4-hydroxyphenylpyruvate dioxygenase

Overview
Name4-hydroxyphenylpyruvate dioxygenase
Smed IDSMED30021502
Length (bp)1369
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 4-hydroxyphenylpyruvate dioxygenase (SMED30021502) t-SNE clustered cells

Violin plots show distribution of expression levels for 4-hydroxyphenylpyruvate dioxygenase (SMED30021502) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 4-hydroxyphenylpyruvate dioxygenase (SMED30021502) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 4-hydroxyphenylpyruvate dioxygenase (SMED30021502) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021502

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30021502SMESG000045752.1 SMESG000045750.1 SMESG000037881.1 SMESG000037878.1 dd_Smed_v4_13579_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30021502SMESG000045752.1 SMESG000045750.1 SMESG000037881.1 SMESG000037878.1 dd_Smed_v4_13579_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30021502SMESG000045752.1 SMESG000045750.1 SMESG000037881.1 SMESG000037878.1 dd_Smed_v4_13579_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Human
Match: HPDL (4-hydroxyphenylpyruvate dioxygenase like [Source:HGNC Symbol;Acc:HGNC:28242])

HSP 1 Score: 157.918 bits (398), Expect = 2.035e-43
Identity = 115/384 (29.95%), Postives = 173/384 (45.05%), Query Frame = 3
Query:  198 RIHHVEIMTKSLDSVCKYLMKGFGF-----RLISKGKENILQSGSAIFVVKEFPNN--CLHQIDT----------VFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQDKSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKND------LLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEEL--TENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVD 1274
            R+ H+     +   + + L + FGF     R +   ++  L+SG A+F+V E   +   L+ +D            FDVA      +E+ A   S    +     R+ D  G    A + S  G +  T++++  Y G FLPG+  +    +    +V   DH+T       S ++L+W+          ++  +       +  GF L     G+RL A              S     V+AE L      ++Q+ +FL  HKGPG+QH+GL   +I+ ATE     G  FL PP  YY+   +  +I+          + GIL+D +          GK FL QVFT  +F   TFFLELIQRQGATGFG GNI+ALW +V 
Sbjct:    7 RLCHIAFHVPAGQPLARNLQRLFGFQPLASREVDGWRQLALRSGDAVFLVNEGAGSGEPLYGLDPRHAVPSATNLCFDVADAGAATRELAALGCS----VPVPPVRVRDAQGAATYAVVSSPAGILSLTLLERAGYRGPFLPGFRPV--SSAPGPGWVSRVDHLTLACTPGSSPTLLRWFHDCLGFCHLPLSPGEDPELGLEMTAGFGL----GGLRLTALQA--------QPGSIVPTLVLAESLPGATTRQDQVEQFLARHKGPGLQHVGLYTPNIVEATEGVATAGGQFLAPPGAYYQQPGKERQIRAAGHEPHLLARQGILLDGD---------KGK-FLLQVFTKSLFTEDTFFLELIQRQGATGFGQGNIRALWQSVQ 362          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Human
Match: HPD (4-hydroxyphenylpyruvate dioxygenase [Source:HGNC Symbol;Acc:HGNC:5147])

HSP 1 Score: 129.028 bits (323), Expect = 8.343e-33
Identity = 100/348 (28.74%), Postives = 164/348 (47.13%), Query Frame = 3
Query:  297 NILQSGSAIFVV--------KEFPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQDKSTFSEFVR-SFDHITYVVHKSCSSSVL---KWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIK---RNPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
            ++++ G  +FV+        KE  ++ +   D V D+A EV +   I+ +A+    +I++      DKFG V  A L    G+  HT+++K +Y G+FLPGY           +  + S + I ++V       ++   +WY       +F+      +D+  V H + + +R             ++N+ ES K  + E      K+QI E++  + G G+QHI L   DII A       G+ FL  P  YY+ ++   +  KI+  E  +D  E+  ILVD +           K +L Q+FT P+ DR T FLE+IQR    GFG+GN  +L+ A +  Q   G
Sbjct:   21 HVIKQGKIVFVLSSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDYIVQKARERGAKIMREPWVEQDKFGKVKFAVL-QTYGDTTHTLVEKMNYIGQFLPGYEAPAFMDPLLPKLPKCSLEMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWS-----VDDTQV-HTEYSSLRSIV----------VANYEESIKMPINEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLREKLKTAKIKVKE-NIDALEELKILVDYDE----------KGYLLQIFTKPVQDRPTLFLEVIQRHNHQGFGAGNFNSLFKAFEEEQNLRG 340          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Human
Match: HPD (4-hydroxyphenylpyruvate dioxygenase [Source:HGNC Symbol;Acc:HGNC:5147])

HSP 1 Score: 129.028 bits (323), Expect = 1.352e-32
Identity = 100/348 (28.74%), Postives = 164/348 (47.13%), Query Frame = 3
Query:  297 NILQSGSAIFVV--------KEFPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQDKSTFSEFVR-SFDHITYVVHKSCSSSVL---KWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIK---RNPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
            ++++ G  +FV+        KE  ++ +   D V D+A EV +   I+ +A+    +I++      DKFG V  A L    G+  HT+++K +Y G+FLPGY           +  + S + I ++V       ++   +WY       +F+      +D+  V H + + +R             ++N+ ES K  + E      K+QI E++  + G G+QHI L   DII A       G+ FL  P  YY+ ++   +  KI+  E  +D  E+  ILVD +           K +L Q+FT P+ DR T FLE+IQR    GFG+GN  +L+ A +  Q   G
Sbjct:   60 HVIKQGKIVFVLSSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDYIVQKARERGAKIMREPWVEQDKFGKVKFAVL-QTYGDTTHTLVEKMNYIGQFLPGYEAPAFMDPLLPKLPKCSLEMIDHIVGNQPDQEMVSASEWYLKNLQFHRFWS-----VDDTQV-HTEYSSLRSIV----------VANYEESIKMPINEPAPGKKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGLEFLSVPSTYYKQLREKLKTAKIKVKE-NIDALEELKILVDYDE----------KGYLLQIFTKPVQDRPTLFLEVIQRHNHQGFGAGNFNSLFKAFEEEQNLRG 379          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Celegans
Match: C31H2.4 (pep chromosome:WBcel235:X:5155093:5159667:-1 gene:WBGene00016294.1 transcript:C31H2.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C31H2.4)

HSP 1 Score: 140.198 bits (352), Expect = 2.659e-37
Identity = 113/396 (28.54%), Postives = 181/396 (45.71%), Query Frame = 3
Query:  183 MGLIKRIHHVE-IMTKSLDSVCKYLMKGFGF-----RLISKGKENILQSGSAIFVVKEF------PNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQDKSTFSEF-------VRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELT-ENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAE----TEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIGT 1298
            MG I  IHH+E I++ +L S   Y   GFGF     ++  +     L++G+A  ++  +       +  +   D + DV+  V NL  ++     N+ ++IQ Q+ +S K G V  A L S  G+V HT+ +  ++ G FLP +  I    S F  F           DH+          +   WY     +K+F+   + +    F           +A   W      L N   + +  +AE +    GK+QI EF+  H G G+QH  L V DII A +I  +  V FL  P  YY+ ++            ++  K  ++V  +     E +   + +   +L Q+F+ P+ DR T F+E+IQR    GFG+GN KAL+DAV+  Q+  GT
Sbjct:    1 MGSISAIHHIEFIVSNALQSAYWYC-SGFGFEKFAEKITDESTSIALRNGTARVIITSYNSQNIYTDQLIKHGDFIKDVSFRVDNLDAVLQNLVENDIKVIQ-QSEVSTKDGLVRTATLLSEGGDVTHTLFELGEFKGNFLPFFTPI----SNFELFENIEKMPAILMDHVVQNYPIGEMEAAADWYFKTMRLKRFWSVDDKVATSEF-----------SAMTAW-----LLVNDDHTVQVTLAEGVKGRKGKSQIEEFINYHGGSGVQHFALLVEDIISAVQIMKSRSVEFLTIPSQYYDNLE------------ERLSKTNLIVKEDLKMIRELNILMDFDENGYLLQIFSKPLQDRPTLFIEIIQRANFKGFGAGNFKALFDAVEREQEKRGT 362          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Celegans
Match: hpd-1 (4-hydroxyphenylpyruvate dioxygenase [Source:UniProtKB/Swiss-Prot;Acc:Q22633])

HSP 1 Score: 139.428 bits (350), Expect = 8.377e-37
Identity = 102/328 (31.10%), Postives = 155/328 (47.26%), Query Frame = 3
Query:  336 EFPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQDKSTFSEFVRS----FDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGK--NQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTL--EWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
            E  N+ +   D V DV  EV +L  IIA AK+    I+   T  SD  G +  A L    G   HT++++ +Y G FLPG+       + F    R      DH           S ++WY  +    +F+   + ++      H + + +R             ++N  E+ K  + E  T + K  +QI E++  + G G+QHI L+ SDII A E     G  FL  P  YY+ +K      ++  +  MD+ +K  ILVD         + NG  +L Q+F+ P  DR T FLE+IQRQ   GFG+GN KAL+++++L Q   G
Sbjct:   80 ELGNHLVQHGDGVKDVCFEVEDLDSIIAHAKAAGATIVHDITEESDADGSIRYATL-RTYGETDHTLLERKNYRGAFLPGFKAHPMPATFFKTLPRVGLNFLDHCVGNQPDLQMDSAVQWYEKVLKFHRFWSVDDSMI------HTEYSALRSIV----------VTNFEETIKMPINEPATSDKKAISQIQEYVDYYGGSGVQHIALNTSDIITAIEALRARGCEFLSIPSSYYDNLKERLAASSMVVKEDMDRLQKLHILVDF--------DENG--YLLQIFSKPCQDRPTLFLEIIQRQNHEGFGAGNFKALFESIELEQTKRG 380          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Fly
Match: Hpd (gene:FBgn0036992 transcript:FBtr0078226)

HSP 1 Score: 124.79 bits (312), Expect = 3.257e-32
Identity = 96/318 (30.19%), Postives = 148/318 (46.54%), Query Frame = 3
Query:  366 DTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQD------KSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKR--NPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
            D V DVA EV +L  I   A S    +++     SD  GFV  A +    G+  HT ++++ Y G FLPG+    +D       ST   F+   DH+          SV  WY  +    +F+      +D+   +H + + +R             ++N+ E+ K  + E      K+QI E++  + G G+QHI L+  DII A       G  FL  P  YYEI++   +     ++  M+  +K  IL+D         + NG  +L Q+FT    DR T FLE+IQR    GFG+GN K+L+ A+++ Q   G
Sbjct:    5 DGVKDVAFEVEDLNAIFTLAVSRGAEVVRDIWEESDDQGFVRFATI-KTYGDTTHTFVERNGYAGDFLPGFQRSPKDVLLNGLPSTKLNFI---DHVVGNQPDLQMESVASWYERILQFHRFWS-----VDDS-QIHTEYSALRSIV----------MANYEETVKMPINEPANGKKKSQIQEYVEYYGGGGVQHIALNTDDIIEAVSNLKARGTEFLTIPSSYYEILQEQLSHSRTKIKEDMEVLKKLNILIDF--------DENG--YLLQIFTKNCQDRPTLFLEVIQRYNHNGFGAGNFKSLFTAIEIEQAKRG 292          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Fly
Match: Hpd (gene:FBgn0036992 transcript:FBtr0078225)

