DnaJ-like subfamily C member 25

Overview
NameDnaJ-like subfamily C member 25
Smed IDSMED30021494
Length (bp)1203
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DnaJ-like subfamily C member 25 (SMED30021494) t-SNE clustered cells

Violin plots show distribution of expression levels for DnaJ-like subfamily C member 25 (SMED30021494) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DnaJ-like subfamily C member 25 (SMED30021494) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DnaJ-like subfamily C member 25 (SMED30021494) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021494

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30021494SMESG000035521.1 dd_Smed_v4_3301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021494SMESG000035521.1 dd_Smed_v4_3301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30021494SMESG000035521.1 dd_Smed_v4_3301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021494SMESG000035521.1 dd_Smed_v4_3301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30021494SMESG000035521.1 dd_Smed_v4_3301_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021494SMESG000035521.1 Contig42989newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021494SMESG000035521.1 Contig42989uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021494SMESG000075021.1 SMESG000035521.1 Contig16963newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021494SMESG000075021.1 SMESG000035521.1 Contig16963uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Human
Match: DNAJC25 (DnaJ heat shock protein family (Hsp40) member C25 [Source:HGNC Symbol;Acc:HGNC:34187])

HSP 1 Score: 235.343 bits (599), Expect = 1.261e-73
Identity = 162/324 (50.00%), Postives = 229/324 (70.68%), Query Frame = 2
Query:   98 AHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEE-------TKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITF 1048
            A + +EGLYCG  +CY++LGV+R   K +I R+YR LAR YHPDR R +        T  +AE  F  +A AYE L+D+E RK+YDYMLD+P+E Y HYY YY RR APKVDV++VILV +  IS+ Q++  W++YN+A+ YL   PKYR++A +IAK +GLL +  +K +N  KK+KEEI+  EEN+IK II  K+DIKGGY KP +  +L  QI L P+ +  +I    RW+Y +NI  +EY +E+++ II+  M +   Q++SL+D +K+ + KRELWIK+N+EVY++E+E E K KLA DP +KRYRR++K  G G++TF
Sbjct:   36 AGALVEGLYCGTRDCYEVLGVSRSAGKAEIARAYRQLARRYHPDRYRPQPGDEGPGRTPQSAEEAFLLVATAYETLKDEETRKDYDYMLDHPEEYYSHYYHYYSRRLAPKVDVRVVILVSVCAISVFQFFSWWNSYNKAISYLATVPKYRIQATEIAKQQGLLKKAKEKGKN--KKSKEEIRDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYCRWIYNFNIKGKEYGEEERLYIIRKSMKMSKSQFDSLEDHQKETFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTF 357          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Human
Match: DNAJC25-GNG10 (DNAJC25-GNG10 readthrough [Source:HGNC Symbol;Acc:HGNC:37501])

HSP 1 Score: 76.6406 bits (187), Expect = 4.502e-16
Identity = 39/92 (42.39%), Postives = 53/92 (57.61%), Query Frame = 2
Query:   98 AHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEE-------TKSTAEIKFRQIANAYEILRDDEQRKEY-DYMLDN 349
            A + +EGLYCG  +CY++LGV+R   K +I R+YR LAR YHPDR R +        T  +AE  F  +A AYE L+  +   E   Y + N
Sbjct:   36 AGALVEGLYCGTRDCYEVLGVSRSAGKAEIARAYRQLARRYHPDRYRPQPGDEGPGRTPQSAEEAFLLVATAYETLKVSQAAAELQQYCMQN 127          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Human
Match: DNAJC25 (DnaJ heat shock protein family (Hsp40) member C25 [Source:HGNC Symbol;Acc:HGNC:34187])

HSP 1 Score: 75.485 bits (184), Expect = 5.964e-16
Identity = 37/82 (45.12%), Postives = 49/82 (59.76%), Query Frame = 2
Query:   89 VVLAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEE-------TKSTAEIKFRQIANAYEILRDD 313
            V  A + +EGLYCG  +CY++LGV+R   K +I R+YR LAR YHPDR R +        T  +AE  F  +A AYE L+  
Sbjct:   33 VRPAGALVEGLYCGTRDCYEVLGVSRSAGKAEIARAYRQLARRYHPDRYRPQPGDEGPGRTPQSAEEAFLLVATAYETLKSS 114          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Human
Match: DNAJC25 (DnaJ heat shock protein family (Hsp40) member C25 [Source:HGNC Symbol;Acc:HGNC:34187])

HSP 1 Score: 75.0998 bits (183), Expect = 9.955e-16
Identity = 36/77 (46.75%), Postives = 48/77 (62.34%), Query Frame = 2
Query:   98 AHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEE-------TKSTAEIKFRQIANAYEILR 307
            A + +EGLYCG  +CY++LGV+R   K +I R+YR LAR YHPDR R +        T  +AE  F  +A AYE L+
Sbjct:   36 AGALVEGLYCGTRDCYEVLGVSRSAGKAEIARAYRQLARRYHPDRYRPQPGDEGPGRTPQSAEEAFLLVATAYETLK 112          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Human
Match: DNAJB9 (DnaJ heat shock protein family (Hsp40) member B9 [Source:HGNC Symbol;Acc:HGNC:6968])

HSP 1 Score: 62.003 bits (149), Expect = 1.898e-10
Identity = 30/66 (45.45%), Postives = 44/66 (66.67%), Query Frame = 2
Query:  143 YDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYM 340
            YDILGV +   +++I +++  LA  YHPD+ ++ +    AE KFR+IA AYE L D  +RKEYD +
Sbjct:   28 YDILGVPKSASERQIKKAFHKLAMKYHPDKNKSPD----AEAKFREIAEAYETLSDANRRKEYDTL 89          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Celegans
Match: dnj-2 (DnaJ homolog dnj-2 [Source:UniProtKB/Swiss-Prot;Acc:Q17433])

HSP 1 Score: 168.318 bits (425), Expect = 1.635e-48
Identity = 130/337 (38.58%), Postives = 207/337 (61.42%), Query Frame = 2
Query:   65 VTFILLGLVVLAHSQI---EGLYCGKENCYDILGVTRED-DKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWES-LDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITFGQED 1060
            + F+L+   V     +     LYCG ENCYD+L V RE+ DKQK+ ++YR+LAR +HPDR + +E K  AE +FR IA AYE L+DDE +  YDY LD+PD+ +Y+YYQYYR R APKVD++IVI+  I +IS+ Q+      ++EA++Y     K+R  A      +GLL E+++   NG+ K  +   ++ + +IK+III+ +D+ GGY + ++Y  L     +FP  I  +I     W + + I K EY  + K+ +I+ Y+ +  ++++    D + D  F+RE W+K+N   ++ E++  ++ K+A    YKRY+R++K   AG I+F  ED
Sbjct:    9 ILFLLVSFFVQECESVGFAPELYCGLENCYDVLEVNREEFDKQKLAKAYRALARKHHPDRVKNKEEKLLAEERFRVIATAYETLKDDEAKTNYDYYLDHPDQRFYNYYQYYRLRAAPKVDLRIVIVGTILIISLFQFLSAKHKFSEAIEYATGVGKFRNMAIKDGIDKGLL-EMDR---NGKLK--KNKGVDNDEVIKQIIIDNLDVTGGYKRESIYDTLAWHTIIFPLTIFRYIKWTALWYWRFAIQKEEYDDDAKLYLIRKYIGVSQMEFDQKYTDEDIDDLFERECWLKRNCATWKAERDAAEQEKMAQSGRYKRYKRYMK--NAGTISFVDED 337          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Celegans
Match: C47A4.1 (pep chromosome:WBcel235:IV:13715906:13716379:-1 gene:WBGene00008122.1 transcript:C47A4.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C47A4.1)

HSP 1 Score: 72.0182 bits (175), Expect = 6.665e-15
Identity = 40/129 (31.01%), Postives = 71/129 (55.04%), Query Frame = 2
Query:  677 GGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWES-LDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITFGQED 1060
            GGY + ++Y  L     +FP  I  +I     W + + I K EY  + K+ +I+ Y+ +  ++++    D + D  F+RE W+K N   ++ E++  ++ K+A    YKRY+R++K   AG I+F  ED
Sbjct:   31 GGYKRESIYDTLAWHTIIFPLTIFRYIKWTALWYWRFAIQKEEYDDDAKLYLIRKYIGVSQMEFDQKYTDEDIDDLFERECWLKTNCATWKAERDAAEQEKMAQSGRYKRYKRYMK--NAGTISFVDED 157          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Celegans
Match: dnj-20 (DnaJ homolog dnj-20 [Source:UniProtKB/Swiss-Prot;Acc:Q8MPX3])

HSP 1 Score: 62.7734 bits (151), Expect = 1.262e-10
Identity = 34/85 (40.00%), Postives = 54/85 (63.53%), Query Frame = 2
Query:   80 LGLVVLAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
            + L+VLA S +  + CG++  Y ILGV +  +  +I ++YR LA+  HPDR + +E    A  KF+ +++AYE+L D E+R  YD
Sbjct:    6 VSLLVLASSLVAFVECGRD-FYKILGVAKNANANQIKKAYRKLAKELHPDRNQDDE---MANEKFQDLSSAYEVLSDKEKRAMYD 86          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Celegans
Match: dnj-10 (DnaJ homolog dnj-10 [Source:UniProtKB/Swiss-Prot;Acc:Q8TA83])

HSP 1 Score: 63.1586 bits (152), Expect = 1.293e-10
Identity = 31/68 (45.59%), Postives = 47/68 (69.12%), Query Frame = 2
Query:  131 KENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
            KE+ Y  LGV ++ D + I ++Y  LA+ YHPD  +T+E    A+ KF++I+ AYE+L DD +R+EYD
Sbjct:   42 KEDYYKTLGVDKKSDAKAIKKAYFQLAKKYHPDVNKTKE----AQTKFQEISEAYEVLSDDTKRQEYD 105          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Celegans
Match: dnj-10 (DnaJ homolog dnj-10 [Source:UniProtKB/Swiss-Prot;Acc:Q8TA83])

HSP 1 Score: 62.7734 bits (151), Expect = 1.622e-10
Identity = 31/68 (45.59%), Postives = 47/68 (69.12%), Query Frame = 2
Query:  131 KENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
            KE+ Y  LGV ++ D + I ++Y  LA+ YHPD  +T+E    A+ KF++I+ AYE+L DD +R+EYD
Sbjct:   42 KEDYYKTLGVDKKSDAKAIKKAYFQLAKKYHPDVNKTKE----AQTKFQEISEAYEVLSDDTKRQEYD 105          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Fly
Match: CG7872 (gene:FBgn0030658 transcript:FBtr0074046)

