSPMAT00000006795.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.013 bits (297), Expect = 1.963e-29
Identity = 98/388 (25.26%), Postives = 178/388 (45.88%), Query Frame = 2
Query:  146 SCQKFGLDLLK-TLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQL-------NSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFS--VVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQ---EWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPID-PIEFNCDHPFMFAVVKQGSLP-LFIGHCA 1264
            +    G  L K  L     + N+ +SP+SI  ALG+   GA G T  E+   L + +L        S  +  +L+  +   +   +  G     N +F +    L   + + V   +   +  +DF  + + +   +N ++E  T+ K  D++  +++++ T L++VN IYFK SW N+F   +  +  F + +  S+    + +     Y ++  L    +++P++       S +V++P     LPK E  + Q+   EW ++ G S      V +++PKF+I  S+ LK  L  +GM   F+  AD S +T   +L +D + HK+ + V E G EA A T          + PI  P     D PF+  +  + +   +F+G  A
Sbjct:  109 AVNGLGFRLYKQVLGGAGPADNIFFSPLSIASALGVVAAGANGSTRAELDTALGFKELLHGKKKAKSMKYFARLNSALYRRSAGFELMGK----NVVFSKKGLWLYRQFTRTVAHLFKSNVRSVDFGESKE-AVELMNAYIEKVTSKKFTDVI--SDVDTATSLMIVNVIYFKGSWANKFEPDLTKNVRFWVNSSYSMMVPTMHQRAKLSYAQDRKLRSTVIKLPYE----GGASMLVIVPHRTEELPKVEESVSQEQLEEWLSLLGPSNHY---VQLSLPKFKISVSYDLKAYLSAMGMPSMFSYGADLSRITGMQKLHVDKITHKSVLHVNEEGTEAKAET-------VVGIMPISMPPTVTVDRPFVVLIYDEKTRAVIFMGRVA 475          
BLAST of Serpin B6 vs. Ensembl Nematostella
Match: EDO40288 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7S1])

HSP 1 Score: 191.815 bits (486), Expect = 1.208e-56
Identity = 129/366 (35.25%), Postives = 197/366 (53.83%), Query Frame = 2
Query:  143 ISCQKFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDKT--FHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQ---QEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDA-ADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV 1222
            +S   F LDL + L  +D   N+ YSP SI +AL MT  GA+G+T+ +M KT H+     E FH    D ++  N    D   I +AN+LF +  +E+L+ + KA  + ++  +  +D+  N + +   +N WVE +T  KIK+L+     N  T L LVNA+YFK SW   F+    ++  F       I    + ++  ++YL++ TLG   V++P+     +  S +V+LP E   L K E+ L +   QE  T   +S  E   V VT+PKF +   F L E L  +G    F+   AD S +++ P L++ +VVHKAF++V E G  AAAAT V +ML   PM P+    F  +HPF+F +
Sbjct:    8 LSTNAFALDLHRVLTAQDGQTNLFYSPASIVVALAMTYLGARGNTATQMTKTFHFPTDVPEKFH----DFLQALNASNSDGNQILMANRLFAQMGFEILEEFKKASKESFSAEMALVDYVKNSNGARDTVNRWVEQKTKDKIKNLIPEGMFNKDTILCLVNAVYFKGSWMKHFNRNATQSGKFKTTPSQEIQVQFMYQSSEFRYLESSTLGCQIVELPYA---GEKLSMVVLLPNEVDGLGKLESSLNKETLQEAMTSLRNSHPE--EVEVTLPKFTLTQEFSLGETLKGMGASDLFSPGKADLSGISAAP-LVVSEVVHKAFVEVNEEGTIAAAATGVGIMLMSMPMNPV----FYANHPFLFLI 359          
BLAST of Serpin B6 vs. Ensembl Nematostella
Match: EDO35650 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKW7])

HSP 1 Score: 188.734 bits (478), Expect = 1.634e-55
Identity = 134/375 (35.73%), Postives = 200/375 (53.33%), Query Frame = 2
Query:  188 KEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQL-----NSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDKT--FHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGD-SLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTD-AADFSSMTSKPE-LMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLPLFIGHC-AQC*LF 1279