HSP 1 Score: 125.946 bits (315), Expect = 6.765e-32
Identity = 99/339 (29.20%), Postives = 154/339 (45.43%), Query Frame = 3
Query:  321 IFVVKEFPNNCLHQI------DTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQD------KSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKR--NPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
            +FV    P++  H +      D V DVA EV +L  I   A S    +++     SD  GFV  A +    G+  HT ++++ Y G FLPG+    +D       ST   F+   DH+          SV  WY  +    +F+   +  +      H + + +R             ++N+ E+ K  + E      K+QI E++  + G G+QHI L+  DII A       G  FL  P  YYEI++   +     ++  M+  +K  IL+D         + NG  +L Q+FT    DR T FLE+IQR    GFG+GN K+L+ A+++ Q   G
Sbjct:   70 VFVSAYTPDDEEHGLHLMRHGDGVKDVAFEVEDLNAIFTLAVSRGAEVVRDIWEESDDQGFVRFATI-KTYGDTTHTFVERNGYAGDFLPGFQRSPKDVLLNGLPSTKLNFI---DHVVGNQPDLQMESVASWYERILQFHRFWSVDDSQI------HTEYSALRSIV----------MANYEETVKMPINEPANGKKKSQIQEYVEYYGGGGVQHIALNTDDIIEAVSNLKARGTEFLTIPSSYYEILQEQLSHSRTKIKEDMEVLKKLNILIDF--------DENG--YLLQIFTKNCQDRPTLFLEVIQRYNHNGFGAGNFKSLFTAIEIEQAKRG 378          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Zebrafish
Match: HPDL (4-hydroxyphenylpyruvate dioxygenase-like protein [Source:NCBI gene;Acc:110438534])

HSP 1 Score: 270.396 bits (690), Expect = 6.081e-86
Identity = 148/397 (37.28%), Postives = 216/397 (54.41%), Query Frame = 3
Query:  192 IKRIHHVEIMTKSLDSVCKYLMKGFGF-----RLISKGKENILQSGSAIFVVKEFPN-------------NCL------HQIDTVFDVALEVTNLQEIIARAKSNND--RIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQ-----DKSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDEN-----FLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCS-ENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAV 1271
            + R+HH+ +   ++D V   L+  F F     R   + K+  L+ GSA+FVV E P+              C+      + +DTV +V  EVT++    +RA  + D    +Q    + D  G V  + + S VGNV HT+ID   Y G FLPG+ E+       D+S     +  FDHITY   +S +  +  WY   F  ++FFI++N+ +DEG+VL+H   G+RL A +YWKC E+     F       CKFV+AE L E G+NQ++ FL +H+G GIQHIGL   DI+   +     GV F  PP  YY  + +  ++    +      +YGIL+D + +     + T+G+  L QVFT P+F   TFFLELI+R+GATGFG GNI+ALW +V
Sbjct:    5 LSRLHHISLQVSNVDKVAHELVSRFQFNVFAARRTDRAKQLALRRGSAVFVVNERPSLSDCGAVRDHRDAGCVFGTHEHYPVDTVSNVCFEVTDVPSA-SRALRDQDGCEFLQPPAELQDDRGRVTFSIVRSPVGNVCHTLIDSSRYQGPFLPGFREVSSGCQGADRSRCP--ITHFDHITYACPRSSTVHITNWYRRNFGFQRFFIDRNEDVDEGYVLNHDGIGLRLTAMEYWKCSESGIKLPFKDEKEPDCKFVIAESLPEQGRNQVDTFLDEHRGAGIQHIGLYTEDIVKTAQTLSQAGVQFFSPPPAYYTEVGKQQEMLDAGYDPQTLSRYGILLDTDIQTDTDRQTTDGQRHLLQVFTKPVFAEDTFFLELIERRGATGFGEGNIRALWRSV 398          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Zebrafish
Match: hpdl (4-hydroxyphenylpyruvate dioxygenase-like [Source:ZFIN;Acc:ZDB-GENE-071004-50])

HSP 1 Score: 269.626 bits (688), Expect = 1.074e-85
Identity = 148/397 (37.28%), Postives = 216/397 (54.41%), Query Frame = 3
Query:  192 IKRIHHVEIMTKSLDSVCKYLMKGFGF-----RLISKGKENILQSGSAIFVVKEFPN-------------NCL------HQIDTVFDVALEVTNLQEIIARAKSNND--RIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQ-----DKSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDEN-----FLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCS-ENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAV 1271
            + R+HH+ +   ++D V   L+  F F     R   + K+  L+ GSA+FVV E P+              C+      + +DTV +V  EVT++    +RA  + D    +Q    + D  G V  + + S VGNV HT+ID   Y G FLPG+ E+       D+S     +  FDHITY   +S +  +  WY   F  ++FFI++N+ +DEG+VL+H   G+RL A +YWKC E+     F       CKFV+AE L E G+NQ++ FL +H+G GIQHIGL   DI+   +     GV F  PP  YY  + +  ++    +      +YGIL+D + +     + T+G+  L QVFT P+F   TFFLELI+R+GATGFG GNI+ALW +V
Sbjct:    5 LSRLHHISLQVSNVDKVAHELVSRFQFNVFAARRTDRAKQLALRRGSAVFVVNERPSPSDCGAVRDHRDAGCVFGTHEHYPVDTVSNVCFEVTDVPSA-SRALRDQDGCEFLQPPAELQDDCGRVTFSIVRSPVGNVCHTLIDSSRYQGPFLPGFREVSSGCQGADRSRCP--ITHFDHITYACPRSSTVHITNWYRRNFGFQRFFIDRNEDVDEGYVLNHDGIGLRLTAMEYWKCSESGIKLPFKDEKEPDCKFVIAESLPEQGRNQVDTFLDEHRGAGIQHIGLYTEDIVKTAQTLSQAGVQFFSPPPAYYTEVGKQQEMLDAGYDPQTLSRYGILLDTDIQTDTDRQTTDGQRHLLQVFTKPVFAEDTFFLELIERRGATGFGEGNIRALWRSV 398          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Zebrafish
Match: hpdb (4-hydroxyphenylpyruvate dioxygenase b [Source:ZFIN;Acc:ZDB-GENE-040808-62])

HSP 1 Score: 127.102 bits (318), Expect = 3.678e-32
Identity = 95/327 (29.05%), Postives = 151/327 (46.18%), Query Frame = 3
Query:  333 KEFPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGY-IEIEQDKSTFSEFVRSFDHITYVVHKSCSS---SVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDK--FEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
            KE  ++ +   D V DVA  V N   ++ +A+     II+    + DKFG V +A +    G+  HT +++  Y G FLPG+   +  D           D I +VV     S    +++WY       +F+   +  L                  +Y       ++N+ E+ K  + E      K+QI E++  + G G+QHI ++ SDII A       G+ F+  P  YY+ +K   K+  +    D    E+  ILVD         + NG  +L Q+FT P+ DR T FLE+IQR    GFG+GN K+L++A++  Q + G
Sbjct:   72 KEMGDHLVKHGDGVKDVAFTVENCDFLVEKARERGAIIIKESHAVEDKFGRVKMAVV-QTYGDTTHTFVERTGYNGLFLPGFHAPLFCDPFLAKLPSGKLDFIDHVVGNQPDSEMVPIVEWYQRNLLFHRFWSVDDKQLQT----------------EYSALRSIVVANYEETVKMPINEPAMGKRKSQIQEYVEYYGGAGVQHIAMNTSDIISAIRNLKERGMEFMSVPDTYYQQLKEKLKLSKVRIIEDLNILEELKILVDY--------DDNG--YLLQIFTKPVQDRPTVFLEVIQRHNHQGFGAGNFKSLFEAIEADQNARG 371          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Zebrafish
Match: hpdb (4-hydroxyphenylpyruvate dioxygenase b [Source:ZFIN;Acc:ZDB-GENE-040808-62])

HSP 1 Score: 127.487 bits (319), Expect = 3.725e-32
Identity = 100/362 (27.62%), Postives = 163/362 (45.03%), Query Frame = 3
Query:  264 FGFRLISKGKENIL----QSGSAIFVV--------KEFPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGY-IEIEQDKSTFSEFVRSFDHITYVVHKSCSS---SVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDK--FEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
              +R +  G  +++    + G  I+V         KE  ++ +   D V DVA  V N   ++ +A+     II+    + DKFG V +A +    G+  HT +++  Y G FLPG+   +  D           D I +VV     S    +++WY       +F+   +  L                  +Y       ++N+ E+ K  + E      K+QI E++  + G G+QHI ++ SDII A       G+ F+  P  YY+ +K   K+  +    D    E+  ILVD         + NG  +L Q+FT P+ DR T FLE+IQR    GFG+GN K+L++A++  Q + G
Sbjct:   45 LAYRGLETGSRDVVSHAVKQGKIIYVFTSALNPGNKEMGDHLVKHGDGVKDVAFTVENCDFLVEKARERGAIIIKESHAVEDKFGRVKMAVV-QTYGDTTHTFVERTGYNGLFLPGFHAPLFCDPFLAKLPSGKLDFIDHVVGNQPDSEMVPIVEWYQRNLLFHRFWSVDDKQLQT----------------EYSALRSIVVANYEETVKMPINEPAMGKRKSQIQEYVEYYGGAGVQHIAMNTSDIISAIRNLKERGMEFMSVPDTYYQQLKEKLKLSKVRIIEDLNILEELKILVDY--------DDNG--YLLQIFTKPVQDRPTVFLEVIQRHNHQGFGAGNFKSLFEAIEADQNARG 379          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Zebrafish
Match: hpda (4-hydroxyphenylpyruvate dioxygenase a [Source:NCBI gene;Acc:394142])

HSP 1 Score: 109.768 bits (273), Expect = 7.424e-26
Identity = 93/331 (28.10%), Postives = 149/331 (45.02%), Query Frame = 3
Query:  333 KEFPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDK-HDYPGKFLPGYIE-------IEQDKSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMD--KFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
            +E   + +   D V DVA  V +   ++ +AK     +++      D  G V  A +    G+  HT ++    Y G FLPGY E       + +  S    F+   DHI           V  WY       +F+      +D+   +H + + +R             ++N+ E+ K  + E      K+QI E++  + GPG+QHI L+ S+II A       G+ FL  P  YYE ++   K   ++   D    ++  ILVD +           K +L Q+FT P+ DR T FLE+IQR    GFG+GN K+L++A++  Q + G
Sbjct:   80 EEMGEHLIKHGDGVKDVAFLVEDCDFLVKKAKERGAAVLKEPWVEQDAGGKVKYA-IVQTYGDTTHTFVEYLGPYKGLFLPGYKEPLFRDPLLPKLPSGHLSFI---DHIVGNQPDDEMVPVSDWYQKCLLFHRFWS-----IDDK-QIHTEYSALRSIV----------VTNYEETIKMPINEPAMGKKKSQIQEYIDYNGGPGVQHIALNTSNIIQAIVNLRARGLEFLSAPDNYYESLREKLKTAKIKVKEDLKTLQELKILVDFDD----------KGYLLQIFTKPVQDRPTLFLEVIQRNNHFGFGAGNFKSLFEAIEKDQDARG 380          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Xenopus
Match: elovl1 (ELOVL fatty acid elongase 1 [Source:Xenbase;Acc:XB-GENE-1014374])