HSP 1 Score: 241.506 bits (615), Expect = 9.355e-77
Identity = 153/319 (47.96%), Postives = 225/319 (70.53%), Query Frame = 2
Query:   92 VLAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITF 1048
             +A   +EGLYCGKENCYD+LGVTRE  K +I ++YR LAR YHPD  R  E K+ AE +F+ +A AYEILRD+E R +YDYMLDNPD  Y HYY+YYRRR APKVDV++VI+V+++++S+ QYY  W  Y+ A+KY    PKYR +A +IA+ E + +++ KK +N  + +K + +   E +I+++I EKMD+KGGYAKPTL+ VLW+Q+ + PY IL +I    +W + Y ++K+ Y +E K+ +I+ ++ +   Q+E+ +D   + Y   +LW ++NF  ++ E+E E K KLA +P YK YRR++K  G G+ITF
Sbjct:   16 TMALGLLEGLYCGKENCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESRTDYDYMLDNPDAYYAHYYRYYRRRVAPKVDVRVVIVVVLTIVSVIQYYSGWQRYDSAIKYFATVPKYRNQALEIARDE-IQEKIQKKGKN--RMSKNDQRDELERIIRRVIEEKMDVKGGYAKPTLWDVLWVQLIICPYTILSFIVWHAQWFWRYTVMKQPYGREQKLYLIRRHLGMGQHQFEAQEDKLIEEYLHLKLWKRENFVAWKAEQEEEMKKKLAENPRYKAYRRYMKNHGPGRITF 331          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Fly
Match: P58IPK (gene:FBgn0037718 transcript:FBtr0082074)

HSP 1 Score: 58.9214 bits (141), Expect = 4.371e-9
Identity = 32/64 (50.00%), Postives = 43/64 (67.19%), Query Frame = 2
Query:  143 YDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
            Y ILGV R   KQ+I+++YR  A+ +HPD  R EE K  AE KF  IA A E+L D E+R+++D
Sbjct:  398 YKILGVKRSASKQEIVKAYRKAAQKWHPDNFRDEE-KKVAEKKFIDIAAAKEVLTDPEKRRQFD 460          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Fly
Match: CG8531 (gene:FBgn0033918 transcript:FBtr0087538)

HSP 1 Score: 55.8398 bits (133), Expect = 3.621e-8
Identity = 26/67 (38.81%), Postives = 40/67 (59.70%), Query Frame = 2
Query:  134 ENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
            EN Y  L + R+   ++I  +YR  +R++HPD+    ++K  AEI F +   AYE+L D +QR  YD
Sbjct:   14 ENYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQRAIYD 80          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Fly
Match: shv (gene:FBgn0031256 transcript:FBtr0078060)

HSP 1 Score: 53.9138 bits (128), Expect = 1.155e-7
Identity = 32/96 (33.33%), Postives = 56/96 (58.33%), Query Frame = 2
Query:   50 MQLL-CVTFILLGLVVLAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
            MQL+ C+  I L L+++  S     + G++  Y IL V +  +  ++ ++YR LA+  HPD+ + +   ST   KF+ +  AYE+L + ++RK YD
Sbjct:    1 MQLIKCLVIIQLSLLLVEES-----FAGRD-FYKILNVKKNANTNEVKKAYRRLAKELHPDKNKDDPDAST---KFQDLGAAYEVLSNPDKRKTYD 87          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Fly
Match: CG32640 (gene:FBgn0052640 transcript:FBtr0073728)

HSP 1 Score: 50.447 bits (119), Expect = 1.953e-7
Identity = 25/68 (36.76%), Postives = 41/68 (60.29%), Query Frame = 2
Query:  131 KENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
            +E+ Y ILGV      ++I R+Y+ +A IYHPD+ +   T +    +FR+I  A+ +L D   R++YD
Sbjct:    2 EEDYYMILGVDHNATDEEIRRAYKRMALIYHPDKNKHPRTTA----QFRKINEAFNVLSDASARRKYD 65          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Zebrafish
Match: dnajc25 (DnaJ (Hsp40) homolog, subfamily C , member 25 [Source:ZFIN;Acc:ZDB-GENE-081104-137])

HSP 1 Score: 244.202 bits (622), Expect = 1.859e-77
Identity = 160/337 (47.48%), Postives = 229/337 (67.95%), Query Frame = 2
Query:   59 LCVTFILLGLVVLAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDR---QRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXX-XXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITFGQE 1057
            +C+ FIL    V A   IEGLYCG ++CYD+LGV+R+  K ++ R+YR LAR YHPDR     T++T+ +A+ KF  +A AYE L+D+E RK+YDYMLD+P+E Y HYY YYRRR APKVDV+IVILV I  IS+ QYY  WS+Y EA+ YL+  PKYR++A ++AK +GLL   N+ +E G+ +  +E    EE  I + II+    IKGGY KP +  +L  +I LFPY +  ++     W Y + I   EY +E+++ II+ YM +   Q++SL++S  + + K++LWIK+N+E Y+KE+E E K K+A D  +KRYRR++K  G G+ITF  +
Sbjct:   13 ICLVFILCFHSVSA--LIEGLYCGTQSCYDVLGVSRDVSKAELGRAYRQLARRYHPDRFQPGETDDTRESAQQKFLLVATAYETLKDEELRKDYDYMLDHPEEYYSHYYTYYRRRLAPKVDVRIVILVTICAISLFQYYSWWSSYTEAINYLMTVPKYRIQATELAKQQGLL---NRTKEKGKNRRSKEEIREEEEQIIRDIIKNKIDIKGGYQKPNVSDILLCKIVLFPYHLCTYVAWNFSWFYRFTIRGEEYGEEERLYIIRKYMKMSQAQFDSLENSLIETFLKQQLWIKENYEAYKKEQEEEMKMKMATDSRWKRYRRWMKSEGPGRITFADD 344          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Zebrafish
Match: dnajc25 (DnaJ (Hsp40) homolog, subfamily C , member 25 [Source:ZFIN;Acc:ZDB-GENE-081104-137])

HSP 1 Score: 243.817 bits (621), Expect = 2.790e-77
Identity = 160/337 (47.48%), Postives = 229/337 (67.95%), Query Frame = 2
Query:   59 LCVTFILLGLVVLAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDR---QRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXX-XXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITFGQE 1057
            +C+ FIL    V A   IEGLYCG ++CYD+LGV+R+  K ++ R+YR LAR YHPDR     T++T+ +A+ KF  +A AYE L+D+E RK+YDYMLD+P+E Y HYY YYRRR APKVDV+IVILV I  IS+ QYY  WS+Y EA+ YL+  PKYR++A ++AK +GLL   N+ +E G+ +  +E    EE  I + II+    IKGGY KP +  +L  +I LFPY +  ++     W Y + I   EY +E+++ II+ YM +   Q++SL++S  + + K++LWIK+N+E Y+KE+E E K K+A D  +KRYRR++K  G G+ITF  +
Sbjct:   23 ICLVFILCFHSVSA--LIEGLYCGTQSCYDVLGVSRDVSKAELGRAYRQLARRYHPDRFQPGETDDTQESAQQKFLLVATAYETLKDEELRKDYDYMLDHPEEYYSHYYTYYRRRLAPKVDVRIVILVTICAISLFQYYSWWSSYTEAINYLMTVPKYRIQATELAKQQGLL---NRTKEKGKNRRSKEEIREEEEQIIRDIIKNKIDIKGGYQKPNVSDILLCKIVLFPYHLCTYVAWNFSWFYRFTIRGEEYGEEERLYIIRKYMKMSQAQFDSLENSLIETFLKQQLWIKENYEAYKKEQEEEMKMKMATDSRWKRYRRWMKSEGPGRITFADD 354          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Zebrafish
Match: dnajb9b (DnaJ heat shock protein family (Hsp40) member B9b [Source:ZFIN;Acc:ZDB-GENE-050522-76])

HSP 1 Score: 63.5438 bits (153), Expect = 2.643e-11
Identity = 34/98 (34.69%), Postives = 58/98 (59.18%), Query Frame = 2
Query:   59 LCVTFILLGLVVLAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNP 352
            + V+ +L+  ++LA          +++ Y+ILGV ++   ++I +++  LA  +HPD+ ++ +    AE KFR+IA AYE L DD +RKEYD     P
Sbjct:   10 VAVSILLISELILA----------EKDYYEILGVPKDASDRQIKKAFHKLAMRFHPDKNKSPD----AEAKFREIAEAYETLSDDNRRKEYDQTRSRP 93          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Zebrafish
Match: dnajb9b (DnaJ heat shock protein family (Hsp40) member B9b [Source:ZFIN;Acc:ZDB-GENE-050522-76])

HSP 1 Score: 63.5438 bits (153), Expect = 2.643e-11
Identity = 34/98 (34.69%), Postives = 58/98 (59.18%), Query Frame = 2
Query:   59 LCVTFILLGLVVLAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNP 352
            + V+ +L+  ++LA          +++ Y+ILGV ++   ++I +++  LA  +HPD+ ++ +    AE KFR+IA AYE L DD +RKEYD     P
Sbjct:   10 VAVSILLISELILA----------EKDYYEILGVPKDASDRQIKKAFHKLAMRFHPDKNKSPD----AEAKFREIAEAYETLSDDNRRKEYDQTRSRP 93          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Zebrafish
Match: dnajb9a (DnaJ heat shock protein family (Hsp40) member B9a [Source:ZFIN;Acc:ZDB-GENE-050626-115])

HSP 1 Score: 61.2326 bits (147), Expect = 2.264e-10
Identity = 32/87 (36.78%), Postives = 56/87 (64.37%), Query Frame = 2
Query:   74 ILLGLVVLAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
            ++  + +L    I  L   +++ YDILGV ++  +++I +++  LA  YHPD+ ++ +    AE KFR+IA AYE L D+++R+EYD
Sbjct:    8 LMFAVCIL---MITELILARKDYYDILGVPKDASERQIKKAFHKLAMKYHPDKNKSPD----AENKFREIAEAYETLSDEKRRREYD 87          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Xenopus
Match: dnajc25 (DnaJ heat shock protein family (Hsp40) member C25 [Source:NCBI gene;Acc:496999])

HSP 1 Score: 253.062 bits (645), Expect = 1.829e-80
Identity = 162/327 (49.54%), Postives = 232/327 (70.95%), Query Frame = 2
Query:   98 AHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEE-------TKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITFGQE 1057
            A +  EGLYCG++ CYD+LGV+R+  K  I R+YR LAR YHPDR R  E       T+ +A+ KF  +A AYE L+D+E RK+YDYMLD+P+E Y HYY YY RR APKVDV+IVILV +  ISI QYY  WS+YNEA+ YL    KYR++A +IAK +GLL+   +K +N  +++KEEIK  EE +I+ II  K+DIKGGY KP ++ +L  QI LFPY+I  +I   + W+Y +NI  +EY +E+K+ +I+  M +   Q+++L++  K+ + +++LWIK+N+EVY+ E+E E K K+A+DP +KRYRR++K  G G++TF  +
Sbjct:   44 AGALTEGLYCGRQVCYDVLGVSRDASKGDIARAYRQLARKYHPDRYRPGEPPGPDGETRESAQEKFLLVATAYETLKDEETRKDYDYMLDHPEEYYRHYYHYYSRRLAPKVDVRIVILVSVCAISIFQYYSWWSSYNEAINYLATVTKYRIQAMEIAKQQGLLNRTKEKGKN--RRSKEEIKSEEEEIIRDIIKNKIDIKGGYQKPQIFDILLFQIILFPYYIFKYISWYVHWIYTFNIQGKEYGEEEKLYLIRRNMKMSQSQFDTLEEHRKNSFLEQKLWIKENYEVYKLEQEEEMKKKMASDPRWKRYRRWMKNEGPGRLTFADD 368          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Xenopus
Match: dnajb9 (DnaJ heat shock protein family (Hsp40) member B9 [Source:NCBI gene;Acc:100038131])

