E3 ubiquitin protein ligase-1

Overview
NameE3 ubiquitin protein ligase-1 (AFJ24730.1)
Smed IDSMED30021490
Length (bp)12996
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin protein ligase-1 (SMED30021490) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin protein ligase-1 (SMED30021490) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin protein ligase-1 (SMED30021490) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin protein ligase-1 (SMED30021490) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021490

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30021490SMESG000066158.1 SmedASXL_019626SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30021490SMESG000066158.1 SmedASXL_002936SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30021490SMESG000066165.1 SMESG000066158.1 SmedASXL_018403SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30021490SMESG000066165.1 SMESG000066158.1 dd_Smed_v4_9945_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021490SMESG000066165.1 SMESG000066158.1 dd_Smed_v4_9945_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30021490SMESG000066165.1 SMESG000066158.1 dd_Smed_v6_9945_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30021490SMESG000066165.1 OX_Smed_1.0.12108ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Human
Match: MYCBP2 (MYC binding protein 2 [Source:HGNC Symbol;Acc:HGNC:23386])

HSP 1 Score: 419.468 bits (1077), Expect = 9.935e-123
Identity = 343/1119 (30.65%), Postives = 517/1119 (46.20%), Query Frame = 1
Query: 9745 FSQSFINF-EKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPM-------DITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAI-----YQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKE--LQDNHDIESKS-----LHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAG---KSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSH-------------CDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENP-------NLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPS-DQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            F QS   F  +S VF  ++ +L+  DD        IS       ++  +       D+T +     +S      SL D +T+ FWES   + +    I +     C + I  +   VSV++D +RD+ N  VT+   +   A+      +QV ++  HIGW++  L   +          H++  E        G  N  +RVR VKVL   +  ST    +      +    + ETL+ F  +T+ +F    +   +   E++E  L  + + E K+     L + +V I+F     T  + +V +            HI+  I +E T++  + +       N N   ++      D +  + CF+LL+ VLALSG+  G +YL  Q  L++DL  LL+  S ++++QV   + R+   V+P  L  I+ GV      +    +    +  +  L +L +F G   K+L++Q+K+K  +                 LP    +S+               +  +  I +LI  ++  +   AW    +     I E  +A+ +  +   + +P        L+  +  L + +     +  + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + TK H R     +  + K         V+ HE C R K    +   D+ T+K ++   ++                         KP+   +E CRFC   S    +     C   +CQ  + +ACS K  PCGH C GV    KNE      C P      C +    S   LKQD DD+CMICFT+ LS  P I L +C H+ H  C RR ++  W G R++F F  CP CK KI H  L+DLL+P   L ++V+RKAL+RLE+EGL  S  +          P  +A+++Y YY+CYKC+ +Y+GGEARC+ +                  DP  EL C ACSDV++A++CPKH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct:   71 FKQSDHQFLHQSNVFHHINNILSKSDDGDSEESFSISIQSGFEAMSQELCIVMCLKDLTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKNITIN----CVKGI--NARYVSVHVDNSRDLGN-KVTSMTFLTGKAVEDLCRIKQVDLDSRHIGWVTSELPGGDN---------HIIKIE------LKGPEN-TLRVRQVKVLGWKDGESTKIAGQISASVAQQRNCEAETLRVFRLITSQVFGKLISGDAEPTPEQEEKALLSSPEGEEKATSDADLKEHMVGIIFSRSKLTNLQKQVCA------------HIVQAIRMEATRVREEWEHAISSKENANSQPND-----EDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPSRLASII-GVKSLPPADISDIIHSTEKGDWNKLGILDMFLGCIAKALTVQLKAKGTTITGTAGTTVGKGVTTVTLPMIFNSSYLRRGESHWWMKGSTPTQISEIIIKLIKDMAAGHLSEAWSRVTKN---AIAETIIALTKMEE--EFRSPVRCIATTRLWLALASLCVLDQ----DHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNVCGN------------------LCTDCDRFLHLHRRTKTHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFREHT-----------------------GKPTTSSSEACRFCGSRSGTELSAVGSVCSDADCQEYAKIACS-KTHPCGHPCGGV----KNEEH----CLP------CLHGCDKSATSLKQDADDMCMICFTEALSAAPAIQL-DCSHIFHLQCCRRVLENRWLGPRITFGFISCPICKNKINHIVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITTPGVRFYNDPAGYAMNRYAYYVCYKCRKAYFGGEARCDAE-----------AGRGDDYDP-RELICGACSDVSRAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSIPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF 1061          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Human
Match: MYCBP2 (MYC binding protein 2 [Source:HGNC Symbol;Acc:HGNC:23386])