            K D +KN  YSP SI +ALGM   GA+G+T+ EM   +HW+       +    H++LS  +       +    + +AN LFL+  + +L  +     K+Y+  I  +D++++ + + + +N WVE +T  KI DL+ P   N LTRL LVNAIYFK  W   F      +  F   + + +   M+ +   +KYL +       +++P+    +   S ++VLP E   L +FE  L   +   +F   S      V V +PKF++ S FKL E L  LGM K F   AADF+ ++  PE L +  V+HKAF++V E G EAAAATA +MM+RCA MR  +P+ F  DHPF+F           I HC ++C LF
Sbjct:   10 KGDAAKNTFYSPASICVALGMVYAGARGETADEMATAMHWEGHKPMLPSKHQEHKELSVALNNPGATNE----MSIANNLFLQKDFSILKEFTDICQKYYDADISLVDYKTDFEGARKHVNQWVEERTKKKICDLIAPGVFNMLTRLTLVNAIYFKGMWDKPFKKEHSHSSEFRTTSSNEVEVEMMFQKSKFKYLHSDKYKCKLLELPYV---DTQLSMVLVLPDETEGLARFEQDLTHDKMTDIFNSVSSQRPADVEVYIPKFKMTSEFKLNEALQELGMKKMFDQAAADFTGISLPPEHLFVSAVLHKAFVEVNEEGTEAAAATAAIMMMRCAIMR--EPLVFRADHPFLF----------LIQHCKSKCVLF 365          
BLAST of Serpin B6 vs. Ensembl Nematostella
Match: EDO35632 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKW8])

HSP 1 Score: 180.259 bits (456), Expect = 3.388e-52
Identity = 121/384 (31.51%), Postives = 204/384 (53.12%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQ---QLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDKTFHLL------NGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERC---SLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPF-TDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAV-VKQGSLPLFIGHCAQ 1267
            F L +L++L K   S NV +SP+S+ MALG+   G++G T+ ++     W +   E  H+   Q  + + TS++     G I++ NK++  +++E+L+ ++    +FY+  + ++DF +    + +++N WV  QT G IK+L+    INSLTRLI+VNA+YFK  WK EF    + TFH        + S I   M+++     +  +  +    V++P+     DD + +++LP E     SL K   V   ++W+ +  ++  E     V++PKFR+    +L+  L  LG+   F +  AD S +++   L +   +HKA I+V E G  AAA T V+M  R   M  +    F  DHPF+F++  K  S  LF+G   Q
Sbjct:   12 FALRILQSLSKSSAS-NVFFSPLSMSMALGLVYLGSRGTTAIQIANIFGWKESEFEETHRTFKQFHEALLTSDLG---YGEIQLVNKIWGHDEFEILEEFLHGTREFYHSEMAQVDFVNKAFDARKEVNAWVHQQTKGNIKELIPHGVINSLTRLIIVNAVYFKGVWKKEFG--EENTFHAAFFVPESHESKIEVEMMTRKMKVNFYYDADIKCRVVELPYS---GDDTAMVIILPEEPSGIFSLEKSIDVEIMEKWRRLMINTTVE-----VSIPKFRLSQKLELRSLLQDLGVSDIFDSRKADLSGISAAKGLYVSSAIHKAHIEVNERGTVAAATTGVVMAKRSLDMNEV----FYADHPFLFSIHHKPSSAILFLGKVMQ 377          
BLAST of Serpin B6 vs. Ensembl Medaka
Match: ENSORLT00000035931.1 (leukocyte elastase inhibitor-like [Source:NCBI gene;Acc:111946638])

HSP 1 Score: 191.045 bits (484), Expect = 6.349e-56
Identity = 131/378 (34.66%), Postives = 201/378 (53.17%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLE----RCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPF-TDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLP-LFIG-HCA 1264
            F LDL K L  +D + NV YSP SI  AL M + GA+G T+ +M ++L     + +  H   ++ +   N   K    + VAN+LF E  Y+ ++ ++    K Y   +EK++F    + +  +IN WVE QT GKIKD+L   ++N+LTRL+LVNAIYFK +W  +F      D  F L   +     M+ +   +     P +    +++P+K   + + S +V LP +       L K E  L  + +       +   V V V  P+F++E  + +K+ L+ +GM   F     DFS M+   +L++ +V HKAF++V E G EAAAATA +MMLRCA M    P  F  DHPF+F +    S+  LF G +C+