HSP 1 Score: 64.6994 bits (156), Expect = 1.922e-11
Identity = 35/92 (38.04%), Postives = 54/92 (58.70%), Query Frame = 2
Query:   59 LCVTFILLGLVVLAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
              V  +L+  ++LA          K+  YDILGV +   +++I +++  LA  YHPD+ ++ +    AE KFR+IA AYE L D+ +RKEYD
Sbjct:   10 FAVCILLISEIILA----------KKTYYDILGVPKNASERQIKKAFHKLAMKYHPDKNKSPD----AEAKFREIAEAYETLSDESKRKEYD 87          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Xenopus
Match: dnajb2 (DnaJ heat shock protein family (Hsp40) member B2 [Source:NCBI gene;Acc:548454])

HSP 1 Score: 61.2326 bits (147), Expect = 6.373e-10
Identity = 33/66 (50.00%), Postives = 42/66 (63.64%), Query Frame = 2
Query:  143 YDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYM 340
            YDILGV R   +  I R+YR LA  +HPD+    + K  AE KF+ IA AYE+L D E+R+ YD M
Sbjct:    5 YDILGVPRNASQDDIKRAYRKLALRWHPDK--NPDNKEHAERKFKDIAEAYEVLSDREKREAYDNM 68          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Xenopus
Match: naa16 (N(alpha)-acetyltransferase 16, NatA auxiliary subunit [Source:Xenbase;Acc:XB-GENE-1013076])

HSP 1 Score: 58.151 bits (139), Expect = 1.432e-8
Identity = 30/77 (38.96%), Postives = 48/77 (62.34%), Query Frame = 2
Query:  131 KENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDN--PD 355
            ++N Y+ LGV ++     I ++YR L+   HPD+ + E     AE +FRQ+   YE+L+D+E+R+ YD +L N  PD
Sbjct:   41 QQNFYEFLGVEQDASSADIRKAYRKLSLTLHPDKNKEE----NAETQFRQLVAIYEVLKDEERRQRYDDILVNGLPD 113          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Xenopus
Match: naa16 (N(alpha)-acetyltransferase 16, NatA auxiliary subunit [Source:Xenbase;Acc:XB-GENE-1013076])

HSP 1 Score: 58.151 bits (139), Expect = 1.470e-8
Identity = 30/77 (38.96%), Postives = 48/77 (62.34%), Query Frame = 2
Query:  131 KENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDN--PD 355
            ++N Y+ LGV ++     I ++YR L+   HPD+ + E     AE +FRQ+   YE+L+D+E+R+ YD +L N  PD
Sbjct:   46 QQNFYEFLGVEQDASSADIRKAYRKLSLTLHPDKNKEE----NAETQFRQLVAIYEVLKDEERRQRYDDILVNGLPD 118          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Mouse
Match: Dnajc25 (DnaJ heat shock protein family (Hsp40) member C25 [Source:MGI Symbol;Acc:MGI:1919679])

HSP 1 Score: 231.106 bits (588), Expect = 3.556e-72
Identity = 162/323 (50.15%), Postives = 227/323 (70.28%), Query Frame = 2
Query:   98 AHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKS------TAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITF 1048
            A + +EGLYCG  +CY++LGV+R   K +I R+YR LAR YHPDR R E          +AE  F  +A AYE L+D+E RK+YDYMLD+P+E Y HYY YY RR APKVDV++VILV +  IS+ QY+  W++YN+A+ YL   PKYR++A +IAK +GLL +  +K +N  KK+KEEI+  EEN+IK II  K+DIKGGY KP +  +L  Q+ L P  +  +I    RW+Y +NI  +EY +E+++ II+  M +   Q++SL+D +K+ + KRELWIK+N+EVY++E+E E K KLA DP +KRYRR++K  G G++TF
Sbjct:   35 AEALVEGLYCGTRDCYEVLGVSRSASKAEIARAYRQLARRYHPDRYRPEPGDGPGGAPPSAE-AFLLVATAYETLKDEETRKDYDYMLDHPEEYYSHYYHYYSRRLAPKVDVRVVILVSVCAISMFQYFSWWNSYNKAISYLATVPKYRIQATEIAKEQGLLKKAKEKGKN--KKSKEEIRDEEENIIKNIIKSKIDIKGGYQKPQVRDLLLFQVILAPVHLCSYIAWYCRWIYNFNIKGKEYGEEERLYIIRKSMKMSQSQFDSLEDHQKEMFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTF 354          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Mouse
Match: Dnajc25 (DnaJ heat shock protein family (Hsp40) member C25 [Source:MGI Symbol;Acc:MGI:1919679])

HSP 1 Score: 151.754 bits (382), Expect = 4.296e-43
Identity = 118/237 (49.79%), Postives = 170/237 (71.73%), Query Frame = 2
Query:  338 MLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITF 1048
            MLD+P+E Y HYY YY RR APKVDV++VILV +  IS+ QY+  W++YN+A+ YL   PKYR++A +IAK +GLL +  +K +   KK+KEEI+  EEN+IK II  K+DIKGGY KP +  +L  Q+ L P  +  +I    RW+Y +NI  +EY +E+++ II+  M +   Q++SL+D +K+ + KRELWIK+N+EVY++E+E E K KLA DP +KRYRR++K  G G++TF
Sbjct:    1 MLDHPEEYYSHYYHYYSRRLAPKVDVRVVILVSVCAISMFQYFSWWNSYNKAISYLATVPKYRIQATEIAKEQGLLKKAKEKGK--NKKSKEEIRDEEENIIKNIIKSKIDIKGGYQKPQVRDLLLFQVILAPVHLCSYIAWYCRWIYNFNIKGKEYGEEERLYIIRKSMKMSQSQFDSLEDHQKEMFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTF 235          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Mouse
Match: Gm20503 (predicted gene 20503 [Source:MGI Symbol;Acc:MGI:5141968])

HSP 1 Score: 70.0922 bits (170), Expect = 5.327e-14
Identity = 38/91 (41.76%), Postives = 51/91 (56.04%), Query Frame = 2
Query:   98 AHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQR------TEETKSTAEIKFRQIANAYEILRDDEQRKEY-DYMLDN 349
            A + +EGLYCG  +CY++LGV+R   K +I R+YR LAR YHPDR R            +AE  F  +A AYE L+  +   E   Y + N
Sbjct:   35 AEALVEGLYCGTRDCYEVLGVSRSASKAEIARAYRQLARRYHPDRYRPEPGDGPGGAPPSAE-AFLLVATAYETLKVSQAAAELQQYCIQN 124          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Mouse
Match: Dnajc25 (DnaJ heat shock protein family (Hsp40) member C25 [Source:MGI Symbol;Acc:MGI:1919679])

HSP 1 Score: 67.781 bits (164), Expect = 4.098e-13
Identity = 35/78 (44.87%), Postives = 46/78 (58.97%), Query Frame = 2
Query:   98 AHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQR------TEETKSTAEIKFRQIANAYEILRDD 313
            A + +EGLYCG  +CY++LGV+R   K +I R+YR LAR YHPDR R            +AE  F  +A AYE L+  
Sbjct:   35 AEALVEGLYCGTRDCYEVLGVSRSASKAEIARAYRQLARRYHPDRYRPEPGDGPGGAPPSAE-AFLLVATAYETLKSS 111          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Mouse
Match: Dnajc25 (DnaJ heat shock protein family (Hsp40) member C25 [Source:MGI Symbol;Acc:MGI:1919679])

HSP 1 Score: 67.781 bits (164), Expect = 4.728e-13
Identity = 35/76 (46.05%), Postives = 46/76 (60.53%), Query Frame = 2
Query:   98 AHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQR------TEETKSTAEIKFRQIANAYEILR 307
            A + +EGLYCG  +CY++LGV+R   K +I R+YR LAR YHPDR R            +AE  F  +A AYE L+
Sbjct:   35 AEALVEGLYCGTRDCYEVLGVSRSASKAEIARAYRQLARRYHPDRYRPEPGDGPGGAPPSAE-AFLLVATAYETLK 109          
BLAST of DnaJ-like subfamily C member 25 vs. UniProt/SwissProt
Match: sp|Q58E03|DJC25_XENLA (DnaJ homolog subfamily C member 25 OS=Xenopus laevis OX=8355 GN=dnajc25 PE=2 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 1.584e-84
Identity = 156/341 (45.75%), Postives = 229/341 (67.16%), Query Frame = 2
Query:   56 LLCVTFILLGLVVLAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTE-------ETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITFGQE 1057
            +L V   +L L   A +  EGLYCG++ CYD+LGV+R+ +K  I R+YR LAR YHPDR R         ET+ +A+ KF  +A AYE L+D+E RK+YDYMLD+P+E Y HYY YY RR APKVDV+IVILV +  +SI QYY  WS+YNEA+ YL    KYR++A +IAK +GLL+   +K +N R K + + +  E           +   GGY KP ++ +L  QI LFPY++  +I   +RW+Y +NI  +EY +E+K+ +I+ YM +   Q+++L++  K+ + +++LWIK+N+EVYR+E+E E K K+A+DP +KRYRR++K  G G++TF  +
Sbjct:    6 VLLVALSVLFLSGRAGALTEGLYCGRQVCYDVLGVSRDANKGDIARAYRQLARKYHPDRYRPGDQLGPDGETRESAQEKFILVATAYETLKDEETRKDYDYMLDHPEEYYRHYYHYYSRRLAPKVDVRIVILVSVCAVSIFQYYSWWSSYNEAINYLATVTKYRIQAMEIAKQQGLLNRTKEKGKNRRSKEEIKSEEEEIIRDIIKNKIDIK--GGYQKPQIFDILLFQIILFPYYMFKYISWYVRWIYTFNIQGKEYGEEEKLYLIRKYMKMSQSQFDTLEEHRKNTFLEQKLWIKENYEVYRQEQEEETKKKMASDPRWKRYRRWMKNEGPGRLTFADD 344          
BLAST of DnaJ-like subfamily C member 25 vs. UniProt/SwissProt
Match: sp|Q5HZT9|DJC25_XENTR (DnaJ homolog subfamily C member 25 OS=Xenopus tropicalis OX=8364 GN=dnajc25 PE=2 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 9.691e-80
Identity = 162/327 (49.54%), Postives = 232/327 (70.95%), Query Frame = 2
Query:   98 AHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEE-------TKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITFGQE 1057
            A +  EGLYCG++ CYD+LGV+R+  K  I R+YR LAR YHPDR R  E       T+ +A+ KF  +A AYE L+D+E RK+YDYMLD+P+E Y HYY YY RR APKVDV+IVILV +  ISI QYY  WS+YNEA+ YL    KYR++A +IAK +GLL+   +K +N  +++KEEIK  EE +I+ II  K+DIKGGY KP ++ +L  QI LFPY+I  +I   + W+Y +NI  +EY +E+K+ +I+  M +   Q+++L++  K+ + +++LWIK+N+EVY+ E+E E K K+A+DP +KRYRR++K  G G++TF  +
Sbjct:   44 AGALTEGLYCGRQVCYDVLGVSRDASKGDIARAYRQLARKYHPDRYRPGEPPGPDGETRESAQEKFLLVATAYETLKDEETRKDYDYMLDHPEEYYRHYYHYYSRRLAPKVDVRIVILVSVCAISIFQYYSWWSSYNEAINYLATVTKYRIQAMEIAKQQGLLNRTKEKGKN--RRSKEEIKSEEEEIIRDIIKNKIDIKGGYQKPQIFDILLFQIILFPYYIFKYISWYVHWIYTFNIQGKEYGEEEKLYLIRRNMKMSQSQFDTLEEHRKNSFLEQKLWIKENYEVYKLEQEEEMKKKMASDPRWKRYRRWMKNEGPGRLTFADD 368          
BLAST of DnaJ-like subfamily C member 25 vs. UniProt/SwissProt
Match: sp|Q9VXT2|DJC25_DROME (DnaJ homolog subfamily C member 25 homolog OS=Drosophila melanogaster OX=7227 GN=CG7872 PE=2 SV=1)