HSP 1 Score: 185.652 bits (470), Expect = 1.484e-53
Identity = 123/388 (31.70%), Postives = 186/388 (47.94%), Query Frame = 3
Query:  192 IKRIHHVEIMTKSL-----DSVCKYLMKGFGFRLISKGK--ENILQSGSAIFVVKEFPNNC------LHQI-------DTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQDKSTFSEF-VRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSI 1292
            I R+ HV     +      + V KY    F  R +  G   +  L++G  +F+V E           L+ I       DT  +V+ EV ++  +         +++   T + D FG V    + S VGNV HT+ID+  Y   FLPG+  ++ + +  S   +   DHI Y      S S+L+WY   F  + F + K +  + G  +     G+RL +               E CK V+AE L + G NQ+++F+  H   GIQHIGLS  DI  A       GV F   P  YY   ++  +I  +       EK+GIL+D+ TE   SE+ + K FL QVF  P+F +++ FLELI+R+ A GFG GNI+ALW ++   Q+ +
Sbjct:    5 IMRLSHVTFQASNALKLIEEFVTKYKFHPFAARGLDGGSSCQVALRNGGVVFMVNENTQKTHENPVMLYDIPLPIPFLDTACNVSFEVEDVPGLYRHLVDEGCQLLLPPTELHDDFGSVTYCIVKSVVGNVSHTLIDRRHYKASFLPGFKYLKNNTNNLSSGNLTHVDHIAYACPFGTSPSILEWYRRCFGFQHFPLYKGEDPERGLEITGHRIGLRLTSL--------VCPRLGEGCKLVLAESLPQEGINQVDQFIEHHTDGGIQHIGLSTPDIFKAARDLSQLGVRFASQPSSYYSEPRKQKEIYNVGLEPQMLEKFGILIDSATEDILSEDAS-KKFLLQVFAEPLFSKNSVFLELIERRSAEGFGEGNIRALWRSMQDLQEDL 383          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Xenopus
Match: hpd (4-hydroxyphenylpyruvate dioxygenase [Source:NCBI gene;Acc:779829])

HSP 1 Score: 134.42 bits (337), Expect = 1.346e-34
Identity = 100/327 (30.58%), Postives = 156/327 (47.71%), Query Frame = 3
Query:  333 KEFPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGY-IEIEQDK--STFSEFVRSF-DHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWC--MDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
            +EF  +     D V DVA EV + + ++ +A+     I++      DKFG V  A +    G+  HT+++K  Y G FLPGY   + QD       +   +F DHI          SV  WY       +F+   +  L      H + + +R             ++N+ E+ K  + E      ++QI E++  + GPG+QHI L+ SDII A       G+ F+  P  YY+ ++ N K   ++    +DK E+  ILVD         + NG  +L Q+FT P+ DR T F E+IQR    GFG+GN K+L+ A++  Q + G
Sbjct:   77 EEFGAHLQKHGDGVKDVAFEVEDCEFLVQKARQRGAVIVKEPWVEEDKFGKVKFA-IVQTYGDTTHTLVEKLGYNGIFLPGYEPPLFQDPLLPKLPDCKLNFIDHIVGNQPDDEMVSVADWYQKALLFHRFWSVDDKQL------HTEFSALRSIV----------VANYEETIKMPINEPAPGKKRSQIQEYVDYYGGPGVQHIALNTSDIITAVSNLQERGMEFMSVPSAYYQTLRENLKTAKIKVAEDIDKLEELKILVDY--------DDNG--YLLQIFTKPVQDRPTLFFEVIQRHNHQGFGAGNFKSLFQAIEADQAARG 376          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Xenopus
Match: hpd (4-hydroxyphenylpyruvate dioxygenase [Source:NCBI gene;Acc:779829])

HSP 1 Score: 134.42 bits (337), Expect = 1.419e-34
Identity = 100/327 (30.58%), Postives = 156/327 (47.71%), Query Frame = 3
Query:  333 KEFPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGY-IEIEQDK--STFSEFVRSF-DHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWC--MDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
            +EF  +     D V DVA EV + + ++ +A+     I++      DKFG V  A +    G+  HT+++K  Y G FLPGY   + QD       +   +F DHI          SV  WY       +F+   +  L      H + + +R             ++N+ E+ K  + E      ++QI E++  + GPG+QHI L+ SDII A       G+ F+  P  YY+ ++ N K   ++    +DK E+  ILVD         + NG  +L Q+FT P+ DR T F E+IQR    GFG+GN K+L+ A++  Q + G
Sbjct:   80 EEFGAHLQKHGDGVKDVAFEVEDCEFLVQKARQRGAVIVKEPWVEEDKFGKVKFA-IVQTYGDTTHTLVEKLGYNGIFLPGYEPPLFQDPLLPKLPDCKLNFIDHIVGNQPDDEMVSVADWYQKALLFHRFWSVDDKQL------HTEFSALRSIV----------VANYEETIKMPINEPAPGKKRSQIQEYVDYYGGPGVQHIALNTSDIITAVSNLQERGMEFMSVPSAYYQTLRENLKTAKIKVAEDIDKLEELKILVDY--------DDNG--YLLQIFTKPVQDRPTLFFEVIQRHNHQGFGAGNFKSLFQAIEADQAARG 379          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Xenopus
Match: hpd (4-hydroxyphenylpyruvate dioxygenase [Source:NCBI gene;Acc:779829])

HSP 1 Score: 134.42 bits (337), Expect = 1.469e-34
Identity = 100/327 (30.58%), Postives = 156/327 (47.71%), Query Frame = 3
Query:  333 KEFPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGY-IEIEQDK--STFSEFVRSF-DHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWC--MDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
            +EF  +     D V DVA EV + + ++ +A+     I++      DKFG V  A +    G+  HT+++K  Y G FLPGY   + QD       +   +F DHI          SV  WY       +F+   +  L      H + + +R             ++N+ E+ K  + E      ++QI E++  + GPG+QHI L+ SDII A       G+ F+  P  YY+ ++ N K   ++    +DK E+  ILVD         + NG  +L Q+FT P+ DR T F E+IQR    GFG+GN K+L+ A++  Q + G
Sbjct:   74 EEFGAHLQKHGDGVKDVAFEVEDCEFLVQKARQRGAVIVKEPWVEEDKFGKVKFA-IVQTYGDTTHTLVEKLGYNGIFLPGYEPPLFQDPLLPKLPDCKLNFIDHIVGNQPDDEMVSVADWYQKALLFHRFWSVDDKQL------HTEFSALRSIV----------VANYEETIKMPINEPAPGKKRSQIQEYVDYYGGPGVQHIALNTSDIITAVSNLQERGMEFMSVPSAYYQTLRENLKTAKIKVAEDIDKLEELKILVDY--------DDNG--YLLQIFTKPVQDRPTLFFEVIQRHNHQGFGAGNFKSLFQAIEADQAARG 373          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Xenopus
Match: hpd (uncharacterized loc100125092 [Source:Xenbase;Acc:XB-GENE-5817456])

HSP 1 Score: 114.005 bits (284), Expect = 2.941e-27
Identity = 104/389 (26.74%), Postives = 177/389 (45.50%), Query Frame = 3
Query:  186 GLIKRIHHVEIMTKSLDSVCKYLMKGFGFRLIS-KGKENILQSGSAIFVVKEFPNNCL--------HQI---DTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDK-HDYPGKFLPGYIE-IEQDK--STFSEFVRSF-DHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQ--TLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
            G     HH+     +      +    FGF   + KG E   +   +  + ++   NC+        H I   D V DVA +V +   +  +AK +   +++      D+ G V  A L +  G+  HT+++    Y G FLPGY E + +D    T      SF DHI      +    +++WY       +F+   +  +      H + + +R             ++N+ E+ K  + E      K+QI E++  +   G+QHI L+ S+II A +   + G+ FL  P  YYE +++  K    T++  ++  ++  ILVD +           K +L Q+FT P+ DR T FLE+IQR    GFG+GN K+L++A++  Q + G
Sbjct:   16 GRFLSFHHLTFWVGNAKQAASFYCDKFGFEPCAYKGLETGSRDVVSHAIKQDKQLNCMISCPEMGQHMIKHGDGVKDVAFQVEDCDFLFQKAKDHGAVVVREPWIEEDEGGKVKYAVLQT-YGDTTHTLLEYLGPYRGVFLPGYKEPLFRDPLLPTLPSGCLSFIDHIVGNQPDNEMVPIVEWYQKCLLFHRFWSVDDKQI------HTEYSSLRSIV----------VTNYEETIKMPINEPAAGKKKSQIQEYVDYYGSAGVQHIALNTSNIIKAVKNLKSRGIEFLSAPDTYYEELRKKLKTAKITVKEDLNVLQELKILVDYDD----------KGYLLQIFTKPMQDRPTLFLEVIQRYNHFGFGAGNFKSLFEAIETDQDARG 377          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Mouse
Match: Hpdl (4-hydroxyphenylpyruvate dioxygenase-like [Source:MGI Symbol;Acc:MGI:2444646])

HSP 1 Score: 152.14 bits (383), Expect = 2.600e-41
Identity = 103/376 (27.39%), Postives = 167/376 (44.41%), Query Frame = 3
Query:  195 KRIHHVEIMTKSLDSVCKYLMKGFGFRLIS-----KGKENILQSGSAIFVVKEF--PNNCL------HQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQDKSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGF--VLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELT--ENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAV 1271
            +R+ H+     +   + + L + FGF+ ++       ++  L+SG A+F+V E   P   L      H + +  ++  +V ++        +    +    TR+ D  G      L S  GN+  T++ +  Y G FLPG+  +         +V   DH+T       S  +++W+          ++  +  + G          G+RL A             ++     V+AE L    + ++Q+ +FL  H GPG+QH+GL   +II A+E     G   L PP  YY+   +  +I          E+ GIL+D + +           FL QVFT  +F   TFFLELIQRQGATGFG  NI+ALW +V
Sbjct:    6 RRLCHIAFHVPAGQPLARDLHRVFGFQPLAVREAGGWRQLALRSGDAVFLVNEGTGPQEPLYSLDPHHSVPSATNLCFDVEDVDGAARALAARGCIMPVPPTRVRDAQGTATYTVLSSPAGNLSLTLLQRAGYRGSFLPGFRPLPCTPG--PGWVSHVDHLTLACTSGSSPMLMRWFHDCLGFHHLPLSPGEDPEMGLKVAAGSGRGGLRLTALQT--------PPNNTVPTLVLAESLPGLNSKQDQVEQFLTRHGGPGLQHVGLYTPNIIDASEGMAKAGCRLLTPPEAYYQQPGKEEQILAAGHKPGLLERQGILLDGDKD----------EFLLQVFTKSLFAEDTFFLELIQRQGATGFGQNNIRALWQSV 361          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Mouse
Match: Hpd (4-hydroxyphenylpyruvic acid dioxygenase [Source:MGI Symbol;Acc:MGI:96213])