Sbjct:   14 FSLDLFKQLSNKDKTANVFYSPFSISSALAMVMLGARGTTASQMTESLKLRD-SQDQVHASFAELLGQLN-KPKASYALSVANRLFGEQTYQFVEEFLGNSRKHYKAELEKVNFMQGSEAARLNINTWVEKQTQGKIKDILAEGSLNNLTRLVLVNAIYFKGNWNKKFDAQETRDADFRLNKNAKKTVKMMYQKSKFPLTYIPEINCQILEMPYK---DKELSMLVFLPTDIEDSTTGLEKLEKALTYENFMEWTRPDMMNEVEVRVGFPRFKMEQKYDMKKVLVSMGMADAFDMSKCDFSGMSPANDLVLSEVFHKAFVEVNEEGTEAAAATAAVMMLRCALM----PAAFIADHPFLFFIRHNSSMSILFAGRYCS 382          
BLAST of Serpin B6 vs. Ensembl Medaka
Match: ENSORLT00000040134.1 (leukocyte elastase inhibitor-like [Source:NCBI gene;Acc:111946638])

HSP 1 Score: 191.045 bits (484), Expect = 6.349e-56
Identity = 131/378 (34.66%), Postives = 201/378 (53.17%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLE----RCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPF-TDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLP-LFIG-HCA 1264
            F LDL K L  +D + NV YSP SI  AL M + GA+G T+ +M ++L     + +  H   ++ +   N   K    + VAN+LF E  Y+ ++ ++    K Y   +EK++F    + +  +IN WVE QT GKIKD+L   ++N+LTRL+LVNAIYFK +W  +F      D  F L   +     M+ +   +     P +    +++P+K   + + S +V LP +       L K E  L  + +       +   V V V  P+F++E  + +K+ L+ +GM   F     DFS M+   +L++ +V HKAF++V E G EAAAATA +MMLRCA M    P  F  DHPF+F +    S+  LF G +C+
Sbjct:   14 FSLDLFKQLSNKDKTANVFYSPFSISSALAMVMLGARGTTASQMTESLKLRD-SQDQVHASFAELLGQLN-KPKASYALSVANRLFGEQTYQFVEEFLGNSRKHYKAELEKVNFMQGSEAARLNINTWVEKQTQGKIKDILAEGSLNNLTRLVLVNAIYFKGNWNKKFDAQETRDADFRLNKNAKKTVKMMYQKSKFPLTYIPEINCQILEMPYK---DKELSMLVFLPTDIEDSTTGLEKLEKALTYENFMEWTRPDMMNEVEVRVGFPRFKMEQKYDMKKVLVSMGMADAFDMSKCDFSGMSPANDLVLSEVFHKAFVEVNEEGTEAAAATAAVMMLRCALM----PAAFIADHPFLFFIRHNSSMSILFAGRYCS 382          
BLAST of Serpin B6 vs. Ensembl Medaka
Match: ENSORLT00000036493.1 (pep primary_assembly:ASM223467v1:20:10521870:10567427:1 gene:ENSORLG00000029922.1 transcript:ENSORLT00000036493.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 187.578 bits (475), Expect = 1.226e-54
Identity = 131/379 (34.56%), Postives = 201/379 (53.03%), Query Frame = 2
Query:  155 KFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLE----RCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPF-TDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLP-LFIG-HCA 1264
            KF LDL K L  ED   NV YSP SI  AL M + GA+G T+ +M ++L     + +  H   ++ +   N   K    + VAN+LF E  Y+ ++ ++    K Y   +EK++F    + +  +IN WVE QT GKI+D+L   ++N+LTRL+LVNAIYFK +W  +F      D  F L   +     M+ +T  +     P +    +++P+K   + + S +V LP +       L K E  L  + +       + + V V V  P+F++E  + +K+ L+ +GM   F     DFS M+   +L++ +V HKAF++V E G EAAAATA +MML CA     D   F  DHPF+F +    S+  LF G +C+
Sbjct:   13 KFSLDLFKQLSNEDKMANVFYSPFSISSALAMVMLGARGTTASQMTESLKLRD-SQDQVHASFAELLGQLN-KPKASYALSVANRLFGEQTYQFVEEFLGNSRKHYKAELEKVNFMQGSEAARLNINTWVEKQTQGKIRDILAEGSLNNLTRLVLVNAIYFKGNWNKKFDAQNTRDADFRLNKNAKKTVKMMYRTSKFPLTYIPEINCQILEMPYK---DKELSMLVFLPTDIEDSTTGLEKLEKALTYENFMEWTRPDMMKKVEVRVGFPRFKMEQKYDMKKVLVSMGMADAFDMSKCDFSGMSPANDLVLSEVFHKAFVEVNEEGTEAAAATAALMMLGCAKNFSTDV--FIADHPFLFFIRHNSSMSILFAGRYCS 384          
BLAST of Serpin B6 vs. Ensembl Medaka
Match: ENSORLT00000046159.1 (leukocyte elastase inhibitor-like [Source:NCBI gene;Acc:111946699])

HSP 1 Score: 182.185 bits (461), Expect = 6.575e-52
Identity = 122/379 (32.19%), Postives = 190/379 (50.13%), Query Frame = 2