HSP 1 Score: 241.506 bits (615), Expect = 9.378e-76
Identity = 153/319 (47.96%), Postives = 225/319 (70.53%), Query Frame = 2
Query:   92 VLAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITF 1048
             +A   +EGLYCGKENCYD+LGVTRE  K +I ++YR LAR YHPD  R  E K+ AE +F+ +A AYEILRD+E R +YDYMLDNPD  Y HYY+YYRRR APKVDV++VI+V+++++S+ QYY  W  Y+ A+KY    PKYR +A +IA+ E + +++ KK +N  + +K + +   E +I+++I EKMD+KGGYAKPTL+ VLW+Q+ + PY IL +I    +W + Y ++K+ Y +E K+ +I+ ++ +   Q+E+ +D   + Y   +LW ++NF  ++ E+E E K KLA +P YK YRR++K  G G+ITF
Sbjct:   16 TMALGLLEGLYCGKENCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESRTDYDYMLDNPDAYYAHYYRYYRRRVAPKVDVRVVIVVVLTIVSVIQYYSGWQRYDSAIKYFATVPKYRNQALEIARDE-IQEKIQKKGKN--RMSKNDQRDELERIIRRVIEEKMDVKGGYAKPTLWDVLWVQLIICPYTILSFIVWHAQWFWRYTVMKQPYGREQKLYLIRRHLGMGQHQFEAQEDKLIEEYLHLKLWKRENFVAWKAEQEEEMKKKLAENPRYKAYRRYMKNHGPGRITF 331          
BLAST of DnaJ-like subfamily C member 25 vs. UniProt/SwissProt
Match: sp|Q9H1X3|DJC25_HUMAN (DnaJ homolog subfamily C member 25 OS=Homo sapiens OX=9606 GN=DNAJC25 PE=1 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 6.053e-73
Identity = 162/324 (50.00%), Postives = 229/324 (70.68%), Query Frame = 2
Query:   98 AHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEE-------TKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITF 1048
            A + +EGLYCG  +CY++LGV+R   K +I R+YR LAR YHPDR R +        T  +AE  F  +A AYE L+D+E RK+YDYMLD+P+E Y HYY YY RR APKVDV++VILV +  IS+ Q++  W++YN+A+ YL   PKYR++A +IAK +GLL +  +K +N  KK+KEEI+  EEN+IK II  K+DIKGGY KP +  +L  QI L P+ +  +I    RW+Y +NI  +EY +E+++ II+  M +   Q++SL+D +K+ + KRELWIK+N+EVY++E+E E K KLA DP +KRYRR++K  G G++TF
Sbjct:   36 AGALVEGLYCGTRDCYEVLGVSRSAGKAEIARAYRQLARRYHPDRYRPQPGDEGPGRTPQSAEEAFLLVATAYETLKDEETRKDYDYMLDHPEEYYSHYYHYYSRRLAPKVDVRVVILVSVCAISVFQFFSWWNSYNKAISYLATVPKYRIQATEIAKQQGLLKKAKEKGKN--KKSKEEIRDEEENIIKNIIKSKIDIKGGYQKPQICDLLLFQIILAPFHLCSYIVWYCRWIYNFNIKGKEYGEEERLYIIRKSMKMSKSQFDSLEDHQKETFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTF 357          
BLAST of DnaJ-like subfamily C member 25 vs. UniProt/SwissProt
Match: sp|A2ALW5|DJC25_MOUSE (DnaJ homolog subfamily C member 25 OS=Mus musculus OX=10090 GN=Dnajc25 PE=1 SV=1)

HSP 1 Score: 231.106 bits (588), Expect = 2.487e-71
Identity = 162/323 (50.15%), Postives = 227/323 (70.28%), Query Frame = 2
Query:   98 AHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKS------TAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITF 1048
            A + +EGLYCG  +CY++LGV+R   K +I R+YR LAR YHPDR R E          +AE  F  +A AYE L+D+E RK+YDYMLD+P+E Y HYY YY RR APKVDV++VILV +  IS+ QY+  W++YN+A+ YL   PKYR++A +IAK +GLL +  +K +N  KK+KEEI+  EEN+IK II  K+DIKGGY KP +  +L  Q+ L P  +  +I    RW+Y +NI  +EY +E+++ II+  M +   Q++SL+D +K+ + KRELWIK+N+EVY++E+E E K KLA DP +KRYRR++K  G G++TF
Sbjct:   35 AEALVEGLYCGTRDCYEVLGVSRSASKAEIARAYRQLARRYHPDRYRPEPGDGPGGAPPSAE-AFLLVATAYETLKDEETRKDYDYMLDHPEEYYSHYYHYYSRRLAPKVDVRVVILVSVCAISMFQYFSWWNSYNKAISYLATVPKYRIQATEIAKEQGLLKKAKEKGKN--KKSKEEIRDEEENIIKNIIKSKIDIKGGYQKPQVRDLLLFQVILAPVHLCSYIAWYCRWIYNFNIKGKEYGEEERLYIIRKSMKMSQSQFDSLEDHQKEMFLKRELWIKENYEVYKQEQEEELKKKLANDPRWKRYRRWMKNEGPGRLTF 354          
BLAST of DnaJ-like subfamily C member 25 vs. TrEMBL
Match: A0A1I8G191 (J domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 2.376e-98
Identity = 188/346 (54.34%), Postives = 257/346 (74.28%), Query Frame = 2
Query:   71 FILLGLVVL------AHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDE----VNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITFGQEDVDMDYS 1078
            F+ +GL+          +QIEG+YCGKENCYD+LGVTR+DDK+ IM +YR LAR  HPDRQRTEE +  +E  F +IA AYEILRDDEQRKEYDYMLDNP+EMYYH+YQYY+R+Y+PKVDV++VI+VI++  SI QYY Q++NY++A+  L K+P+YR++AK+IAKSEGLLD       +KRENGRK TKEE+K  EE +I+ II+ KMDI+G Y KP++  VLW Q+ + P  +L WI   +RW+ L+ +LKREY   +K  +I+ YM L  L WE L +  ++    +ELWIK  + V+ +E+  + + ++A D  +K+ RR++++GG GQITFGQEDVDMD+S
Sbjct:    7 FVSVGLIFALVCCFQVDAQIEGIYCGKENCYDVLGVTRDDDKKTIMSTYRKLARKLHPDRQRTEEDRKKSEETFPRIAQAYEILRDDEQRKEYDYMLDNPEEMYYHFYQYYKRKYSPKVDVRVVIVVIVTAFSIFQYYSQYTNYHDAVNTLSKQPRYRMQAKEIAKSEGLLDSDGPGGKRKRENGRKLTKEEVKEKEEEVIRGIIMRKMDIRGSYEKPSIMNVLWFQLLMLPIRVLQWIYWALRWIVLFGLLKREYGPAEKEYLIRRYMGLSALAWEHLPEQRREQLLAKELWIKAKYVVFAEEEAEKMRQQMAEDTKHKKMRRYLRRGGPGQITFGQEDVDMDFS 352          
BLAST of DnaJ-like subfamily C member 25 vs. TrEMBL
Match: A0A3S1HWI6 (J domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_004708 PE=4 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 1.217e-91
Identity = 182/342 (53.22%), Postives = 241/342 (70.47%), Query Frame = 2
Query:   26 KFCFFLIDMQLLCVTFILLGLVVLAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITFG 1051
            + CFF++     C  F        AH+ IEGLYCG ENCYDILGVTR+  K ++ ++YR LA+ +HPD  +  + K  A   F +IANAYEILRD+EQR +YDYMLDNPDE Y HYY+YYR R APKVDV++VI V I++IS+ QYYG WSNYN AL YL K+ KYR++A +IAKSEGL+   NKKR+    K+KEEI+  EE  I+KII EKMDI+GGY+KP +  VLW+Q+ L PY    +I    RWV+ +NI +  Y  E+K+ II+ +M L   Q+++ +D E + Y ++ELWIK NF  ++++KE E K+KLA    YK YRR++KKGGAGQI+FG
Sbjct:   10 RICFFIL---WSCCLFT-------AHAYIEGLYCGLENCYDILGVTRDSSKSEVTKAYRKLAKKWHPDMHKKAKAKEEANQMFLKIANAYEILRDEEQRNDYDYMLDNPDEYYAHYYRYYRTRVAPKVDVRLVIAVTITVISVVQYYGAWSNYNSALNYLCKDQKYRIRATEIAKSEGLIS-ANKKRKG---KSKEEIREEEEATIRKIIEEKMDIRGGYSKPKVTDVLWVQLVLLPYHTALYIAWWARWVWRFNIKQEAYGDEEKLHIIRKFMGLSQAQFDAQEDHEIEEYLEQELWIKDNFTEWKQQKEEEMKSKLAESARYKMYRRYMKKGGAGQISFG 337          
BLAST of DnaJ-like subfamily C member 25 vs. TrEMBL
Match: A0A1Y1MTD1 (J domain-containing protein OS=Photinus pyralis OX=7054 GN=PPYR_14906 PE=4 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 1.124e-84
Identity = 170/332 (51.20%), Postives = 240/332 (72.29%), Query Frame = 2
Query:   65 VTFILLGLVVLAH-SQ---IEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITF 1048
            +  +L+ +V ++H SQ   +EGLYCGKENCYD+LGVTR   K +I RSYR LA+ YHPD  R  + K+ AE KF+ +ANAYEIL+D+E R +YDYMLDNPDE Y HYY+YYRRR APKVDV+IVI V IS+ISI QYY  W  Y  A+KY +  PKYR +A +IA+ +G L      ++ G+ K+  E K  +E++I+ +I EKMDIKG YAKPT + +LW+Q+ L PY ++ +I   + WV+ ++IL++ Y++++K+ II+ YMN+   Q++S++D EK  Y K +LWIKQN++V++KEKE   K +LA +  YK+YRR+IK  G G++TF
Sbjct:    5 IYILLISVVAISHLSQAQLLEGLYCGKENCYDVLGVTRASSKNEIARSYRQLAKKYHPDLHRDLKAKAEAEEKFKIVANAYEILKDEESRTDYDYMLDNPDEYYAHYYRYYRRRVAPKVDVRIVIFVTISIISIIQYYSAWQRYETAIKYFMTVPKYRNRALEIAQQQGFLGTDAGHKKRGKSKS--EQKEEQESIIRMVIEEKMDIKGAYAKPTFFDILWIQLILSPYTLVKYIYWYLSWVWNHSILRKPYTEDEKLYIIRKYMNMGQHQFDSIEDHEKAEYLKNQLWIKQNYKVWQKEKEETMKKQLAENSRYKQYRRYIKNHGVGRMTF 334          
BLAST of DnaJ-like subfamily C member 25 vs. TrEMBL
Match: V3Z5X4 (J domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_129609 PE=4 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 1.341e-83
Identity = 161/324 (49.69%), Postives = 226/324 (69.75%), Query Frame = 2
Query:   80 LGLVVLAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITFG 1051
               V   ++ I+GLYCG+ENCYDIL  TR+  K +I+++YR LAR +HPDR +TEE K  A  KF++I NAYEIL+DDEQR +Y+YMLDNPDE Y HY+ YY+ R APKVD++IVI V IS++S+ QY+G WSNYN A+ YL K+PKYR +A D A  E  L   + K ++ R K     K +EE +I+++I   MDI+GGY +P    VLW+QI   PY++L +I    +W + + I + EY +E+K+ +I+ YM   T QWE++D+ +K  Y  +ELW K NF+V++++++ E KAKLA    YK YRR++KKGG GQI+FG
Sbjct:    4 FACVFTVNAYIDGLYCGRENCYDILESTRDMTKNEIIKNYRKLARQWHPDRHKTEEGKKEAHEKFQKIGNAYEILKDDEQRVDYNYMLDNPDEYYSHYFYYYQHRLAPKVDIRIVIAVTISIVSVFQYFGAWSNYNAAIDYLCKDPKYRSRAIDTAMKENKLSNPSMKGKSRRVKI----KEDEEQIIREVIESNMDIRGGYQRPKYTDVLWIQIIFLPYYLLMYIVWWFQWTWKFTIKREEYGEEEKLYLIRKYMKCGTTQWEAIDEDDKLDYLDQELWKKDNFKVWKQQQDEEMKAKLAESARYKSYRRYMKKGGPGQISFG 323          
BLAST of DnaJ-like subfamily C member 25 vs. TrEMBL
Match: A0A1Y3BDE0 (DnaJ domain containing protein OS=Euroglyphus maynei OX=6958 GN=BLA29_005166 PE=4 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 1.449e-83
Identity = 174/347 (50.14%), Postives = 242/347 (69.74%), Query Frame = 2
Query:   50 MQLLCVTFILLGLVV----LAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVN---------KKRENGRK-KTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITF 1048
            M+L    FI++  +V      H+ +EGLYCG++NCYD+LG+TR   K++I RSYR+LAR +HPD  R +E K+ A  KF+ IA AYE+LRDDE R++YDYMLDNP+E Y+HYY+YYRR YAPKVDV+IVI+V I+LIS+ QYY   S Y EA+ Y V  PKYR++AKDIA  EG+   V          K+R  G K K KEE+K  E+  I+K+I +KM+I+G Y+KP+   +LW+Q+FL P +I+ +I    RW+Y ++I K      +K  +I+ +MNL   QW   D +E D Y + ELWI++NFE ++++K+ E +AKLA +P YKRYRR+++KGG GQITF
Sbjct:    1 MKLTLEVFIIITTIVNNLNFCHAFLEGLYCGQDNCYDVLGLTRGTSKEEISRSYRALARKWHPDLHRGDEAKAIATEKFQLIAQAYEVLRDDESRRDYDYMLDNPEEYYHHYYRYYRRIYAPKVDVRIVIVVTITLISVYQYYASNSRYKEAIDYFVTVPKYRIQAKDIAMDEGIWPTVTSTSDGKSRLKQRGPGNKQKLKEELKQEEDACIRKVIEDKMNIEGAYSKPSYKDILWVQLFLIPVFIVQYIYWYARWIYKFDIKKEPLGLVEKHYLIRKFMNLSEFQWAQKDPNEIDEYMREELWIRENFEPWKQKKDDEIRAKLAENPAYKRYRRYLRKGGPGQITF 347          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Cavefish
Match: dnajc25 (DnaJ heat shock protein family (Hsp40) member C25 [Source:NCBI gene;Acc:103044146])