HSP 1 Score: 139.813 bits (351), Expect = 1.125e-36
Identity = 104/348 (29.89%), Postives = 161/348 (46.26%), Query Frame = 3
Query:  297 NILQSGSAIFVV--------KEFPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQDKSTFSEFVRS----FDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRN---PKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
            ++++ G  +FV+        KE  ++ +   D V D+A EV +   I+ +A+    +I++      DKFG V  A L    G+  HT+++K +Y G+FLPG+       +   +  R      DHI          S  +WY       +F+      +D+  V H + + +R             ++N+ ES K  + E      K+QI E++  + G G+QHI L   DII A       G  FL  P  YY++++ N    KIQ  E  MD  E+  ILVD +           K +L Q+FT P+ DR T FLE+IQR    GFG+GN  +L+ A +  Q   G
Sbjct:   60 HVIKQGKIVFVLCSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDHIVQKARERGAKIVREPWVEQDKFGKVKFAVL-QTYGDTTHTLVEKINYTGRFLPGFEAPTYKDTLLPKLPRCNLEIIDHIVGNQPDQEMQSASEWYLKNLQFHRFWS-----VDDTQV-HTEYSSLRSIV----------VTNYEESIKMPINEPAPGRKKSQIQEYVDYNGGAGVQHIALKTEDIITAIRHLRERGTEFLAAPSSYYKLLRENLKSAKIQVKE-SMDVLEELHILVDYDE----------KGYLLQIFTKPMQDRPTLFLEVIQRHNHQGFGAGNFNSLFKAFEEEQALRG 379          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Mouse
Match: Hpd (4-hydroxyphenylpyruvic acid dioxygenase [Source:MGI Symbol;Acc:MGI:96213])

HSP 1 Score: 56.9954 bits (136), Expect = 6.518e-10
Identity = 37/93 (39.78%), Postives = 47/93 (50.54%), Query Frame = 3
Query:  951 DIIHATEISINNGVTFLKPPIGYYEIIKRN---PKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQ 1220
            DII A       G  FL  P  YY++++ N    KIQ  E  MD  E+  ILVD +           K +L Q+FT P+ DR T FLE+IQR 
Sbjct:    5 DIITAIRHLRERGTEFLAAPSSYYKLLRENLKSAKIQVKE-SMDVLEELHILVDYDE----------KGYLLQIFTKPMQDRPTLFLEVIQRH 86          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Mouse
Match: Hpd (4-hydroxyphenylpyruvic acid dioxygenase [Source:MGI Symbol;Acc:MGI:96213])

HSP 1 Score: 56.225 bits (134), Expect = 4.643e-9
Identity = 31/102 (30.39%), Postives = 55/102 (53.92%), Query Frame = 3
Query:  297 NILQSGSAIFVV--------KEFPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGY 578
            ++++ G  +FV+        KE  ++ +   D V D+A EV +   I+ +A+    +I++      DKFG V  A L    G+  HT+++K +Y G+FLPG+
Sbjct:   21 HVIKQGKIVFVLCSALNPWNKEMGDHLVKHGDGVKDIAFEVEDCDHIVQKARERGAKIVREPWVEQDKFGKVKFAVL-QTYGDTTHTLVEKINYTGRFLPGF 121          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. UniProt/SwissProt
Match: sp|Q96IR7|HPDL_HUMAN (4-hydroxyphenylpyruvate dioxygenase-like protein OS=Homo sapiens OX=9606 GN=HPDL PE=1 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 9.772e-43
Identity = 115/384 (29.95%), Postives = 173/384 (45.05%), Query Frame = 3
Query:  198 RIHHVEIMTKSLDSVCKYLMKGFGF-----RLISKGKENILQSGSAIFVVKEFPNN--CLHQIDT----------VFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQDKSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKND------LLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEEL--TENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVD 1274
            R+ H+     +   + + L + FGF     R +   ++  L+SG A+F+V E   +   L+ +D            FDVA      +E+ A   S    +     R+ D  G    A + S  G +  T++++  Y G FLPG+  +    +    +V   DH+T       S ++L+W+          ++  +       +  GF L     G+RL A              S     V+AE L      ++Q+ +FL  HKGPG+QH+GL   +I+ ATE     G  FL PP  YY+   +  +I+          + GIL+D +          GK FL QVFT  +F   TFFLELIQRQGATGFG GNI+ALW +V 
Sbjct:    7 RLCHIAFHVPAGQPLARNLQRLFGFQPLASREVDGWRQLALRSGDAVFLVNEGAGSGEPLYGLDPRHAVPSATNLCFDVADAGAATRELAALGCS----VPVPPVRVRDAQGAATYAVVSSPAGILSLTLLERAGYRGPFLPGFRPV--SSAPGPGWVSRVDHLTLACTPGSSPTLLRWFHDCLGFCHLPLSPGEDPELGLEMTAGFGL----GGLRLTALQA--------QPGSIVPTLVLAESLPGATTRQDQVEQFLARHKGPGLQHVGLYTPNIVEATEGVATAGGQFLAPPGAYYQQPGKERQIRAAGHEPHLLARQGILLDGD---------KGK-FLLQVFTKSLFTEDTFFLELIQRQGATGFGQGNIRALWQSVQ 362          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. UniProt/SwissProt
Match: sp|Q5XIH9|HPDL_RAT (4-hydroxyphenylpyruvate dioxygenase-like protein OS=Rattus norvegicus OX=10116 GN=Hpdl PE=2 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 3.003e-41
Identity = 105/376 (27.93%), Postives = 171/376 (45.48%), Query Frame = 3
Query:  195 KRIHHVEIMTKSLDSVCKYLMKGFGFRLIS-----KGKENILQSGSAIFVVKEF--PNNCL------HQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQDKSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGF--VLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELT--ENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAV 1271
            +R+ H+     +   + + L + FGF+ ++       ++  L+SG A+F+V E   P   L      H + +  ++  +V ++        +    +    TR+ D  G      + S  GN+  T++ +  Y G FLPG+  +         +V   DH+T       S ++++W+          ++  +  + G    +     G+RL A          L N S     V+AE L    + ++Q+ +FL  H GPG+QH+GL   +II A+E     G   L PP  YY+   +  +I          E+ GIL+D + +           FL QVFT  +FD  TFFLELI+RQGATGFG  NI+ALW +V
Sbjct:    6 RRLCHIAFHVPAGQPLARDLQRIFGFQPLAVREAGGWRQLALRSGDAVFLVNEGTGPREPLYGLDPHHSVPSATNLCFDVEDVDRAARALAARGCIMPVPPTRVRDAQGTATYTVVSSPAGNLSLTLLQRAGYRGSFLPGFRPLPCTPG--PGWVSHVDHLTLACTSGSSPTLMRWFHNCLGFHHLPLSPGEDPELGLKVAVGSGRGGLRLTALQT-------LPN-STVPTLVLAESLPGLTSEQDQVEQFLTRHGGPGLQHVGLYTPNIIDASEGMAKAGGRLLTPPEAYYQQPGKEEQILASGHKPSFLERQGILLDGDKD----------EFLLQVFTKSLFDEDTFFLELIERQGATGFGQNNIRALWQSV 361          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. UniProt/SwissProt
Match: sp|Q8K248|HPDL_MOUSE (4-hydroxyphenylpyruvate dioxygenase-like protein OS=Mus musculus OX=10090 GN=Hpdl PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.819e-40
Identity = 103/376 (27.39%), Postives = 167/376 (44.41%), Query Frame = 3
Query:  195 KRIHHVEIMTKSLDSVCKYLMKGFGFRLIS-----KGKENILQSGSAIFVVKEF--PNNCL------HQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQDKSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGF--VLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELT--ENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAV 1271
            +R+ H+     +   + + L + FGF+ ++       ++  L+SG A+F+V E   P   L      H + +  ++  +V ++        +    +    TR+ D  G      L S  GN+  T++ +  Y G FLPG+  +         +V   DH+T       S  +++W+          ++  +  + G          G+RL A             ++     V+AE L    + ++Q+ +FL  H GPG+QH+GL   +II A+E     G   L PP  YY+   +  +I          E+ GIL+D + +           FL QVFT  +F   TFFLELIQRQGATGFG  NI+ALW +V
Sbjct:    6 RRLCHIAFHVPAGQPLARDLHRVFGFQPLAVREAGGWRQLALRSGDAVFLVNEGTGPQEPLYSLDPHHSVPSATNLCFDVEDVDGAARALAARGCIMPVPPTRVRDAQGTATYTVLSSPAGNLSLTLLQRAGYRGSFLPGFRPLPCTPG--PGWVSHVDHLTLACTSGSSPMLMRWFHDCLGFHHLPLSPGEDPEMGLKVAAGSGRGGLRLTALQT--------PPNNTVPTLVLAESLPGLNSKQDQVEQFLTRHGGPGLQHVGLYTPNIIDASEGMAKAGCRLLTPPEAYYQQPGKEEQILAAGHKPGLLERQGILLDGDKD----------EFLLQVFTKSLFAEDTFFLELIQRQGATGFGQNNIRALWQSV 361          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. UniProt/SwissProt
Match: sp|Q18347|YBWL_CAEEL (Putative protein C31H2.4 OS=Caenorhabditis elegans OX=6239 GN=C31H2.4 PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 3.382e-36
Identity = 113/396 (28.54%), Postives = 181/396 (45.71%), Query Frame = 3
Query:  183 MGLIKRIHHVE-IMTKSLDSVCKYLMKGFGF-----RLISKGKENILQSGSAIFVVKEF------PNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQDKSTFSEF-------VRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELT-ENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAE----TEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIGT 1298
            MG I  IHH+E I++ +L S   Y   GFGF     ++  +     L++G+A  ++  +       +  +   D + DV+  V NL  ++     N+ ++IQ Q+ +S K G V  A L S  G+V HT+ +  ++ G FLP +  I    S F  F           DH+          +   WY     +K+F+   + +    F           +A   W      L N   + +  +AE +    GK+QI EF+  H G G+QH  L V DII A +I  +  V FL  P  YY+ ++            ++  K  ++V  +     E +   + +   +L Q+F+ P+ DR T F+E+IQR    GFG+GN KAL+DAV+  Q+  GT
Sbjct:    1 MGSISAIHHIEFIVSNALQSAYWYC-SGFGFEKFAEKITDESTSIALRNGTARVIITSYNSQNIYTDQLIKHGDFIKDVSFRVDNLDAVLQNLVENDIKVIQ-QSEVSTKDGLVRTATLLSEGGDVTHTLFELGEFKGNFLPFFTPI----SNFELFENIEKMPAILMDHVVQNYPIGEMEAAADWYFKTMRLKRFWSVDDKVATSEF-----------SAMTAW-----LLVNDDHTVQVTLAEGVKGRKGKSQIEEFINYHGGSGVQHFALLVEDIISAVQIMKSRSVEFLTIPSQYYDNLE------------ERLSKTNLIVKEDLKMIRELNILMDFDENGYLLQIFSKPLQDRPTLFIEIIQRANFKGFGAGNFKALFDAVEREQEKRGT 362          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. UniProt/SwissProt
Match: sp|Q60Y65|HPPD_CAEBR (4-hydroxyphenylpyruvate dioxygenase OS=Caenorhabditis briggsae OX=6238 GN=hpd-1 PE=3 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 6.360e-36
Identity = 111/396 (28.03%), Postives = 180/396 (45.45%), Query Frame = 3
Query:  183 MGLIKRIHHVEIMTKSLDSVCKYLMKGFGFRLIS-KGKE--------NILQSGSAIFVVKE--FPNNC------LHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQDKSTFSEFVRS----FDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGK--NQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWC--MDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
            +G +    HV  +  +      +    FGF   + KG E        + ++    +FV +    P+N       +   D V DV  EV +L  I+A AK+    I++  T  SD+ G V  A L    G   HT++++  Y G FLPG+       + F    R      DH          +  ++WY  +    +F+   + ++      H + + +R             ++N  E+ K  + E  + N K  +QI EF+  + G G+QHI L+ +DII A E     G  FL  P  YY+ +++   + +++    MD+ +K  ILVD         + NG  +L Q+F+ P  DR T FLE+IQRQ   GFG+GN KAL+++++L Q   G
Sbjct:   12 IGTLVAFDHVRFVVGNAKQAAYWYCANFGFEPFAYKGLETGSRITAQHAIKQDKIVFVFESALLPDNTELGEHLVQHGDGVKDVCFEVEDLDSIVAHAKAAGATIVRDITEESDENGSVRFATL-RTYGETDHTLLERKKYKGAFLPGFKPHPMPPTFFHSLPRVGLNFLDHCVGNQPDLQMAPAVEWYENILKFHRFWSVDDSMI------HTEYSALRSIV----------VTNFEETIKMPINEPASSNKKAVSQIQEFVDYYGGSGVQHIALNTTDIITAIEALRARGCEFLSIPSSYYDNLRQRLSVSSMKIKEDMDRLQKLHILVDF--------DENG--YLLQIFSKPCQDRPTLFLEIIQRQNHQGFGAGNFKALFESIELEQTKRG 380          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. TrEMBL
Match: A0A498LPY3 (4-hydroxyphenylpyruvate dioxygenase OS=Labeo rohita OX=84645 GN=ROHU_031591 PE=3 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 2.699e-85
Identity = 152/405 (37.53%), Postives = 215/405 (53.09%), Query Frame = 3
Query:  192 IKRIHHVEIMTKSLDSVCKYLMKGFGF-----RLISKGKENILQSGSAIFVVKEFPN------------------------NCLH------QIDTVFDVALEVTNLQEIIARAKSNN-DRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQDKSTFSEF---VRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDEN-----FLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCSEN-TNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAV 1271
            + R+HH+ +   +++ V   L+  F F     RL  + K+  L+ GSA+FVV E PN                        NCL+       +DTV +V  EV ++Q   A  +       +Q  T + D  G V  + + S VGNV HT+ID+  Y G FLPG+  +  D  T +     +  FDHITY   +S ++ V +WY   F  ++FFI++N+ +DEG+VL+H   G+RL A +YWKC E+     F       CKFV+AE L E G+NQ++ FL  H+G GIQHIGL   DI+   +     GV F  PP  YY  + +  +I           +YGIL+D +         T+G+ +L QVFT PIF   TFFLELI+R+GATGFG GNI+ALW +V
Sbjct:    5 LSRLHHISLNVSNVNKVAHELVSRFQFNVFAARLTDRAKQLALRRGSAVFVVNERPNEAPRRLNGHQSRGWSSVTERHRDSNCLYGAHAHYPVDTVSNVCFEVEDVQSAAAALRDRGLCEFLQPPTEVCDDSGRVTFSIIRSPVGNVCHTLIDRSQYQGLFLPGFHRVGSDSQTAARSQCPITHFDHITYACPRSSTAHVTRWYRDTFGFRRFFIDRNEDVDEGYVLNHDGIGLRLTAMEYWKCSESGITLPFKDEKEPDCKFVIAESLPEQGRNQVDTFLDQHRGAGIQHIGLYTEDIVRTAQTLSQAGVQFFSPPPAYYTEVGKQEEIVAAGHDPHTLSQYGILLDTDIHTDTDRRITDGQRYLLQVFTKPIFGEDTFFLELIERRGATGFGEGNIRALWRSV 409          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. TrEMBL
Match: A0A0R4IQ07 (4-hydroxyphenylpyruvate dioxygenase OS=Danio rerio OX=7955 GN=LOC110438534 PE=3 SV=1)