Query:  155 KFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSV--VGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLE----RCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPF-TDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLP-LFIG-HCA 1264
            KF LDL K L  ED   NV YSP SI  AL M + GA+G T+ +M K+L     + +  H   ++ +   N   K    + VAN+LF E  Y+ ++ ++    K Y   +EK++F    + +  +IN WVE QT GKIKD+L   ++N+LTRL+LVNAIYFK +W  +F      D  F L   +     M+ +T  +     P +    +++P+K   + + S +V LP +       L K E  L  + +       +   V V V  P+F++E  + +K+ L+ +GM   F     DFS M+   +L++ +V HKAF++V     E   A A    ++   M       F  DHPF+F +    S+  LF G +C+
Sbjct:   71 KFSLDLFKQLSNEDKMANVFYSPFSISSALAMVMLGARGTTASQMTKSLKLRD-SQDQVHASFAELLGQLN-KPKASYALSVANRLFGEQTYQFVEEFLGNSRKHYKAELEKVNFMQGSEAARLNINTWVEKQTQGKIKDILAEGSLNNLTRLVLVNAIYFKGNWNKKFDAQETRDADFRLNKNAKKTVKMMYRTSKFPLTYIPEINCQILEMPYK---DKELSMLVFLPTDIEDSTTGLEKLEKALTYENFMEWTRPDMMNEVEVRVGFPRFKMEQKYDMKKVLVSMGMADAFDMSKCDFSGMSPANDLVLSEVFHKAFVEV---NEEGTEAAAATAFIKYGFMLNFSTDVFIADHPFLFFIRHNRSMSILFAGRYCS 441          
BLAST of Serpin B6 vs. Ensembl Medaka
Match: ENSORLT00000039962.1 (leukocyte elastase inhibitor [Source:NCBI gene;Acc:101163464])

HSP 1 Score: 176.407 bits (446), Expect = 2.604e-50
Identity = 115/378 (30.42%), Postives = 191/378 (50.53%), Query Frame = 2
Query:  158 FGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSE--SFHQQLSDCIKTSNVDEKDQG-TIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVG--DKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPL----ERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDA-ADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLP-LFIGH 1258
            F L + + L ++  + N+ +SP SI  AL M + GA+GDT+ +M + L       E  +  QQL +      +++   G  + VAN+L+ E  +  L  ++K     YN  +E +DF++  +++   IN WVE QT  KIKDL+    +N+ T L+LVNAIYFK +W  +F  +   D  F L      P  M+ +   + Y+K P +    +++P++     + S ++ LP     E   L + E +L  +++         +   V V +P+F++E  + LK+ L  +GMV  F  A  +FS +++  +L + D +HKAF++V E G E   A A   M  C     +    F  DHPF+F +    S+  LF G 
Sbjct:   14 FSLAMFRQLSEDHRTTNIFFSPFSISSALAMVMLGARGDTATQMAECLKTQDCQEEVHTLFQQLLE-----ELNKPRAGFLLSVANRLYGEQSFLFLKEFLKQTSSCYNAELESVDFRNKYEEARIKINSWVEKQTQDKIKDLVGEGILNNTTTLVLVNAIYFKGTWDQQFLGIRTEDAEFRLNKKDKNPVMMMRQEAKFPYVKIPEIDCQILEMPYE---GKELSMLIFLPREILDESTGLERLEKLLTYEKFMEWTSPEKMDLTKVDVRLPRFKMEEKYNLKKVLTRMGMVDAFDQAKCNFSGISAAKDLYLYDAIHKAFVEVNEKGTE---AAAATGMFMCNSSGNLKQQYFTADHPFLFFIRHNSSMNILFAGR 380          
BLAST of Serpin B6 vs. Planmine SMEST
Match: SMESG000032430.1 (SMESG000032430.1)

HSP 1 Score: 693.345 bits (1788), Expect = 0.000e+0
Identity = 344/349 (98.57%), Postives = 345/349 (98.85%), Query Frame = 2
Query:  224 MSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLPLFIGHCAQC 1270
            MSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDKTFHLLNGSS PTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVF DSLFEFVGVH+TMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSM SKPELMIDDVVHKAFIDVTEHGVEAAAATAVMMMLRCAPMRPIDPIEF CDHPFMFAVVKQGSLPLFIGHCAQC
Sbjct:    1 MSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDKTFHLLNGSSKPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFDDSLFEFVGVHITMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMISKPELMIDDVVHKAFIDVTEHGVEAAAATAVMMMLRCAPMRPIDPIEFICDHPFMFAVVKQGSLPLFIGHCAQC 349          