HSP 1 Score: 256.144 bits (653), Expect = 3.363e-82
Identity = 159/317 (50.16%), Postives = 223/317 (70.35%), Query Frame = 2
Query:   98 AHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITF 1048
            A + IEGLYCG ++CYD+LGV R+  K +I R+YR LAR YHPDR + EE     + KF  IA AYE L+D++ R++YDYMLD+P+E Y HYY YYRRR APKVDV+IVILV +  ISI QYY  WS+Y+EA+ YL   PKYR++A ++AK +GLL+   +K +N R K   EI+  EE +I+ II  K+DIKGGY KP +  +L  +I LFPY++  ++     W+Y + +   EY +E+K+ II+  M +   Q++SLDD  +  + +R+LWIK+N+EVY++E+E E K K+A DP +KRYRR++K  G G+ITF
Sbjct:   29 AAALIEGLYCGSQSCYDVLGVGRDAAKAEIGRAYRQLARKYHPDRYQGEEGAEAGQQKFLLIATAYETLKDEDARRDYDYMLDHPEEYYSHYYTYYRRRLAPKVDVRIVILVTVCAISIFQYYSWWSSYSEAINYLTTVPKYRIQATELAKQQGLLNRTKEKGKNRRSKE--EIREEEEEIIRDIIKNKIDIKGGYQKPNISDILLFKIILFPYYMCTYVAWYCSWIYRFTVRGEEYGEEEKLYIIRKNMKMSQAQFDSLDDHLRQTFLERQLWIKENYEVYKQEQEEEMKMKMAMDPRWKRYRRWMKSEGPGRITF 343          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Cavefish
Match: dnajb9b (dnaJ homolog subfamily B member 9-like [Source:NCBI gene;Acc:103032122])

HSP 1 Score: 67.0106 bits (162), Expect = 2.142e-12
Identity = 33/81 (40.74%), Postives = 53/81 (65.43%), Query Frame = 2
Query:  110 IEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNP 352
            I  L   +E+ Y++LGVT++  + +I +++  LA  YHPD+ ++ +    AE KFR+IA AYE L D ++R+EYD M  +P
Sbjct:   17 ISELILAEEDYYEVLGVTKDASEHQIKKAFHKLAMKYHPDKNKSPD----AEAKFREIAEAYETLSDAKRRQEYDQMRSSP 93          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Cavefish
Match: dnajc3b (dnaJ homolog subfamily C member 3-like [Source:NCBI gene;Acc:103042161])

HSP 1 Score: 61.6178 bits (148), Expect = 5.273e-10
Identity = 33/75 (44.00%), Postives = 50/75 (66.67%), Query Frame = 2
Query:  131 KENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPD 355
            K + Y ILGV+R  +KQ+I+++YR LA+ +HPD  ++E  K  AE +F  IA+A E+L D E R+++D   D  D
Sbjct:  391 KRDYYKILGVSRSANKQEIIKAYRKLAQQWHPDNFQSESEKKEAEKRFIDIASAKEVLTDPEMRQKFDSGEDPLD 465          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Cavefish
Match: dnajc3b (dnaJ homolog subfamily C member 3-like [Source:NCBI gene;Acc:103042161])

HSP 1 Score: 61.6178 bits (148), Expect = 5.273e-10
Identity = 33/75 (44.00%), Postives = 50/75 (66.67%), Query Frame = 2
Query:  131 KENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPD 355
            K + Y ILGV+R  +KQ+I+++YR LA+ +HPD  ++E  K  AE +F  IA+A E+L D E R+++D   D  D
Sbjct:  391 KRDYYKILGVSRSANKQEIIKAYRKLAQQWHPDNFQSESEKKEAEKRFIDIASAKEVLTDPEMRQKFDSGEDPLD 465          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Cavefish
Match: dnajb2 (DnaJ heat shock protein family (Hsp40) member B2 [Source:NCBI gene;Acc:103038546])

HSP 1 Score: 57.3806 bits (137), Expect = 5.968e-10
Identity = 29/64 (45.31%), Postives = 42/64 (65.62%), Query Frame = 2
Query:  143 YDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
            YD+LGV+R   +  I ++YR LA  +HPD+    + K  AE KF++IA AYE+L D  +R+ YD
Sbjct:    5 YDVLGVSRSASQDDIKKAYRKLALRWHPDKN--PDNKEEAERKFKEIAEAYEVLSDRSKREAYD 66          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000796.1 (pep scaffold:Pmarinus_7.0:GL487111:2166:5165:-1 gene:ENSPMAG00000000730.1 transcript:ENSPMAT00000000796.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 8.785e-10
Identity = 26/64 (40.62%), Postives = 41/64 (64.06%), Query Frame = 2
Query:  143 YDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
            Y +LGV R   +  I ++Y++LAR +HPD+ R       AE +F +I  AYE+L ++E+R +YD
Sbjct:   39 YAVLGVARSAPQSDIKKAYKALAREWHPDKNR----DPNAEDRFVEITKAYEVLSNEEKRSQYD 98          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Sea Lamprey
Match: dnaja3b (DnaJ heat shock protein family (Hsp40) member A3b [Source:ZFIN;Acc:ZDB-GENE-040115-3])

HSP 1 Score: 55.0694 bits (131), Expect = 1.097e-8
Identity = 30/68 (44.12%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  131 KENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
            K++ Y ILGV ++  ++ I +SY  LA+ YHPD   T +    A+ KF ++A AYE+L DD +RK+YD
Sbjct:   11 KKDYYQILGVAKDVAQKDIKKSYYQLAKKYHPD---TNKDDPKAKEKFAELAEAYEVLSDDAKRKQYD 75          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Sea Lamprey
Match: dnajc1 (DnaJ (Hsp40) homolog, subfamily C, member 1 [Source:ZFIN;Acc:ZDB-GENE-061103-529])