HSP 1 Score: 270.396 bits (690), Expect = 1.361e-82
Identity = 148/397 (37.28%), Postives = 216/397 (54.41%), Query Frame = 3
Query:  192 IKRIHHVEIMTKSLDSVCKYLMKGFGF-----RLISKGKENILQSGSAIFVVKEFPN-------------NCL------HQIDTVFDVALEVTNLQEIIARAKSNND--RIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQ-----DKSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDEN-----FLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCS-ENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAV 1271
            + R+HH+ +   ++D V   L+  F F     R   + K+  L+ GSA+FVV E P+              C+      + +DTV +V  EVT++    +RA  + D    +Q    + D  G V  + + S VGNV HT+ID   Y G FLPG+ E+       D+S     +  FDHITY   +S +  +  WY   F  ++FFI++N+ +DEG+VL+H   G+RL A +YWKC E+     F       CKFV+AE L E G+NQ++ FL +H+G GIQHIGL   DI+   +     GV F  PP  YY  + +  ++    +      +YGIL+D + +     + T+G+  L QVFT P+F   TFFLELI+R+GATGFG GNI+ALW +V
Sbjct:    5 LSRLHHISLQVSNVDKVAHELVSRFQFNVFAARRTDRAKQLALRRGSAVFVVNERPSLSDCGAVRDHRDAGCVFGTHEHYPVDTVSNVCFEVTDVPSA-SRALRDQDGCEFLQPPAELQDDRGRVTFSIVRSPVGNVCHTLIDSSRYQGPFLPGFREVSSGCQGADRSRCP--ITHFDHITYACPRSSTVHITNWYRRNFGFQRFFIDRNEDVDEGYVLNHDGIGLRLTAMEYWKCSESGIKLPFKDEKEPDCKFVIAESLPEQGRNQVDTFLDEHRGAGIQHIGLYTEDIVKTAQTLSQAGVQFFSPPPAYYTEVGKQQEMLDAGYDPQTLSRYGILLDTDIQTDTDRQTTDGQRHLLQVFTKPVFAEDTFFLELIERRGATGFGEGNIRALWRSV 398          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. TrEMBL
Match: E7FH29 (4-hydroxyphenylpyruvate dioxygenase OS=Danio rerio OX=7955 GN=hpdl PE=3 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 2.404e-82
Identity = 148/397 (37.28%), Postives = 216/397 (54.41%), Query Frame = 3
Query:  192 IKRIHHVEIMTKSLDSVCKYLMKGFGF-----RLISKGKENILQSGSAIFVVKEFPN-------------NCL------HQIDTVFDVALEVTNLQEIIARAKSNND--RIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQ-----DKSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDEN-----FLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCS-ENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAV 1271
            + R+HH+ +   ++D V   L+  F F     R   + K+  L+ GSA+FVV E P+              C+      + +DTV +V  EVT++    +RA  + D    +Q    + D  G V  + + S VGNV HT+ID   Y G FLPG+ E+       D+S     +  FDHITY   +S +  +  WY   F  ++FFI++N+ +DEG+VL+H   G+RL A +YWKC E+     F       CKFV+AE L E G+NQ++ FL +H+G GIQHIGL   DI+   +     GV F  PP  YY  + +  ++    +      +YGIL+D + +     + T+G+  L QVFT P+F   TFFLELI+R+GATGFG GNI+ALW +V
Sbjct:    5 LSRLHHISLQVSNVDKVAHELVSRFQFNVFAARRTDRAKQLALRRGSAVFVVNERPSPSDCGAVRDHRDAGCVFGTHEHYPVDTVSNVCFEVTDVPSA-SRALRDQDGCEFLQPPAELQDDCGRVTFSIVRSPVGNVCHTLIDSSRYQGPFLPGFREVSSGCQGADRSRCP--ITHFDHITYACPRSSTVHITNWYRRNFGFQRFFIDRNEDVDEGYVLNHDGIGLRLTAMEYWKCSESGIKLPFKDEKEPDCKFVIAESLPEQGRNQVDTFLDEHRGAGIQHIGLYTEDIVKTAQTLSQAGVQFFSPPPAYYTEVGKQQEMLDAGYDPQTLSRYGILLDTDIQTDTDRQTTDGQRHLLQVFTKPVFAEDTFFLELIERRGATGFGEGNIRALWRSV 398          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. TrEMBL
Match: A0A1S3KJ86 (4-hydroxyphenylpyruvate dioxygenase OS=Salmo salar OX=8030 GN=LOC106560341 PE=3 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 3.039e-82
Identity = 150/423 (35.46%), Postives = 221/423 (52.25%), Query Frame = 3
Query:  192 IKRIHHVEIMTKSLDSVCKYLMKGFGF-----RLISKGKENILQSGSAIFVVKEFPN----------------------------------------NCLH------QIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQ-DKSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDEN-----FLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVD-----AETEFSC-SENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAV 1271
            + R+HH+ +   ++D +   L+  F F     RL  K K+   + G+A+FVV E PN                                        NCL+       +DT  +V  EV +++      ++     +   T + D+ G V  + + S +GNV HT++D   Y G FLPG+ E+E   KST S  +  FDHITY   + C+  V+ WY   F  ++FFI+ N+ +DEG+VL+ +  G+RL A +YWKC E      F       CKFV+AE L E G+NQ++ FL  H+GPGIQHIGL   DI+   +     GV F  PP  YY  + +  +++ + +      ++GIL+D     A+T+ SC + +T  K +L QVFT PIF   TFFLELI+R+GA+GFG GNI+ALW +V
Sbjct:    5 LSRLHHISLHVTNVDKIAYELVSKFKFNLFVARLTEKSKQLAFRKGAAVFVVNERPNKSPLELNGVTLSTGRGISPSQSEPGWTNNIQPGENNDKDPNCLYDVHPHYPVDTASNVCFEVEDVERSFKSLRNLGCDFLVPPTEVCDEKGLVTYSVVKSILGNVNHTLVDTSKYKGSFLPGFQEVENVAKSTESCPITHFDHITYACPRRCTPQVMSWYERHFGFQRFFIDSNEDVDEGYVLNKEGIGLRLTAMEYWKCSETGIKLPFTDRKQPDCKFVIAESLPEQGRNQVDTFLEQHRGPGIQHIGLYTQDIVSTAQTMGQAGVHFFSPPPAYYTEVGKQQEMEDVGYDPQMLSQHGILLDTDLRQAQTDPSCQTTDTQKKRYLLQVFTKPIFSEDTFFLELIERRGASGFGEGNIQALWRSV 427          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. TrEMBL
Match: G3NDJ6 (4-hydroxyphenylpyruvate dioxygenase OS=Gasterosteus aculeatus OX=69293 PE=3 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 9.708e-82
Identity = 150/391 (38.36%), Postives = 217/391 (55.50%), Query Frame = 3
Query:  186 GLIKRIHHVEIMTKSLDSVCKYLMKGFGF-----RLISKGKENILQSGSAIFVVKEFP------NNCL------HQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQD----KSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHS-----ESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYY---EIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAV 1271
             L+ R+HHV +   + + V   L+  F F     RL    K+  ++ G+A+FVV E P      + CL      H +DTV +V  EV ++Q      +      +   T + D+ G+V  + + S VGNV HT+ID+  Y G FLPG+  +  D     +  S  +  FDHITYV H+  +  V++WY  LF  ++FFI+  + +DEGFV++ +  G+RL A +YWKC E  ++  S       CKFV+AE L+E G+NQ++ FL  H  PGIQHIGL   +I+  T    + GV F  PP  YY   ++ KR  +I+          K+GIL+D +       + N + +L QVFT P+F   TFFLELI+R+GATGFG GNIKALW +V
Sbjct:    3 ALLTRLHHVSLNVSNAEKVTGDLVSKFKFSLFATRLTDGAKQLAVRKGAAVFVVTERPGRAGEPSGCLYDVSARHPVDTVNNVCFEVDDVQRSSRALRHLGCDFLVPPTTVHDRCGYVTYSVVKSIVGNVCHTLIDRTKYKGSFLPGFEGVGGDFRPPDADTSCPITHFDHITYVCHRKTTRQVMRWYEKLFGFQRFFIDGGEDVDEGFVINQEGIGLRLTAMEYWKCSEAGIALPSVDKKEPDCKFVIAESLSEQGRNQVDTFLEQHGAPGIQHIGLYTENIVSTTHAMADAGVQFFSPPQAYYMQAQVGKRQ-EIEEAGHSPQMLAKHGILLDTDLNRDRRSSVN-RGYLLQVFTKPVFAEDTFFLELIERKGATGFGEGNIKALWRSV 391          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Cavefish
Match: hpdl (4-hydroxyphenylpyruvate dioxygenase-like [Source:ZFIN;Acc:ZDB-GENE-071004-50])