BLAST of Serpin B6 vs. Planmine SMEST
Match: SMESG000032448.1 (SMESG000032448.1)

HSP 1 Score: 517.694 bits (1332), Expect = 0.000e+0
Identity = 258/345 (74.78%), Postives = 290/345 (84.06%), Query Frame = 2
Query:  236 MALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLPLFIGHCAQC 1270
            MALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFK +W+  FSV G K FHL+NGS   T M+   E Y+YL + +LGF+AVQIPF+ I +D YS  V+LP    +LP+ E ++FQ  WK++  D LF+   V +TMPKFRIE SF LK++L +LGMVKPFT +ADFS MT++ +LM+DDVVHKAFID+ E+GVEAAAATAVMM+     +R  DPIEF CD PFMFA+VKQGSLPLFIG   QC
Sbjct:    1 MALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKGAWEKTFSVCGQKPFHLINGSVKSTNMMDNVEQYRYLNDSSLGFSAVQIPFRNIKDDHYSLFVILPKAPKTLPELEGLIFQHSWKSILSDELFQNKRVRITMPKFRIECSFSLKKKLQNLGMVKPFTSSADFSLMTNELDLMLDDVVHKAFIDIDENGVEAAAATAVMMVECMMIIREDDPIEFKCDRPFMFALVKQGSLPLFIGQFTQC 345          
BLAST of Serpin B6 vs. Planmine SMEST
Match: SMESG000032440.1 (SMESG000032440.1)

HSP 1 Score: 517.694 bits (1332), Expect = 0.000e+0
Identity = 258/345 (74.78%), Postives = 290/345 (84.06%), Query Frame = 2
Query:  236 MALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLPLFIGHCAQC 1270
            MALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFK +W+  FSV G K FHL+NGS   T M+   E Y+YL + +LGF+AVQIPF+ I +D YS  V+LP    +LP+ E ++FQ  WK++  D LF+   V +TMPKFRIE SF LK++L +LGMVKPFT +ADFS MT++ +LM+DDVVHKAFID+ E+GVEAAAATAVMM+     +R  DPIEF CD PFMFA+VKQGSLPLFIG   QC
Sbjct:    1 MALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKGAWEKTFSVCGQKPFHLINGSVKSTNMMDNVEQYRYLNDSSLGFSAVQIPFRNIKDDHYSLFVILPKAPKTLPELEGLIFQHSWKSILSDELFQNKRVRITMPKFRIECSFSLKKKLQNLGMVKPFTSSADFSLMTNELDLMLDDVVHKAFIDIDENGVEAAAATAVMMVECMMIIREDDPIEFKCDRPFMFALVKQGSLPLFIGQFTQC 345          
BLAST of Serpin B6 vs. Planmine SMEST
Match: SMESG000032457.1 (SMESG000032457.1)

HSP 1 Score: 437.958 bits (1125), Expect = 2.979e-152
Identity = 214/378 (56.61%), Postives = 285/378 (75.40%), Query Frame = 2
Query:  137 MEISCQKFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGEMMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYELLDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQPNNINSLTRLILVNAIYFKNSWKNEFSVVGDKTFHLLNGSSIPTTMISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLPLFIGHCAQC 1270
            ME SCQKF  DL +++  +++ KN+I+SP+SIY+ALGMTL+GA+G+T  EM K+L+W+Q N   +HQQL D IKT N++    GT+++ANKLFLE KY L+D+YVK++   Y+  I+++DF+++P+++C+DIN WVEN+TNGKIK+LLQ   IN+ T+LILVNAIYF  +W  +F V+G K F+LLNG+S    MIS +E + YLKN +L F+AV+IPFK + +  +SFM++LP ER SL K E  +FQ  W+T F D LF    V V MPKF+IE+SF L +EL  LGM+KPF+  ADFS MT   +LMI+DVVHKAFIDV E+G+EAAAATAV MML CA  +P  PIEF CDHPFMF ++KQ SLP F GH +QC
Sbjct:    1 MEFSCQKFSYDLFQSIINDNYDKNIIFSPISIYLALGMTLWGAQGETLSEMSKSLYWNQENCNLYHQQLHDVIKTCNIESSPNGTVKIANKLFLETKYNLIDTYVKSLSCLYDSKIKQLDFENHPEQACQDINNWVENETNGKIKNLLQQRQINNQTKLILVNAIYFNGAWLKQFKVIGHKQFYLLNGTSKSIEMISNSEHFSYLKNDSLKFSAVKIPFKIMESILFSFMIILPDERDSLAKVEQDIFQSNWETTFNDDLFTAKNVEVIMPKFKIENSFSLSDELKKLGMLKPFSPDADFSGMTGNKDLMINDVVHKAFIDVDENGIEAAAATAVTMMLGCAMTQPQQPIEFKCDHPFMFVLLKQDSLPFFTGHFSQC 378          