HSP 1 Score: 53.9138 bits (128), Expect = 3.953e-8
Identity = 26/75 (34.67%), Postives = 45/75 (60.00%), Query Frame = 2
Query:  137 NCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDN--PD 355
            N YD+LGV +     +I ++Y  ++ + HPD+ +    +  AE  FRQ+   Y++L+D+++R  YD +L N  PD
Sbjct:   51 NFYDVLGVNQAAPPSEIRKAYHRMSLLLHPDKNK----QDNAETLFRQLVAIYDVLKDEDKRGRYDTVLQNGLPD 121          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Sea Lamprey
Match: dnaja1 (DnaJ heat shock protein family (Hsp40) member A1 [Source:ZFIN;Acc:ZDB-GENE-030131-2642])

HSP 1 Score: 50.8322 bits (120), Expect = 2.419e-7
Identity = 26/64 (40.62%), Postives = 38/64 (59.38%), Query Frame = 2
Query:  143 YDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
            YD+LGV       ++ ++YR LA  YHPD+   E        KF+QI+ AYE+L D ++R+ YD
Sbjct:    8 YDLLGVKPNSTADELKKAYRKLALKYHPDKNPNEGE------KFKQISQAYEVLSDAKKRELYD 65          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Sea Lamprey
Match: DNAJA4 (DnaJ heat shock protein family (Hsp40) member A4 [Source:HGNC Symbol;Acc:HGNC:14885])

HSP 1 Score: 48.9062 bits (115), Expect = 1.275e-6
Identity = 26/64 (40.62%), Postives = 38/64 (59.38%), Query Frame = 2
Query:  143 YDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
            YD LGV      +++ ++YR LA  YHPD+   E        KF+QI+ AYE+L D ++R+ YD
Sbjct:    8 YDTLGVNPNATHEELKKAYRKLALKYHPDKNPNEGE------KFKQISQAYEVLLDPKKRELYD 65          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Yeast
Match: XDJ1 (Chaperone with a role in facilitating mitochondrial protein import; ascomycete-specific member of the DnaJ-like family, closely related to Ydj1p; predicted to be C-terminally prenylated; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies [Source:SGD;Acc:S000004080])

HSP 1 Score: 66.2402 bits (160), Expect = 2.132e-12
Identity = 32/69 (46.38%), Postives = 46/69 (66.67%), Query Frame = 2
Query:  143 YDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDN 349
            YD+LGVTR+   Q+I  +YR LA  +HPD+   +++K   EIKF++I  AYEIL D E++  YD   D+
Sbjct:   11 YDVLGVTRDATVQEIKTAYRKLALKHHPDKYVDQDSKEVNEIKFKEITAAYEILSDPEKKSHYDLYGDD 79          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Yeast
Match: JEM1 (DnaJ-like chaperone required for nuclear membrane fusion during mating; localizes to the ER membrane; exhibits genetic interactions with KAR2 [Source:SGD;Acc:S000003609])

HSP 1 Score: 55.0694 bits (131), Expect = 1.138e-8
Identity = 30/79 (37.97%), Postives = 43/79 (54.43%), Query Frame = 2
Query:  122 YCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIK--FRQIANAYEILRDDEQRKEYDYMLDNP 352
            Y  K++ Y ILGV+     ++I ++Y +L + YHPD+ +         I     QI  AYE L DD++RKEYD    NP
Sbjct:  533 YDPKKDYYKILGVSPSASSKEIRKAYLNLTKKYHPDKIKANHNDKQESIHETMSQINEAYETLSDDDKRKEYDLSRSNP 611          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Yeast
Match: YDJ1 (Type I HSP40 co-chaperone; involved in regulation of HSP90 and HSP70 functions; acts as an adaptor that helps Rsp5p recognize cytosolic misfolded proteins for ubiquitination after heat shock; critical for determining cell size at Start as a function of growth rate; involved in protein translocation across membranes; member of the DnaJ family; chimeric protein in which human p58IPK J domain replaces yeast Ydj1p J domain can complement yeast ydj1 mutant [Source:SGD;Acc:S000005008])

HSP 1 Score: 51.2174 bits (121), Expect = 1.262e-7
Identity = 29/64 (45.31%), Postives = 38/64 (59.38%), Query Frame = 2
Query:  143 YDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
            YDILGV       +I ++YR  A  YHPD+  +EE    A  KF++ + AYEIL D E+R  YD
Sbjct:    8 YDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEE----AAEKFKEASAAYEILSDPEKRDIYD 67          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Yeast
Match: SIS1 (Type II HSP40 co-chaperone that interacts with the HSP70 protein Ssa1p; shuttles between cytosol and nucleus; mediates delivery of misfolded proteins into the nucleus for degradation; involved in proteasomal degradation of misfolded cytosolic proteins; protein abundance increases in response to DNA replication stress; polyQ aggregates sequester Sis1p and interfere with clearance of misfolded proteins; similar to bacterial DnaJ proteins and mammalian DnaJB1 [Source:SGD;Acc:S000004952])

HSP 1 Score: 50.8322 bits (120), Expect = 1.811e-7
Identity = 26/65 (40.00%), Postives = 43/65 (66.15%), Query Frame = 2
Query:  140 CYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
             YD+LGV+   ++Q++ + YR  A  YHPD+  T +T+     KF++I+ A+EIL D ++R+ YD
Sbjct:    7 LYDLLGVSPSANEQELKKGYRKAALKYHPDKP-TGDTE-----KFKEISEAFEILNDPQKREIYD 65          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Yeast
Match: APJ1 (Chaperone with a role in SUMO-mediated protein degradation; member of the DnaJ-like family; conserved across eukaryotes; overexpression interferes with propagation of the [Psi+] prion; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies; forms nuclear foci upon DNA replication stress [Source:SGD;Acc:S000005021])

HSP 1 Score: 50.8322 bits (120), Expect = 2.372e-7
Identity = 29/65 (44.62%), Postives = 39/65 (60.00%), Query Frame = 2
Query:  143 YDILGVTREDDKQKIMRSYRSLARIYHPDR-QRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
            YD L VT      +I ++YR+ A  YHPD+   TEE+K     KF++I  AYEIL+D+  R  YD
Sbjct:    8 YDSLNVTAAASTSEIKKAYRNAALKYHPDKNNHTEESKR----KFQEICQAYEILKDNRLRALYD 68          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Nematostella
Match: EDO44964 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU71])

HSP 1 Score: 167.548 bits (423), Expect = 1.178e-49
Identity = 117/253 (46.25%), Postives = 180/253 (71.15%), Query Frame = 2
Query:  308 DDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQ--YYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITFGQED 1060
            D EQR +YDYMLD+P+E Y HYY YYR R APKVDV+IV+ V I+++SI Q  Y   WS YNEA++Y +  PKYR KA   A  +GLL+ + K+     K++KEE+K  EE++++ ++   ++I+GG+ KP++  VLW++I LFPY ++ +I   +RW + + I   EY  E+K+ I++  M + + QWE+L++S+ +Y+FKRELW++ NFE Y++E+E E + KLA +  YK YRR++KKGG GQ+TF +++
Sbjct:    1 DPEQRNDYDYMLDHPEETYRHYYHYYRHRMAPKVDVRIVVAVSITIVSILQACYLHGWSRYNEAVQYALSVPKYRNKAIQKAHEDGLLNGLRKRG----KRSKEEMKEEEESILRSVVESSLEIRGGHCKPSIMDVLWIRIVLFPYTLVMYITWLVRWYWKFTIKGEEYGDEEKIYIMRKNMGISSTQWEALEESQVEYFFKRELWVQHNFEEYKEEQEEEMRQKLAQNNKYKAYRRYMKKGGPGQMTFMEDE 249          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Nematostella
Match: EDO35598 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL50])

HSP 1 Score: 137.117 bits (344), Expect = 2.415e-38
Identity = 103/254 (40.55%), Postives = 147/254 (57.87%), Query Frame = 2
Query:   35 FFLIDMQLLCVTFILLGLVVLAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFP---YWILCWIGRKIRWVYLY 787
            F ++ + +LC T ++ G V       EGLYCG ENCYD+LGVTRE +K                      + K  A  KF+ IA AYE L+D EQR +YDYMLD+P+E Y HYY YYR R APKVDV+           +  Y   WS YNEA++Y +  PKYR KA   A  +GLL+ + K+     K++KEE+K  EE++++ ++   ++I+GG+ KP++  VLW++I LF    Y +L ++  +   VYLY
Sbjct:    7 FLILSLAILCFTPVVQGFV-------EGLYCGTENCYDVLGVTRESNKG---------------------DDKENAIKKFQLIATAYETLKDPEQRNDYDYMLDHPEETYRHYYHYYRHRMAPKVDVR----------IVVAYLHGWSRYNEAVQYALSVPKYRNKAIQKAHEDGLLNGLRKR----GKRSKEEMKEEEESILRSVVESSLEIRGGHCKPSIMDVLWIRIVLFAPILYMVLDYLTTEEATVYLY 218          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Nematostella
Match: EDO40501 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6W8])

HSP 1 Score: 58.151 bits (139), Expect = 4.937e-10
Identity = 27/64 (42.19%), Postives = 44/64 (68.75%), Query Frame = 2
Query:  143 YDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
            Y ILGV R    ++I +++R +A  YHPD+ + ++    AE KFR++A AYE+L D+ +R++YD
Sbjct:   28 YQILGVPRNASDKQIKKAFRKMAVKYHPDKNKGKD----AEEKFREVAEAYEVLSDENKRRQYD 87          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Nematostella
Match: EDO28803 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5G0])

HSP 1 Score: 56.6102 bits (135), Expect = 1.160e-9
Identity = 29/77 (37.66%), Postives = 49/77 (63.64%), Query Frame = 2
Query:  131 KENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDN--PD 355
            K+N Y +LGV     + +I R+YR ++   HPDR + ++    AE+KFR++    E+L+D+++RK YD +L +  PD
Sbjct:   43 KDNFYQVLGVETTATQAEIRRAYRRISLQLHPDRNKEDD----AELKFRKLVAVAEVLKDEDKRKRYDTILRDGMPD 115          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Nematostella
Match: EDO33179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSZ8])

HSP 1 Score: 57.3806 bits (137), Expect = 1.676e-9
Identity = 28/69 (40.58%), Postives = 43/69 (62.32%), Query Frame = 2
Query:  128 GKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
              ++ YDILGV+R      + RSY+ LAR +HPD+        TA+ +F +I  AYEIL D+ +R+++D
Sbjct:   24 ASDDPYDILGVSRTASPNDVKRSYKKLARNWHPDKN----NDPTAQERFIKINQAYEILSDEGKRRDFD 88          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Medaka
Match: dnajc25 (DnaJ heat shock protein family (Hsp40) member C25 [Source:NCBI gene;Acc:101163593])