HSP 1 Score: 215.312 bits (547), Expect = 8.456e-65
Identity = 128/379 (33.77%), Postives = 193/379 (50.92%), Query Frame = 3
Query:  192 IKRIHHVEIMTKSLDSVCKYLMKGF-----GFRLISKGKENILQSGSAIFVVKEFPNNCL-------------------HQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDK--FGFVDIAQLGSCVGNVVHTIIDKHDYP--GKFLPGYIEIEQDKSTFSEF---VRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLS-----NHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETE--FSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQ 1214
            + R+HHV +   +   V   L   F     G R+ ++ ++  L+ GSA+FVV E  +  +                   + +D+  +V  EV ++ E  AR       ++   T + D    G V  + + S VGNV HT++D+  Y   G FLPG+  +     +  +    V  FDH+T+   +  +  V+KWY   F  ++FFI  N+ +DEG+VL+    G+RL A +YWKC E  LS     + +  CKFV+AE L E G+NQ++ FL  H+GPGIQHIGLS  +I+   E     GV F  PP  YY  + +  +I        + +++GIL+D +       S   NG+ +L QVFT PIF   TFFLELI+
Sbjct:    5 VCRLHHVSLHVSNAVRVAGALASRFQFVAVGARVTARSRQLALRKGSAVFVVNERRDTGVTWTEAEENGQGYLYDVRPCYAVDSACNVCFEVEDVTESCARLSDRGCDVLVPPTEVCDPDGGGSVTYSVIRSVVGNVCHTLLDRSRYQDQGGFLPGFQRVGDGTDSEPDSRCPVTHFDHVTFACPRRSTGEVMKWYQENFGFQRFFIGSNEDVDEGYVLNQDGIGLRLTAMEYWKCSEIGLSIPFKDSQTPDCKFVIAESLPEKGQNQVDTFLKQHRGPGIQHIGLSTQNIVSTAETMAQAGVEFFTPPPAYYTEVGKQQEILEAGHHPKELKQHGILLDTDLRNHEDSSTMPNGR-YLLQVFTKPIFSEDTFFLELIE 382          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Cavefish
Match: hpdb (4-hydroxyphenylpyruvate dioxygenase [Source:NCBI gene;Acc:103024912])

HSP 1 Score: 132.88 bits (333), Expect = 2.734e-34
Identity = 98/347 (28.24%), Postives = 165/347 (47.55%), Query Frame = 3
Query:  297 NILQSGSAIFVV--------KEFPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGY-IEIEQDKSTFSEFVRSFDHITYVVHKSCSS---SVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDK--FEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
            ++++ G  I+V         KE   + +   D V DVA  V N + ++ +A+     +++    + DKFG V +A L    G+  HT++++  Y G FLPG+   + +D           D I +VV          V++WY       +F+   +  L   F      + +R             ++N+ E+ K  + E      K+QI E++  + GPG+QHI ++ S+II A       G+ F+  P  YY+ ++ N K+  ++   D    E+  ILVD         + NG  +L Q+FT P+ DR T FLE+IQR    GFG+GN K+L++A++  Q + G
Sbjct:   60 HVVKQGKIIYVFSSALNPGNKEMGEHLVQHGDGVKDVAFTVNNCEFLVQKARERGAIVVKEPHVLEDKFGRVKLAVL-QTYGDTTHTLVEREGYNGLFLPGFHAPLFRDPLLDKLPCGKLDFIDHVVGNQPDDEMVPVVEWYQKNLLFHRFWSVDDKQLQTQF------SALRSIV----------VANYEETVKMPINEPAMGKRKSQIQEYVEYYGGPGVQHIAMNTSNIIEAIRNLKERGMEFMSVPGTYYQQLRENLKLSKVKITEDISILEELKILVDY--------DDNG--YLLQIFTKPVQDRPTVFLEVIQRHNHQGFGAGNFKSLFEAIEADQNARG 379          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Cavefish
Match: hpda (4-hydroxyphenylpyruvate dioxygenase [Source:NCBI gene;Acc:103021345])

HSP 1 Score: 111.694 bits (278), Expect = 9.935e-27
Identity = 89/328 (27.13%), Postives = 148/328 (45.12%), Query Frame = 3
Query:  333 KEFPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIID-KHDYPGKFLPGYIEIEQDKSTFSEFVRS----FDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMD--KFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
            +E   + +   D+V D+A +V +   ++ +AK     I++      DK G V  A +    G+  HT+++    Y G FLPGY E         +         DHI           +  WY       +F+      +D+   +H + + +R             ++N+ E+ K  + E      K+QI E++  + G G+QHI L+ SDII A       G+ FL  P  YY+ ++   K   ++   D    ++  ILVD           + K +L Q+F+ P+ DR T FLE+IQR    GFG+GN K+L++A++  Q + G
Sbjct:   80 EEMGRHLMQHGDSVKDIAFQVEDCDFLVKKAKERGAVIVKEPWVEQDKHGKVKYAVV-QTYGDTTHTLVEYMTPYKGLFLPGYQEPLFKDPLLPKLPPGCLSFIDHIVGNQPDDEMVPISDWYQKCLMFHRFWS-----IDDK-QIHTQYSSLRSIV----------VTNYEETIKMPINEPAPGKKKSQIQEYVDYNGGAGVQHIALNTSDIIKAIVNLKARGMEFLSAPDSYYDSLREKLKTAKIKVKEDLKTLQELKILVD----------YDDKGYLLQIFSKPVQDRPTLFLEVIQRNNHFGFGAGNFKSLFEAIEKDQDARG 380          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Cavefish
Match: hpda (4-hydroxyphenylpyruvate dioxygenase [Source:NCBI gene;Acc:103021345])

HSP 1 Score: 86.6557 bits (213), Expect = 2.211e-18
Identity = 91/387 (23.51%), Postives = 157/387 (40.57%), Query Frame = 3
Query:  198 RIHHVEIMTKSLDSVCKYLMKGFGFRLIS-KGKE--------NILQSGSAIFVVK--------EFPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIID-KHDYPGKFLPGYIEIEQDKSTFSEFVRSFDHITYVVHKSCS---SSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
            R HH+     +      +     GF  ++ KG E        ++++    +FV +        E   + +   D+V D+A +V +   ++ +AK     I++      DK G V  A +    G+  HT+++    Y G FLPGY E       F + +     +  ++   CS   S  L++   L   + + I+   +       H + + +R             ++N+ E+ K  + E      K+QI E++  + G G+QHI L+ SDII A                                       +  ILVD +           K +L Q+F+ P+ DR T FLE+IQR    GFG+GN K+L++A++  Q + G
Sbjct:   18 RFHHLTFWVGNAKQAAAFYCDKMGFEPVAYKGLETGSREIVSHVIKQDKILFVFESALNPGNEEMGRHLMQHGDSVKDIAFQVEDCDFLVKKAKERGAVIVKEPWVEQDKHGKVKYAVV-QTYGDTTHTLVEYMTPYKGLFLPGYQE-----PLFKDPL-----LPKLMPHCCSHLLSVSLRYQKCLMFHRFWSIDDKQI-------HTQYSSLRSIV----------VTNYEETIKMPINEPAPGKKKSQIQEYVDYNGGAGVQHIALNTSDIIKA---------------------------------------ELKILVDYDD----------KGYLLQIFSKPVQDRPTLFLEVIQRNNHFGFGAGNFKSLFEAIEKDQDARG 327          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001974.1 (pep scaffold:Pmarinus_7.0:GL487872:2:2713:1 gene:ENSPMAG00000001795.1 transcript:ENSPMAT00000001974.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 1.808e-13
Identity = 38/107 (35.51%), Postives = 59/107 (55.14%), Query Frame = 3
Query:  984 NGVTFLKPPIGYYEIIKRN---PKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
             G+ F+  P  YY+++       KI+ +E  +DK  +  ILVD +           K +L Q+F+ P+ DR T FLE+IQR    GFG GN K+L++A++  Q + G
Sbjct:    2 RGMEFMSVPDTYYDLLYEKLACAKIKVVED-LDKLRELKILVDFDD----------KGYLLQIFSKPMQDRPTLFLEVIQRHNHQGFGVGNFKSLFEAIEADQNARG 97          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Nematostella
Match: EDO35286 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLZ3])

HSP 1 Score: 189.889 bits (481), Expect = 1.546e-56
Identity = 114/331 (34.44%), Postives = 174/331 (52.57%), Query Frame = 3
Query:  366 DTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPG--------YIEIEQDKSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNN----GMRLAAFDYWKCDENFLSNHSES-----CKFVVAEELTE--------NGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCSEN----TNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAV 1271
            DTV D+ALEV N+         N   +++      D +G V  + + S  GNV H++++   Y G FLPG        Y ++  + +  +  +   DH+     K     ++ WY      K+F +N ++  D GF +    N    G++L A +YW+C+E  + ++ +S      KFV+AE L          +G NQI  FL  H GPG+QHIGL  SDI  A +     GV+ +  P  YY  +++  +I+     ++   ++ IL+DAE+    SEN    T+   +L QVFT P+FD+ TFF+ELIQR GATGFG+GNI+ALW A+
Sbjct:    1 DTVKDIALEVENVSYATEIVAVNGGTVLEFTKVCDDCYGTVTSSMIRSPCGNVCHSLLNTTKYTGLFLPGFKRSPTQTYCQLNFNFTKPNNVITHVDHVAIACEKGSMLEIIDWYVKCLGFKRFCLNSSEESD-GFTIESPVNSASVGLKLTAMEYWRCNEIGIESNKDSHLDGAVKFVLAEALPGQGFFSDLFSGSNQIETFLHAHGGPGVQHIGLHTSDIARAMDEWTKAGVSIIPQPREYYNQVEKIKEIEQAGKSVNSLMEHNILLDAESIDHKSENNQASTDNSVYLMQVFTKPLFDQDTFFMELIQRHGATGFGAGNIQALWKAL 330          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Medaka
Match: hpdl (4-hydroxyphenylpyruvate dioxygenase like [Source:NCBI gene;Acc:101165105])