BLAST of Serpin B6 vs. Planmine SMEST
Match: SMESG000032440.1 (SMESG000032440.1)

HSP 1 Score: 209.534 bits (532), Expect = 1.157e-65
Identity = 110/184 (59.78%), Postives = 139/184 (75.54%), Query Frame = 2
Query:  719 MISKTETYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQEWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADFSSMTSKPELMIDDVVHKAFIDVTEHGVEXXXXXXXXXXLRCAPMRPIDPIEFNCDHPFMFAVVKQGSLPLFIGHCAQC 1270
            M+   E Y+YL + +LGF+AVQIPF+ I +D YS  V+LP    +LP+ E ++FQ  WK++  D LF+   V +TMPKFRIE SF LK++L +LGMVKPFT +ADFS MT++ +LM+DDVVHKAFID+ E+GVEAAAATAVMM+     +R  DPIEF CD PFMFA+VKQGSLPLFIG   QC
Sbjct:    1 MMDNVEQYRYLNDSSLGFSAVQIPFRNIKDDHYSLFVILPKAPKTLPELEGLIFQHSWKSILSDELFQNKRVRITMPKFRIECSFSLKKKLQNLGMVKPFTSSADFSLMTNELDLMLDDVVHKAFIDIDENGVEAAAATAVMMVECMMIIREDDPIEFKCDRPFMFALVKQGSLPLFIGQFTQC 184          
The following BLAST results are available for this feature:
BLAST of Serpin B6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SERPINB65.852e-5436.61serpin family B member 6 [Source:HGNC Symbol;Acc:H... [more]
SERPINB65.852e-5436.61serpin family B member 6 [Source:HGNC Symbol;Acc:H... [more]
SERPINB65.852e-5436.61serpin family B member 6 [Source:HGNC Symbol;Acc:H... [more]
SERPINB65.852e-5436.61serpin family B member 6 [Source:HGNC Symbol;Acc:H... [more]
SERPINB65.852e-5436.61serpin family B member 6 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Serpin B6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
srp-63.235e-4431.55SeRPin; Serine or cysteine protease inhibitor [So... [more]
srp-77.458e-4130.79SeRPin; Serine or cysteine protease inhibitor [So... [more]
srp-71.514e-4030.79SeRPin; Serine or cysteine protease inhibitor [So... [more]
srp-71.984e-4030.79SeRPin; Serine or cysteine protease inhibitor [So... [more]
srp-21.257e-3731.47SeRPin [Source:UniProtKB/TrEMBL;Acc:O17365][more]
back to top
BLAST of Serpin B6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spn42Da5.600e-6234.32gene:FBgn0265137 transcript:FBtr0086197[more]
Spn42Da2.620e-6134.32gene:FBgn0265137 transcript:FBtr0086201[more]
Spn42Da2.761e-6134.32gene:FBgn0265137 transcript:FBtr0086196[more]
Spn42Da1.612e-6034.32gene:FBgn0265137 transcript:FBtr0086198[more]
Spn42Da2.554e-5432.00gene:FBgn0265137 transcript:FBtr0300336[more]
back to top
BLAST of Serpin B6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
serpinb1l16.139e-5032.33serpin peptidase inhibitor, clade B (ovalbumin), m... [more]
serpinb1l16.139e-5032.33serpin peptidase inhibitor, clade B (ovalbumin), m... [more]
serpini16.233e-4929.59serpin peptidase inhibitor, clade I (neuroserpin),... [more]
serpini16.233e-4929.59serpin peptidase inhibitor, clade I (neuroserpin),... [more]
serpinb1l21.178e-4834.79serpin peptidase inhibitor, clade B (ovalbumin), m... [more]
back to top
BLAST of Serpin B6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp5mc11.191e-5634.35ATP synthase membrane subunit c locus 1 [Source:Xe... [more]
ENSXETT00000024938.11.071e-5431.91serpin peptidase inhibitor, clade B (ovalbumin), m... [more]
slc7a56.967e-5333.59solute carrier family 7 member 5 [Source:Xenbase;A... [more]