HSP 1 Score: 247.669 bits (631), Expect = 1.901e-78
Identity = 147/320 (45.94%), Postives = 212/320 (66.25%), Query Frame = 2
Query:   95 LAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEET--KSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITF 1048
            +A + +EGLYCG E CYD+LGVTRE  K +I R+YR LAR YHPDR + EE+  + +   KF  IA AYE L+D++ R++YDYMLD+P+E Y HYY YYRRR  PKVDV++VILV I  ISI QYY   S+YNEA+ YL+  PKYR++A +IAK +GL +   +K +N R K +   +  E           +   GGY KP L  +L  QI LFPY++  ++   + WVY + I + EY +++K+ II+  M +   Q++SL++S +  + ++ LWIK+ F+ Y++++E E K K+A DP  KRYRR++K  G G++TF
Sbjct:   62 VATALVEGLYCGTEVCYDVLGVTREASKAEIARAYRQLARRYHPDRYKPEESGPEESPHKKFLLIATAYETLKDEDSRRDYDYMLDHPEEYYQHYYAYYRRRLTPKVDVRVVILVTICAISIFQYYSWHSSYNEAINYLMTVPKYRIQATEIAKQQGLFNRPKEKGKNRRSKEEIREQEEEVIRDIIKNKIDIK--GGYQKPNLTDILLCQIVLFPYYLTSYVVWYVSWVYRFTICREEYGEQEKLYIIRRNMKMSQSQFDSLEESSRQTFLEKRLWIKERFQAYKRDQEEEMKVKMATDPRMKRYRRWMKNEGPGRLTF 379          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Medaka
Match: dnajc25 (DnaJ heat shock protein family (Hsp40) member C25 [Source:NCBI gene;Acc:101163593])

HSP 1 Score: 223.787 bits (569), Expect = 1.430e-69
Identity = 138/320 (43.12%), Postives = 202/320 (63.12%), Query Frame = 2
Query:   95 LAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEET--KSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTXXXXXXXXXXXXXXXXXXXXXXXGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILKREYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITF 1048
            +A + +EGLYCG E CYD+LGVTRE  K +I R+YR LAR YHPDR + EE+  + +   KF  IA AYE L+D++ R++YDYMLD+P+E Y HYY YYRRR  PKVDV++VILV I  ISI QYY   S+YNEA+ YL+  PKYR++A +IAK +GL +   +K +N R K +   +                                +I LFPY++  ++   + WVY + I + EY +++K+ II+  M +   Q++SL++S +  + ++ LWIK+ F+ Y++++E E K K+A DP  KRYRR++K  G G++TF
Sbjct:   62 VATALVEGLYCGTEVCYDVLGVTREASKAEIARAYRQLARRYHPDRYKPEESGPEESPHKKFLLIATAYETLKDEDSRRDYDYMLDHPEEYYQHYYAYYRRRLTPKVDVRVVILVTICAISIFQYYSWHSSYNEAINYLMTVPKYRIQATEIAKQQGLFNRPKEKGKNRRSKEEIREQE------------------------------EEIVLFPYYLTSYVVWYVSWVYRFTICREEYGEQEKLYIIRRNMKMSQSQFDSLEESSRQTFLEKRLWIKERFQAYKRDQEEEMKVKMATDPRMKRYRRWMKNEGPGRLTF 351          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Medaka
Match: dnajb9b (DnaJ heat shock protein family (Hsp40) member B9 [Source:NCBI gene;Acc:101166518])

HSP 1 Score: 66.6254 bits (161), Expect = 2.598e-12
Identity = 38/93 (40.86%), Postives = 55/93 (59.14%), Query Frame = 2
Query:   56 LLCVTFILLGLVVLAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
            LL V  +L+   +LA          K + YDILGV ++  ++ I +++  LA  YHPDR +  +    AE KFR+IA AYE L DD++R+EYD
Sbjct:    9 LLAVHVLLISEFILA----------KRDYYDILGVPKDATERHIKKAFHKLALKYHPDRNKGPD----AEAKFREIAEAYETLSDDKRRREYD 87          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Medaka
Match: zgc:122979 (dnaJ homolog subfamily B member 5 [Source:NCBI gene;Acc:101168635])

HSP 1 Score: 56.9954 bits (136), Expect = 1.253e-8
Identity = 28/64 (43.75%), Postives = 42/64 (65.62%), Query Frame = 2
Query:  143 YDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
            Y ILG+T E ++ +I ++YR LA  +HPD+     +   AE KF++IA AYE+L D ++R  YD
Sbjct:   58 YKILGITHESNEDEIKKAYRKLALKFHPDKN----SDPDAEDKFKEIAEAYEVLTDPQKRSVYD 117          
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Medaka
Match: dnajc3a (DnaJ heat shock protein family (Hsp40) member C3 [Source:NCBI gene;Acc:101166264])

HSP 1 Score: 55.0694 bits (131), Expect = 6.918e-8
Identity = 31/73 (42.47%), Postives = 45/73 (61.64%), Query Frame = 2
Query:  143 YDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLD--NPD 355
            Y ILGV R   K++I+++YR LA+ +HPD  +  + K  AE +F  IA A E+L D E R ++D   D  +PD
Sbjct:  406 YKILGVKRTAKKKEIIKAYRKLAQQWHPDNFQDPQEKKKAEKRFIDIAQAKEVLTDPEMRNKFDQGEDPMDPD 478          
BLAST of DnaJ-like subfamily C member 25 vs. Planmine SMEST
Match: SMESG000035521.1 (SMESG000035521.1)

HSP 1 Score: 320.857 bits (821), Expect = 2.722e-108
Identity = 184/186 (98.92%), Postives = 185/186 (99.46%), Query Frame = 2
Query:   50 MQLLCVTFILLGLVVLAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKT 607
            MQLLCVTFILLGLVVLA SQIEGLYCGKENCYDILGVTREDDKQKIMR+YRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMYYHYYQYYRRRYAPKVDVKIVILVIISLISIAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKT
Sbjct:    1 MQLLCVTFILLGLVVLAQSQIEGLYCGKENCYDILGVTREDDKQKIMRAYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMYYHYYQYYRRRYAPKVDVKIVILVIISLISIAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKT 186          

HSP 2 Score: 99.3673 bits (246), Expect = 2.032e-23
Identity = 47/47 (100.00%), Postives = 47/47 (100.00%), Query Frame = 2
Query:  938 VYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITFGQEDVDMDYS 1078
            VYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITFGQEDVDMDYS
Sbjct:  251 VYRKEKEIEQKAKLAADPNYKRYRRFIKKGGAGQITFGQEDVDMDYS 297          
BLAST of DnaJ-like subfamily C member 25 vs. Planmine SMEST
Match: SMESG000035521.1 (SMESG000035521.1)

HSP 1 Score: 320.087 bits (819), Expect = 4.682e-107
Identity = 184/186 (98.92%), Postives = 185/186 (99.46%), Query Frame = 2
Query:   50 MQLLCVTFILLGLVVLAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMXXXXXXXXXXXXAPKVDVKXXXXXXXXXXXXAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKT 607
            MQLLCVTFILLGLVVLA SQIEGLYCGKENCYDILGVTREDDKQKIMR+YRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMYYHYYQYYRRRYAPKVDVKIVILVIISLISIAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKT
Sbjct:    1 MQLLCVTFILLGLVVLAQSQIEGLYCGKENCYDILGVTREDDKQKIMRAYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDNPDEMYYHYYQYYRRRYAPKVDVKIVILVIISLISIAQYYGQWSNYNEALKYLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKT 186          
BLAST of DnaJ-like subfamily C member 25 vs. Planmine SMEST
Match: SMESG000027166.1 (SMESG000027166.1)

HSP 1 Score: 60.077 bits (144), Expect = 2.032e-10
Identity = 33/97 (34.02%), Postives = 55/97 (56.70%), Query Frame = 2
Query:   44 IDMQLLCVTFILLGLVVLAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
            ID  +  +  +LL  V ++          +E+ Y +LGV++  DK++I  +YR LA  YHPD+ + ++    A  KF +I  AYE+L D  +R++YD
Sbjct:    3 IDFSIFGIVILLLVTVAMS----------EEDYYKLLGVSKNADKKQIKSAYRKLAVKYHPDKNKEKD----AGEKFMKITKAYEVLSDQNKRQQYD 85          
BLAST of DnaJ-like subfamily C member 25 vs. Planmine SMEST
Match: SMESG000005351.1 (SMESG000005351.1)

HSP 1 Score: 57.7658 bits (138), Expect = 2.055e-9
Identity = 33/71 (46.48%), Postives = 44/71 (61.97%), Query Frame = 2
Query:  143 YDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD-YMLDNP 352
            YDIL V+   D  +I + YR LA  +HPD+    + K  AE KF++I+ AYE+L D E+RK YD Y  D P
Sbjct:    7 YDILNVSPNSDASEIKKQYRKLALRWHPDKN--PDNKIEAEKKFKEISEAYEVLSDAEKRKMYDMYGKDGP 75          
BLAST of DnaJ-like subfamily C member 25 vs. Planmine SMEST
Match: SMESG000009124.1 (SMESG000009124.1)