HSP 1 Score: 263.462 bits (672), Expect = 4.395e-83
Identity = 148/405 (36.54%), Postives = 212/405 (52.35%), Query Frame = 3
Query:  192 IKRIHHVEIMTK-----SLDSVCKYLMKGFGFRLISKGKENILQSGSAIFVVKEFPNNC-------------------------------LHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQD-KSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDE-----NFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAE--TEFSCSENTN-GKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAV 1271
            ++R+HHV +        + D V KY    F  RL +  ++   ++G+AIFVV E PN                                 LH +D+V +V  EV +++             +   T + D+ G V  + + S VGNV HT++DK  Y G FLPG+   EQD  S  S+ V  FDHITY   +  +  V+ WY  +F  K+FFI++N+ +DEGFV++ K  G+RL A  YWKC +      F       CKFV+AE L   G+NQ++ FL  H+ PGIQHI L  ++I+    +    GV F  PP  YY  + +  +I+ +        ++GIL+D +  T+ S  E +   + +L QVFT PIF   TFFLELI+R+GATGFG GNIKALW +V
Sbjct:    5 LRRLHHVSLHVSNGQKIAYDLVSKYKFNLFATRLTACSRQVAFRNGAAIFVVNEKPNRSGPLGLPGTCVDDPRVHAGKYNTTAALYDVCPLHPVDSVSNVCFEVEDVERSARDLHHLGCSFLVPPTTVEDQNGLVTYSVVKSVVGNVCHTLVDKTKYGGAFLPGFDVTEQDWSSEDSDSVTHFDHITYACPRKSTQQVMSWYEKMFGFKRFFIDRNEDVDEGFVVNQKGVGLRLTAMQYWKCSKAGISVPFADRKEPDCKFVIAESLPHQGRNQVDTFLEHHRAPGIQHIALYTNNIVSTANLMAAAGVQFFSPPPAYYTEVGKQLEIEEVGHDPQVLAQHGILLDTDLHTDPSAQEASRENRRYLLQVFTKPIFAEDTFFLELIERRGATGFGEGNIKALWRSV 409          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Medaka
Match: hpda (4-hydroxyphenylpyruvate dioxygenase [Source:NCBI gene;Acc:101165831])

HSP 1 Score: 114.005 bits (284), Expect = 1.666e-27
Identity = 89/317 (28.08%), Postives = 146/317 (46.06%), Query Frame = 3
Query:  366 DTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDK-HDYPGKFLPGYIEIEQDKSTFSEF----VRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQT--LEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
            D V D+A +V +   ++  AK     I++      D  G V    +    G+  HT+I+    Y G FLP Y E         +     ++  DHI           V  WY       +F+      +D+   +H + + +R             ++N+ E+ K  + E      K+QI E++  + GPG+QHI L+ S+II A       G+ FL  P  YYE +++  K     ++  +D+ ++  ILVD +           K +L Q+FT P+ DR T FLE+IQR+   GFG+GN K+L++A++  Q + G
Sbjct:   91 DAVKDIAFKVEDCDFLVKMAKERGAVIVKEPWVEQDSHGRVKYGVI-QTYGDTTHTLIEYLGPYKGLFLPDYKEPLFRDPLLPKLPPAGLKFIDHIVGNQPDDQMVPVSDWYQKCLMFHRFWS-----IDDK-QIHTQYSALRSIV----------VTNYEETIKMPINEPAMGKKKSQIQEYVDYNGGPGVQHIALNTSNIIQAIVNLRERGMEFLSAPESYYESLRKKLKAANFKVDEDLDRLQELKILVDFDD----------KGYLLQIFTKPVQDRPTLFLEVIQRKNHFGFGAGNFKSLFEAIEKDQDARG 380          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Medaka
Match: hpdb (4-hydroxyphenylpyruvate dioxygenase-like [Source:NCBI gene;Acc:101157460])

HSP 1 Score: 101.293 bits (251), Expect = 1.951e-23
Identity = 86/325 (26.46%), Postives = 139/325 (42.77%), Query Frame = 3
Query:  333 KEFPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGY-IEIEQDKSTFSEFVRSFDHITYVVHKSCSS---SVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
            KE  ++ +   D V D+A  V +   ++ +A+     II+    + DK G V +A L    G+  HT ++K  Y G FLPG+   + QD           D I +VV          ++ WY       +F+   +  L   F      + +R             ++N+ E+ K  + E      K+QI E++  + GPG+QHI ++ SDII  +E+ I                                      L+D +         NG  +L Q+FT P+ DR T FLE+IQR    GFG+GN K+L++A++  Q++ G
Sbjct:   54 KEMGDHMVKHGDGVKDIAFTVEDCDFLVQKARERGANIIKEPHTLEDKKGKVRLAVL-RTYGDTTHTFVEKTGYKGLFLPGFHPPLFQDPLLTKLPSGKLDFIDHVVGNQPDDEMVPIVDWYQKTLLFHRFWSVDDKQLQTEF------SALRSIV----------VANYEETVKMPINEPAMGKRKSQIQEYVDYYGGPGVQHIAMNTSDII-TSELKI--------------------------------------LIDYDD--------NG--YLLQIFTKPVQDRPTVFLEVIQRHNHQGFGAGNFKSLFEAIEADQQARG 312          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Medaka
Match: hpda (4-hydroxyphenylpyruvate dioxygenase [Source:NCBI gene;Acc:101165831])

HSP 1 Score: 77.0258 bits (188), Expect = 4.004e-15
Identity = 68/265 (25.66%), Postives = 107/265 (40.38%), Query Frame = 3
Query:  516 GNVVHTIIDK-HDYPGKFLPGYIEIEQDKSTFSEF----VRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
            G+  HT+I+    Y G FLP Y E         +     ++  DHI           V  WY       +F+   +  +      H + + +R             ++N+ E+ K  + E      K+QI E++  + GPG+QHI L+ S+II A                                       +  ILVD +           K +L Q+FT P+ DR T FLE+IQR+   GFG+GN K+L++A++  Q + G
Sbjct:  115 GDTTHTLIEYLGPYKGLFLPDYKEPLFRDPLLPKLPPAGLKFIDHIVGNQPDDQMVPVSDWYQKCLMFHRFWSIDDKQI------HTQYSALRSIV----------VTNYEETIKMPINEPAMGKKKSQIQEYVDYNGGPGVQHIALNTSNIIQA---------------------------------------ELKILVDFDD----------KGYLLQIFTKPVQDRPTLFLEVIQRKNHFGFGAGNFKSLFEAIEKDQDARG 314          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Planmine SMEST
Match: SMESG000037878.1 (SMESG000037878.1)

HSP 1 Score: 369.007 bits (946), Expect = 2.940e-128
Identity = 178/181 (98.34%), Postives = 181/181 (100.00%), Query Frame = 3
Query:  183 MGLIKRIHHVEIMTKSLDSVCKYLMKGFGFRLISKGKENILQSGSAIFVVKEFPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQDKSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINK 725
            MGLIKRIHHVEIMTKSLDSVCKYLMKGFGFRLISKGKENILQSGSAIF+VK+FPNNCLHQIDT+FDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQDKSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINK
Sbjct:    1 MGLIKRIHHVEIMTKSLDSVCKYLMKGFGFRLISKGKENILQSGSAIFIVKQFPNNCLHQIDTIFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQDKSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINK 181          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Planmine SMEST
Match: SMESG000045750.1 (SMESG000045750.1)

HSP 1 Score: 367.466 bits (942), Expect = 1.612e-127
Identity = 178/181 (98.34%), Postives = 180/181 (99.45%), Query Frame = 3
Query:  183 MGLIKRIHHVEIMTKSLDSVCKYLMKGFGFRLISKGKENILQSGSAIFVVKEFPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQDKSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINK 725
            MGLIKRIHHVEIMTKSLDSVCKYLMKGFGFRLISKGKENILQSGSAIF+VK+FPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIE DKSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINK
Sbjct:    1 MGLIKRIHHVEIMTKSLDSVCKYLMKGFGFRLISKGKENILQSGSAIFIVKQFPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEHDKSTFSEFVRSFDHITYVVHKSCSSSVLKWYSTLFDMKKFFINK 181          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Planmine SMEST
Match: SMESG000045752.1 (SMESG000045752.1)

HSP 1 Score: 300.827 bits (769), Expect = 1.378e-99
Identity = 141/144 (97.92%), Postives = 144/144 (100.00%), Query Frame = 3
Query:  873 NGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIGTTN 1304
            +GKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNG+NFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQ+SIGTTN
Sbjct:  165 SGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGENFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQESIGTTN 308          

HSP 2 Score: 80.4925 bits (197), Expect = 1.422e-16
Identity = 36/37 (97.30%), Postives = 36/37 (97.30%), Query Frame = 3
Query:  774 MRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKN 884
            MRLAAFDYWKCDENFLSNHSESCKFVVAEELTEN KN
Sbjct:    1 MRLAAFDYWKCDENFLSNHSESCKFVVAEELTENEKN 37          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Planmine SMEST
Match: SMESG000037881.1 (SMESG000037881.1)

HSP 1 Score: 276.559 bits (706), Expect = 1.147e-92
Identity = 131/134 (97.76%), Postives = 132/134 (98.51%), Query Frame = 3
Query:  903 MDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIGTTN 1304
            MDHKGPGIQHIGLSVSDIIHATEISINNGV FLKPP GYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQ+SIGTTN
Sbjct:    1 MDHKGPGIQHIGLSVSDIIHATEISINNGVIFLKPPTGYYEIIKRNPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQESIGTTN 134          
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Planmine SMEST
Match: SMESG000056251.1 (SMESG000056251.1)