ENSXETT00000024879.16.859e-5232.53serpin peptidase inhibitor, clade B (ovalbumin), m... [more]
serpinb62.296e-5133.51serpin family B member 6 [Source:NCBI gene;Acc:493... [more]
back to top
BLAST of Serpin B6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Serpinb9f7.630e-6135.65serine (or cysteine) peptidase inhibitor, clade B,... [more]
Serpinb9g2.398e-5934.44serine (or cysteine) peptidase inhibitor, clade B,... [more]
Serpinb9h3.224e-5935.10serine (or cysteine) peptidase inhibitor, clade B,... [more]
Serpinb9e4.617e-5935.00serine (or cysteine) peptidase inhibitor, clade B,... [more]
Serpinb3d4.715e-5631.49serine (or cysteine) peptidase inhibitor, clade B ... [more]
back to top
BLAST of Serpin B6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O02739|SPB6_BOVIN9.022e-5737.33Serpin B6 OS=Bos taurus OX=9913 GN=SERPINB6 PE=2 S... [more]
sp|Q5JJ64|Y1782_THEKO1.003e-5635.83Uncharacterized serpin-like protein TK1782 OS=Ther... [more]
sp|Q5R899|SPB6_PONAB7.964e-5436.89Serpin B6 OS=Pongo abelii OX=9601 GN=SERPINB6 PE=2... [more]
sp|P35237|SPB6_HUMAN2.810e-5336.61Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1... [more]
sp|Q60854|SPB6_MOUSE7.842e-5337.01Serpin B6 OS=Mus musculus OX=10090 GN=Serpinb6 PE=... [more]
back to top
BLAST of Serpin B6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1V5YH803.213e-6334.91Serpin (Serine protease inhibitor) OS=Chloroflexi ... [more]
A0A517PTF11.922e-6234.83Serpin (Serine protease inhibitor) OS=Planctomycet... [more]
F1L1S52.994e-6238.16Serpin-like protein OS=Ascaris suum OX=6253 PE=2 S... [more]
A0A518IGV01.690e-6134.73Serpin (Serine protease inhibitor) OS=Planctomycet... [more]
U3EQV83.078e-6136.55Serpin B6 OS=Micrurus fulvius OX=8637 PE=2 SV=1[more]
back to top
BLAST of Serpin B6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SERPINB84.868e-5333.87leukocyte elastase inhibitor-like [Source:NCBI gen... [more]
serpinb1l35.551e-5033.16leukocyte elastase inhibitor-like [Source:NCBI gen... [more]
serpini11.506e-4829.53serpin family I member 1 [Source:NCBI gene;Acc:103... [more]
SERPINB87.936e-4831.19leukocyte elastase inhibitor-like [Source:NCBI gen... [more]
serpinb1l22.537e-4031.78serpin family B member 1 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Serpin B6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SERPINB15.207e-5634.83serpin family B member 1 [Source:HGNC Symbol;Acc:H... [more]
SERPINB13.860e-4836.93serpin family B member 1 [Source:HGNC Symbol;Acc:H... [more]
SERPINB11.099e-4233.44serpin family B member 1 [Source:HGNC Symbol;Acc:H... [more]
ENSPMAT00000008982.12.102e-3126.82pep scaffold:Pmarinus_7.0:GL477391:47974:54419:1 g... [more]
ENSPMAT00000006795.11.963e-2925.26pep scaffold:Pmarinus_7.0:GL479006:3227:9631:1 gen... [more]
back to top
BLAST of Serpin B6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Serpin B6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO402881.208e-5635.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356501.634e-5535.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356323.388e-5231.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serpin B6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000035931.16.349e-5634.66leukocyte elastase inhibitor-like [Source:NCBI gen... [more]