HSP 1 Score: 58.9214 bits (141), Expect = 2.772e-9
Identity = 32/68 (47.06%), Postives = 45/68 (66.18%), Query Frame = 2
Query:  131 KENCYDILGVTREDDKQKIMRSYRSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYD 334
            K N Y IL V R   K++I+++YR LA  YHPDR R  + K  AE KF  I++A ++L D E+R++YD
Sbjct:  380 KRNYYKILNVHRTATKKEILKAYRKLAAEYHPDRNRG-DNKKAAERKFIDISDAKDVLTDAEKRQKYD 446          
The following BLAST results are available for this feature:
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAJC251.261e-7350.00DnaJ heat shock protein family (Hsp40) member C25 ... [more]
DNAJC25-GNG104.502e-1642.39DNAJC25-GNG10 readthrough [Source:HGNC Symbol;Acc:... [more]
DNAJC255.964e-1645.12DnaJ heat shock protein family (Hsp40) member C25 ... [more]
DNAJC259.955e-1646.75DnaJ heat shock protein family (Hsp40) member C25 ... [more]
DNAJB91.898e-1045.45DnaJ heat shock protein family (Hsp40) member B9 [... [more]
back to top
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnj-21.635e-4838.58DnaJ homolog dnj-2 [Source:UniProtKB/Swiss-Prot;A... [more]
C47A4.16.665e-1531.01pep chromosome:WBcel235:IV:13715906:13716379:-1 ge... [more]
dnj-201.262e-1040.00DnaJ homolog dnj-20 [Source:UniProtKB/Swiss-Prot;... [more]
dnj-101.293e-1045.59DnaJ homolog dnj-10 [Source:UniProtKB/Swiss-Prot;... [more]
dnj-101.622e-1045.59DnaJ homolog dnj-10 [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG78729.355e-7747.96gene:FBgn0030658 transcript:FBtr0074046[more]
P58IPK4.371e-950.00gene:FBgn0037718 transcript:FBtr0082074[more]
CG85313.621e-838.81gene:FBgn0033918 transcript:FBtr0087538[more]
shv1.155e-733.33gene:FBgn0031256 transcript:FBtr0078060[more]
CG326401.953e-736.76gene:FBgn0052640 transcript:FBtr0073728[more]
back to top
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajc251.859e-7747.48DnaJ (Hsp40) homolog, subfamily C , member 25 [Sou... [more]
dnajc252.790e-7747.48DnaJ (Hsp40) homolog, subfamily C , member 25 [Sou... [more]
dnajb9b2.643e-1134.69DnaJ heat shock protein family (Hsp40) member B9b ... [more]
dnajb9b2.643e-1134.69DnaJ heat shock protein family (Hsp40) member B9b ... [more]
dnajb9a2.264e-1036.78DnaJ heat shock protein family (Hsp40) member B9a ... [more]
back to top
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajc251.829e-8049.54DnaJ heat shock protein family (Hsp40) member C25 ... [more]
dnajb91.922e-1138.04DnaJ heat shock protein family (Hsp40) member B9 [... [more]
dnajb26.373e-1050.00DnaJ heat shock protein family (Hsp40) member B2 [... [more]
naa161.432e-838.96N(alpha)-acetyltransferase 16, NatA auxiliary subu... [more]
naa161.470e-838.96N(alpha)-acetyltransferase 16, NatA auxiliary subu... [more]
back to top
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnajc253.556e-7250.15DnaJ heat shock protein family (Hsp40) member C25 ... [more]
Dnajc254.296e-4349.79DnaJ heat shock protein family (Hsp40) member C25 ... [more]
Gm205035.327e-1441.76predicted gene 20503 [Source:MGI Symbol;Acc:MGI:51... [more]
Dnajc254.098e-1344.87DnaJ heat shock protein family (Hsp40) member C25 ... [more]
Dnajc254.728e-1346.05DnaJ heat shock protein family (Hsp40) member C25 ... [more]
back to top
BLAST of DnaJ-like subfamily C member 25 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q58E03|DJC25_XENLA1.584e-8445.75DnaJ homolog subfamily C member 25 OS=Xenopus laev... [more]
sp|Q5HZT9|DJC25_XENTR9.691e-8049.54DnaJ homolog subfamily C member 25 OS=Xenopus trop... [more]
sp|Q9VXT2|DJC25_DROME9.378e-7647.96DnaJ homolog subfamily C member 25 homolog OS=Dros... [more]
sp|Q9H1X3|DJC25_HUMAN6.053e-7350.00DnaJ homolog subfamily C member 25 OS=Homo sapiens... [more]
sp|A2ALW5|DJC25_MOUSE2.487e-7150.15DnaJ homolog subfamily C member 25 OS=Mus musculus... [more]
back to top
BLAST of DnaJ-like subfamily C member 25 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8G1912.376e-9854.34J domain-containing protein OS=Macrostomum lignano... [more]
A0A3S1HWI61.217e-9153.22J domain-containing protein OS=Elysia chlorotica O... [more]
A0A1Y1MTD11.124e-8451.20J domain-containing protein OS=Photinus pyralis OX... [more]
V3Z5X41.341e-8349.69J domain-containing protein OS=Lottia gigantea OX=... [more]
A0A1Y3BDE01.449e-8350.14DnaJ domain containing protein OS=Euroglyphus mayn... [more]
back to top
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajc253.363e-8250.16DnaJ heat shock protein family (Hsp40) member C25 ... [more]
dnajb9b2.142e-1240.74dnaJ homolog subfamily B member 9-like [Source:NCB... [more]
dnajc3b5.273e-1044.00dnaJ homolog subfamily C member 3-like [Source:NCB... [more]
dnajc3b5.273e-1044.00dnaJ homolog subfamily C member 3-like [Source:NCB... [more]
dnajb25.968e-1045.31DnaJ heat shock protein family (Hsp40) member B2 [... [more]
back to top
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000796.18.785e-1040.63pep scaffold:Pmarinus_7.0:GL487111:2166:5165:-1 ge... [more]
dnaja3b1.097e-844.12DnaJ heat shock protein family (Hsp40) member A3b ... [more]
dnajc13.953e-834.67DnaJ (Hsp40) homolog, subfamily C, member 1 [Sourc... [more]
dnaja12.419e-740.63DnaJ heat shock protein family (Hsp40) member A1 [... [more]
DNAJA41.275e-640.63DnaJ heat shock protein family (Hsp40) member A4 [... [more]
back to top
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
XDJ12.132e-1246.38Chaperone with a role in facilitating mitochondria... [more]
JEM11.138e-837.97DnaJ-like chaperone required for nuclear membrane ... [more]
YDJ11.262e-745.31Type I HSP40 co-chaperone; involved in regulation ... [more]
SIS11.811e-740.00Type II HSP40 co-chaperone that interacts with the... [more]
APJ12.372e-744.62Chaperone with a role in SUMO-mediated protein deg... [more]
back to top
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO449641.178e-4946.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355982.415e-3840.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405014.937e-1042.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO288031.160e-937.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331791.676e-940.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DnaJ-like subfamily C member 25 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnajc251.901e-7845.94DnaJ heat shock protein family (Hsp40) member C25 ... [more]
dnajc251.430e-6943.13DnaJ heat shock protein family (Hsp40) member C25 ... [more]
dnajb9b2.598e-1240.86DnaJ heat shock protein family (Hsp40) member B9 [... [more]
zgc:1229791.253e-843.75dnaJ homolog subfamily B member 5 [Source:NCBI gen... [more]
dnajc3a6.918e-842.47DnaJ heat shock protein family (Hsp40) member C3 [... [more]
back to top
BLAST of DnaJ-like subfamily C member 25 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035521.12.722e-10898.92SMESG000035521.1[more]
SMESG000035521.14.682e-10798.92SMESG000035521.1[more]
SMESG000027166.12.032e-1034.02SMESG000027166.1[more]
SMESG000005351.12.055e-946.48SMESG000005351.1[more]
SMESG000009124.12.772e-947.06SMESG000009124.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021494 ID=SMED30021494|Name=DnaJ-like subfamily C member 25|organism=Schmidtea mediterranea sexual|type=transcript|length=1203bp
ATGAGATATCAATTATATTTATTTTAAATTCTGCTTTTTTCTAATTGACA
TGCAACTTTTGTGTGTCACCTTTATTTTGTTAGGCCTTGTCGTTTTAGCA
CACTCTCAAATTGAAGGCTTATATTGTGGAAAAGAAAATTGTTATGACAT
TCTTGGTGTTACCAGAGAAGATGACAAACAGAAAATTATGAGATCCTATA
GGAGTCTGGCAAGAATTTATCATCCTGATCGACAAAGAACTGAAGAAACT
AAAAGCACCGCTGAAATTAAATTTAGACAAATCGCTAATGCTTATGAAAT
TCTTAGAGATGATGAACAACGTAAAGAGTACGATTATATGCTTGACAATC
CAGATGAAATGTATTATCATTATTACCAATACTATCGTCGTCGATATGCT
CCGAAAGTTGACGTTAAAATTGTAATTTTAGTCATTATTTCTTTGATATC
AATTGCACAGTATTATGGACAATGGTCCAATTACAACGAAGCACTTAAAT
ATCTAGTTAAAGAACCAAAATATCGACTGAAAGCTAAAGATATCGCAAAA
TCAGAAGGACTTTTAGACGAAGTCAATAAAAAACGAGAAAATGGCAGGAA
AAAAACAAAAGAAGAAATAAAAATGAATGAGGAAAATTTAATAAAAAAAA
TTATTATTGAAAAAATGGATATTAAAGGCGGATATGCTAAACCAACCTTA
TATAAGGTATTATGGTTACAAATCTTTCTTTTTCCATACTGGATTCTTTG
TTGGATTGGTAGGAAAATTCGCTGGGTTTATTTGTACAATATCTTGAAAC
GCGAATACAGTAAAGAAGATAAAATGGATATTATAAAATACTACATGAAC
TTGCCAACTCTTCAATGGGAGTCATTAGATGACAGTGAAAAAGACTATTA
CTTCAAAAGGGAACTGTGGATAAAACAAAATTTTGAAGTTTATAGAAAAG
AAAAGGAAATTGAACAGAAAGCAAAATTAGCAGCAGATCCAAATTATAAA
AGATATCGCAGGTTTATTAAAAAGGGGGGAGCTGGACAAATAACATTTGG
CCAGGAAGATGTAGATATGGATTACAGTTAATAATAAGTCTTTTCAAATC
GTATCAAAATTTTTGGTATATTGTCTTAATATTTTTTAAAATGTTGCAAT
TTAAATAAAGTTTGACATTTTTGTTGAAATTGTTTTCAGGAATATAAACC
GAC
back to top

protein sequence of SMED30021494-orf-1

>SMED30021494-orf-1 ID=SMED30021494-orf-1|Name=SMED30021494-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=344bp
MQLLCVTFILLGLVVLAHSQIEGLYCGKENCYDILGVTREDDKQKIMRSY
RSLARIYHPDRQRTEETKSTAEIKFRQIANAYEILRDDEQRKEYDYMLDN
PDEMYYHYYQYYRRRYAPKVDVKIVILVIISLISIAQYYGQWSNYNEALK
YLVKEPKYRLKAKDIAKSEGLLDEVNKKRENGRKKTKEEIKMNEENLIKK
IIIEKMDIKGGYAKPTLYKVLWLQIFLFPYWILCWIGRKIRWVYLYNILK
REYSKEDKMDIIKYYMNLPTLQWESLDDSEKDYYFKRELWIKQNFEVYRK
EKEIEQKAKLAADPNYKRYRRFIKKGGAGQITFGQEDVDMDYS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036869J_dom_sf
IPR018253DnaJ_domain_CS
IPR001623DnaJ_domain
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001623DnaJ domainPRINTSPR00625JDOMAINcoord: 70..90
score: 42.42
coord: 50..65
score: 46.92
coord: 32..50
score: 39.24
IPR001623DnaJ domainSMARTSM00271dnaj_3coord: 29..90
e-value: 4.1E-21
score: 86.1
IPR001623DnaJ domainPFAMPF00226DnaJcoord: 30..95
e-value: 1.5E-20
score: 73.1
IPR001623DnaJ domainPROSITEPS50076DNAJ_2coord: 30..98
score: 19.095
IPR001623DnaJ domainCDDcd06257DnaJcoord: 30..87
e-value: 1.12333E-13
score: 62.9481
IPR036869Chaperone J-domain superfamilyGENE3DG3DSA:1.10.287.110coord: 16..122
e-value: 9.0E-30
score: 105.0
IPR036869Chaperone J-domain superfamilySUPERFAMILYSSF46565Chaperone J-domaincoord: 24..100
NoneNo IPR availablePANTHERPTHR44176FAMILY NOT NAMEDcoord: 3..321
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.906
NoneNo IPR availableTMHMMTMhelixcoord: 120..142
NoneNo IPR availableTMHMMTMhelixcoord: 220..237
IPR018253DnaJ domain, conserved sitePROSITEPS00636DNAJ_1coord: 75..94