HSP 1 Score: 123.635 bits (309), Expect = 4.604e-31
Identity = 93/329 (28.27%), Postives = 160/329 (48.63%), Query Frame = 3
Query:  333 KEFPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFGFVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQDKSTFSEFVRS-----FDHITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRLAAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQHIGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKR---NPKIQTLEWCMDKFEKYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATGFGSGNIKALWDAVDLSQKSIG 1295
            KE   +     D V D+A EV +L  I  +A      +++     SD+ G V  A++ +   +  HT ID+  Y G +LP Y  I  D+   ++   S      DHI         +++++WY       +F+      +D+   +H + + +R             ++N+ E+ K  + E      K+QI E++  +   G+QHI ++ +DII A ++    G+ FL  P  YY  +++   + KI+  E  +D+ EK  IL+D +         NG  +L Q+FT  + DR T FLE+IQR    GFG+GN K+L++A+++ Q+  G
Sbjct:   82 KEIGEHLTAHGDAVKDIAFEVEDLDAIFHKAVEKGANVVKDIWTESDENGTVKFARIKTFY-DTTHTFIDRSQYKGVYLPNYRLI-NDEDPINKIFESPGLNFIDHIVGNQPDDQMNNIVEWYEKTLQFHRFW-----SVDDS-QIHTEYSALRSIV----------ITNYDETVKLPINEPAAGKRKSQIQEYVDYYGSGGVQHIAMNTNDIIKAIKVLKGRGLKFLDAPKTYYTTLRKQLESAKIKVTE-DLDQLEKLSILIDFDD--------NG--YLLQIFTKNMQDRPTVFLEVIQRHNHNGFGAGNFKSLFEAIEVDQEERG 381          
The following BLAST results are available for this feature:
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
HPDL2.035e-4329.954-hydroxyphenylpyruvate dioxygenase like [Source:H... [more]
HPD8.343e-3328.744-hydroxyphenylpyruvate dioxygenase [Source:HGNC S... [more]
HPD1.352e-3228.744-hydroxyphenylpyruvate dioxygenase [Source:HGNC S... [more]
back to top
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
C31H2.42.659e-3728.54pep chromosome:WBcel235:X:5155093:5159667:-1 gene:... [more]
hpd-18.377e-3731.104-hydroxyphenylpyruvate dioxygenase [Source:UniPr... [more]
back to top
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hpd3.257e-3230.19gene:FBgn0036992 transcript:FBtr0078226[more]
Hpd6.765e-3229.20gene:FBgn0036992 transcript:FBtr0078225[more]
back to top
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HPDL6.081e-8637.284-hydroxyphenylpyruvate dioxygenase-like protein [... [more]
hpdl1.074e-8537.284-hydroxyphenylpyruvate dioxygenase-like [Source:Z... [more]
hpdb3.678e-3229.054-hydroxyphenylpyruvate dioxygenase b [Source:ZFIN... [more]
hpdb3.725e-3227.624-hydroxyphenylpyruvate dioxygenase b [Source:ZFIN... [more]
hpda7.424e-2628.104-hydroxyphenylpyruvate dioxygenase a [Source:NCBI... [more]
back to top
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elovl11.484e-5331.70ELOVL fatty acid elongase 1 [Source:Xenbase;Acc:XB... [more]
hpd1.346e-3430.584-hydroxyphenylpyruvate dioxygenase [Source:NCBI g... [more]
hpd1.419e-3430.584-hydroxyphenylpyruvate dioxygenase [Source:NCBI g... [more]
hpd1.469e-3430.584-hydroxyphenylpyruvate dioxygenase [Source:NCBI g... [more]
hpd2.941e-2726.74uncharacterized loc100125092 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Hpdl2.600e-4127.394-hydroxyphenylpyruvate dioxygenase-like [Source:M... [more]
Hpd1.125e-3629.894-hydroxyphenylpyruvic acid dioxygenase [Source:MG... [more]
Hpd6.518e-1039.784-hydroxyphenylpyruvic acid dioxygenase [Source:MG... [more]
Hpd4.643e-930.394-hydroxyphenylpyruvic acid dioxygenase [Source:MG... [more]
back to top
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96IR7|HPDL_HUMAN9.772e-4329.954-hydroxyphenylpyruvate dioxygenase-like protein O... [more]
sp|Q5XIH9|HPDL_RAT3.003e-4127.934-hydroxyphenylpyruvate dioxygenase-like protein O... [more]
sp|Q8K248|HPDL_MOUSE1.819e-4027.394-hydroxyphenylpyruvate dioxygenase-like protein O... [more]
sp|Q18347|YBWL_CAEEL3.382e-3628.54Putative protein C31H2.4 OS=Caenorhabditis elegans... [more]
sp|Q60Y65|HPPD_CAEBR6.360e-3628.034-hydroxyphenylpyruvate dioxygenase OS=Caenorhabdi... [more]
back to top
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A498LPY32.699e-8537.534-hydroxyphenylpyruvate dioxygenase OS=Labeo rohit... [more]
A0A0R4IQ071.361e-8237.284-hydroxyphenylpyruvate dioxygenase OS=Danio rerio... [more]
E7FH292.404e-8237.284-hydroxyphenylpyruvate dioxygenase OS=Danio rerio... [more]
A0A1S3KJ863.039e-8235.464-hydroxyphenylpyruvate dioxygenase OS=Salmo salar... [more]
G3NDJ69.708e-8238.364-hydroxyphenylpyruvate dioxygenase OS=Gasterosteu... [more]
back to top
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hpdl8.456e-6533.774-hydroxyphenylpyruvate dioxygenase-like [Source:Z... [more]
hpdb2.734e-3428.244-hydroxyphenylpyruvate dioxygenase [Source:NCBI g... [more]
hpda9.935e-2727.134-hydroxyphenylpyruvate dioxygenase [Source:NCBI g... [more]
hpda2.211e-1823.514-hydroxyphenylpyruvate dioxygenase [Source:NCBI g... [more]
back to top
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000001974.11.808e-1335.51pep scaffold:Pmarinus_7.0:GL487872:2:2713:1 gene:E... [more]
back to top
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO352861.546e-5634.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hpdl4.395e-8336.544-hydroxyphenylpyruvate dioxygenase like [Source:N... [more]
hpda1.666e-2728.084-hydroxyphenylpyruvate dioxygenase [Source:NCBI g... [more]
hpdb1.951e-2326.464-hydroxyphenylpyruvate dioxygenase-like [Source:N... [more]
hpda4.004e-1525.664-hydroxyphenylpyruvate dioxygenase [Source:NCBI g... [more]
back to top
BLAST of 4-hydroxyphenylpyruvate dioxygenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037878.12.940e-12898.34SMESG000037878.1[more]
SMESG000045750.11.612e-12798.34SMESG000045750.1[more]
SMESG000045752.11.378e-9997.92SMESG000045752.1[more]
SMESG000037881.11.147e-9297.76SMESG000037881.1[more]
SMESG000056251.14.604e-3128.27SMESG000056251.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021502 ID=SMED30021502|Name=4-hydroxyphenylpyruvate dioxygenase|organism=Schmidtea mediterranea sexual|type=transcript|length=1369bp
AAAATAATTGATCGTAAAATTTATTGGATCAGTTATAATATTTGATTCTT
GCAATATATGAAAGCCATCTATTAATTTGGAAATCACAATTACTCCACAA
ATATTAGATTTGATTGATTGGTTTTAGTAACGTTTATTTATTTGTTTCAT
TTTCTTGGCAATATCTTGCAAGAAATTGTTAAATGGGGTTGATTAAGAGG
ATCCATCACGTCGAAATAATGACAAAATCTTTGGATTCAGTTTGTAAATA
TCTAATGAAAGGATTTGGATTTAGACTTATTTCTAAGGGGAAAGAAAATA
TTTTGCAATCAGGAAGCGCAATATTTGTTGTTAAGGAATTCCCTAATAAT
TGTCTGCATCAAATTGATACTGTTTTCGATGTAGCATTAGAAGTGACAAA
TTTGCAAGAAATAATTGCCCGAGCTAAAAGTAATAATGATCGAATAATTC
AACATCAGACTAGGATTAGTGATAAATTCGGATTTGTTGACATTGCCCAA
CTAGGATCTTGTGTGGGGAATGTAGTCCACACGATCATTGACAAGCATGA
CTATCCAGGAAAATTCCTCCCAGGTTACATCGAAATTGAACAGGATAAAA
GCACATTCAGTGAGTTCGTAAGGTCATTCGATCATATCACATATGTTGTG
CACAAAAGTTGCTCTAGTTCCGTCCTAAAGTGGTACTCAACTTTGTTCGA
CATGAAGAAATTCTTTATTAATAAAAACGATTTGTTAGATGAAGGTTTTG
TGCTCCATCACAAAAACAATGGTATGCGATTGGCTGCGTTTGATTATTGG
AAATGCGATGAAAATTTCCTATCAAATCATAGCGAGTCGTGCAAATTTGT
CGTGGCGGAAGAATTGACTGAAAACGGTAAAAATCAAATTAACGAGTTCC
TCATGGATCACAAGGGCCCGGGTATTCAGCACATCGGTCTATCGGTTAGT
GACATTATTCACGCTACTGAAATCTCAATAAACAATGGAGTTACATTTCT
AAAACCACCCATTGGTTATTATGAAATCATAAAAAGAAATCCAAAAATTC
AGACGTTGGAATGGTGCATGGATAAATTCGAGAAATATGGGATATTAGTT
GATGCTGAAACCGAATTTTCATGTTCAGAAAATACAAATGGCAAGAACTT
CTTGTATCAAGTGTTTACCAACCCCATATTTGATAGACATACGTTTTTTC
TTGAATTAATTCAAAGACAAGGGGCCACTGGATTCGGTTCGGGTAACATC
AAGGCATTATGGGATGCCGTGGATTTGTCACAGAAATCTATAGGAACTAC
TAATTAGAAGAAATATTTGCTTTCTCACTTTCTATTTGCTAAATCGTGTC
TTTTTCTCGTTTTTTATTA
back to top

protein sequence of SMED30021502-orf-1

>SMED30021502-orf-1 ID=SMED30021502-orf-1|Name=SMED30021502-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=375bp
MGLIKRIHHVEIMTKSLDSVCKYLMKGFGFRLISKGKENILQSGSAIFVV
KEFPNNCLHQIDTVFDVALEVTNLQEIIARAKSNNDRIIQHQTRISDKFG
FVDIAQLGSCVGNVVHTIIDKHDYPGKFLPGYIEIEQDKSTFSEFVRSFD
HITYVVHKSCSSSVLKWYSTLFDMKKFFINKNDLLDEGFVLHHKNNGMRL
AAFDYWKCDENFLSNHSESCKFVVAEELTENGKNQINEFLMDHKGPGIQH
IGLSVSDIIHATEISINNGVTFLKPPIGYYEIIKRNPKIQTLEWCMDKFE
KYGILVDAETEFSCSENTNGKNFLYQVFTNPIFDRHTFFLELIQRQGATG
FGSGNIKALWDAVDLSQKSIGTTN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:00038684-hydroxyphenylpyruvate dioxygenase activity
GO:0051213dioxygenase activity
GO:0016701oxidoreductase activity, acting on single donors with incorporation of molecular oxygen
GO:0046872metal ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
Vocabulary: INTERPRO
TermDefinition
IPR0059564OHPhenylPyrv_dOase
IPR037523VOC
IPR029068Glyas_Bleomycin-R_OHBP_Dase
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0009072aromatic amino acid family metabolic process
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029068Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenaseGENE3DG3DSA:3.10.180.10coord: 2..141
e-value: 1.8E-24
score: 88.3
IPR029068Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenaseGENE3DG3DSA:3.10.180.10coord: 145..373
e-value: 2.9E-58
score: 198.8
IPR029068Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenaseSUPERFAMILYSSF54593Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenasecoord: 4..360
NoneNo IPR availablePANTHERPTHR11959:SF104-HYDROXYPHENYLPYRUVATE DIOXYGENASE-LIKE PROTEINcoord: 4..368
IPR0059564-hydroxyphenylpyruvate dioxygenasePANTHERPTHR119594-HYDROXYPHENYLPYRUVATE DIOXYGENASEcoord: 4..368
IPR037523Vicinal oxygen chelate (VOC) domainPROSITEPS51819VOCcoord: 6..121
score: 11.052
IPR037523Vicinal oxygen chelate (VOC) domainPROSITEPS51819VOCcoord: 148..311
score: 11.061