ENSORLT00000040134.16.349e-5634.66leukocyte elastase inhibitor-like [Source:NCBI gen... [more]
ENSORLT00000036493.11.226e-5434.56pep primary_assembly:ASM223467v1:20:10521870:10567... [more]
ENSORLT00000046159.16.575e-5232.19leukocyte elastase inhibitor-like [Source:NCBI gen... [more]
ENSORLT00000039962.12.604e-5030.42leukocyte elastase inhibitor [Source:NCBI gene;Acc... [more]
back to top
BLAST of Serpin B6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000032430.10.000e+098.57SMESG000032430.1[more]
SMESG000032448.10.000e+074.78SMESG000032448.1[more]
SMESG000032440.10.000e+074.78SMESG000032440.1[more]
SMESG000032457.12.979e-15256.61SMESG000032457.1[more]
SMESG000032440.11.157e-6559.78SMESG000032440.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021505 ID=SMED30021505|Name=Serpin B6|organism=Schmidtea mediterranea sexual|type=transcript|length=1382bp
TATTTTAATAAATAGTAGCAAATCATAATTGAAAAATACTAATTCTTAAA
TAATAGAGTTTAGTTTTAATTTTATCATAAATAAACTACATAAATTTGAA
ATCCAAATTTTCTGTTCATTCTGAATATTGTTTCTAATGGAAATTTCCTG
CCAGAAATTCGGTCTTGATTTACTTAAAACTTTATGCAAAGAAGATTTTA
GCAAAAATGTAATATATTCACCGATGAGTATTTATATGGCATTGGGAATG
ACGCTTTACGGCGCTAAAGGCGACACTTCGGGTGAAATGATGAAAACTCT
TCATTGGGATCAGCTGAATTCTGAGTCATTTCATCAACAATTGTCGGATT
GTATTAAAACGAGTAATGTTGATGAGAAAGACCAAGGAACAATTAGAGTA
GCAAACAAGCTATTTTTGGAAAATAAGTATGAACTGCTAGATTCATATGT
GAAAGCAGTTGATAAATTTTACAACGGCGGCATTGAGAAAATGGATTTCC
AATCAAATCCCGATAAATCCTGTCGAGATATAAATTGTTGGGTAGAAAAT
CAAACAAATGGAAAAATCAAAGATCTTCTCCAACCAAATAATATAAACAG
CTTAACAAGACTAATTTTGGTCAATGCAATTTATTTTAAAAATTCTTGGA
AAAATGAATTCTCTGTGGTTGGTGATAAAACCTTTCACTTATTGAATGGA
AGTTCTATACCAACCACTATGATATCTAAAACCGAAACTTACAAATACTT
GAAAAATCCGACACTGGGATTCGCTGCCGTACAAATTCCGTTTAAAAGAA
TTCATAATGATGATTATTCATTCATGGTCGTTTTACCACTCGAACGGTGC
TCATTGCCTAAATTCGAGACGGTGCTTTTTCAACAGGAATGGAAAACCGT
TTTCGGCGACAGCTTATTTGAATTTGTCGGTGTACATGTTACAATGCCTA
AATTCAGAATTGAGAGTTCTTTCAAATTAAAAGAAGAATTAATGCATCTT
GGAATGGTAAAACCTTTTACGGATGCAGCTGACTTTTCTTCGATGACTTC
TAAACCAGAGTTAATGATAGATGATGTTGTTCATAAAGCTTTCATAGATG
TAACTGAGCACGGTGTCGAGGCCGCTGCAGCTACCGCAGTGATGATGATG
TTGCGATGTGCACCTATGAGACCGATAGATCCTATTGAGTTCAACTGTGA
CCATCCTTTTATGTTCGCGGTGGTGAAACAGGGCTCATTGCCTTTATTTA
TTGGACATTGTGCCCAGTGCTAGTTGTTCGATTGATTTATATTTTCACAA
TATCCCAGCTTATATCTTTTTTGAAACTTTGGATTTTTAATAGTGAATTT
TATAATTTATATATTTTTGCATTCAATAAAAA
back to top

protein sequence of SMED30021505-orf-1

>SMED30021505-orf-1 ID=SMED30021505-orf-1|Name=SMED30021505-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=379bp
MEISCQKFGLDLLKTLCKEDFSKNVIYSPMSIYMALGMTLYGAKGDTSGE
MMKTLHWDQLNSESFHQQLSDCIKTSNVDEKDQGTIRVANKLFLENKYEL
LDSYVKAVDKFYNGGIEKMDFQSNPDKSCRDINCWVENQTNGKIKDLLQP
NNINSLTRLILVNAIYFKNSWKNEFSVVGDKTFHLLNGSSIPTTMISKTE
TYKYLKNPTLGFAAVQIPFKRIHNDDYSFMVVLPLERCSLPKFETVLFQQ
EWKTVFGDSLFEFVGVHVTMPKFRIESSFKLKEELMHLGMVKPFTDAADF
SSMTSKPELMIDDVVHKAFIDVTEHGVEAAAATAVMMMLRCAPMRPIDPI
EFNCDHPFMFAVVKQGSLPLFIGHCAQC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR023796Serpin_dom
IPR023795Serpin_CS
Vocabulary: cellular component
TermDefinition
GO:0005615extracellular space