HSP 1 Score: 422.55 bits (1085), Expect = 4.235e-117
Identity = 376/1279 (29.40%), Postives = 579/1279 (45.27%), Query Frame = 1
Query: 9331 MRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLL--------EKHKSIDKSNKPQISLIEEKNLKVYSQQLWAV---GSAV------FYRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINF-EKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPM-------DITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAI-----YQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKE--LQDNHDIESK--------SLHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGV--IHPNEFENPQNVKIKLEKPFIPLNLLIIFAG---KSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSH-------------CDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENP-------NLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPS-DQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + F + +  +  L +A++ +LR      ++ + + WLL NV   +SL  ++W     L        E+    +K++K      +EK+ +V    L  +   G A       F+R+L  I               L +M ++  SL          F QS   F  +S VF  ++ +L+  DD        IS       ++  +       D+T +     +S      SL D +T+ FWES   + +    I +     C + I  +   VSV++D +RD+ N  VT+   +   A+      +QV ++  HIGW++  L   +          H++  E        G  N  +RVR VKVL   +  ST    +      +    + ETL+ F  +T+ +F    +   +   E++E  L  + + E K         L + +V I+F     T  + +V +            HI+  I +E T++  + +       N N   ++      D +  + CF+LL+ VLALSG+  G +YL  Q  L++DL  LL+  S ++++QV   + R+   V+P  L  I+ GV  + P +  +  +   K +  +  L +L +F G   K+L++Q+K+K  +                 LP    +S+               +  +  I +LI  ++  +   AW    +     I E  +A+ +  +   + +P        L+  +  L + +     +  + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + TK H R     +  + K         V+ HE C R K    +   D+ T+K ++   ++                         KP+   +E CRFC   S    +     C   +CQ  + +ACS K  PCGH C GV    KNE      C P      C +    S   LKQD DD+CMICFT+ LS  P I L +C H+ H  C RR ++  W G R++F F  CP CK KI H  L+DLL+P   L ++V+RKAL+RLE+EGL  S  +          P  +A+++Y YY+CYKC+ +Y+GGEARC+ +                  DP  EL C ACSDV++A++CPKH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct: 3544 LAFVIQHHDLEGLEIAMKQALRKSACRVFAMEAFNWLLCNVIQTTSLHDILWHFVASLTPAPVEPEEEEDEENKTSKENSE--QEKDTRVCEHPLSDIVIAGEAAHPLPHTFHRLLQTISDLMMSLPSGS---SLQQMALRCWSL---------KFKQSDHQFLHQSNVFHHINNILSKSDDGDSEESFSISIQSGFEAMSQELCIVMCLKDLTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKNITIN----CVKGI--NARYVSVHVDNSRDLGN-KVTSMTFLTGKAVEDLCRIKQVDLDSRHIGWVTSELPGGDN---------HIIKIE------LKGPEN-TLRVRQVKVLGWKDGESTKIAGQISASVAQQRNCEAETLRVFRLITSQVFGKLISGDAEPTPEQEEKALLSSPEGEEKVYNATSDADLKEHMVGIIFSRSKLTNLQKQVCA------------HIVQAIRMEATRVREEWEHAISSKENANSQPND-----EDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPSRLASII-GVKSLPPADISDIIHSTEKGD--WNKLGILDMFLGCIAKALTVQLKAKGTTITGTAGTTVGKGVTTVTLPMIFNSSYLRRGESHWWMKGSTPTQISEIIIKLIKDMAAGHLSEAWSRVTKN---AIAETIIALTKMEE--EFRSPVRCIATTRLWLALASLCVLDQ----DHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNVCG------------------NLCTDCDRFLHLHRRTKTHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFREHT-----------------------GKPTTSSSEACRFCGSRSGTELSAVGSVCSDADCQEYAKIACS-KTHPCGHPCGGV----KNEEH----CLP------CLHGCDKSATSLKQDADDMCMICFTEALSAAPAIQL-DCSHIFHLQCCRRVLENRWLGPRITFGFISCPICKNKINHIVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITTPGVRFYNDPAGYAMNRYAYYVCYKCRKAYFGGEARCDAE-----------AGRGDDYDP-RELICGACSDVSRAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSIPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF 4678          

HSP 2 Score: 171.785 bits (434), Expect = 2.849e-41
Identity = 243/1090 (22.29%), Postives = 438/1090 (40.18%), Query Frame = 1
Query: 2098 LRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVV-PIQCKSVRITTGSFSTGILSQNGKVFIFGN----KITSPQIIDLISNPNDLTDNLQPIFFNFSTNNYKKQIIFCILKQNIFYMKRKPLTLSTHRKSYHQDQFKFLAKDNTILL---TLDEQ---RGLLINISSGTIKIMPDYDEGNFSSLMNSYFDPRYSVLWSIDSGHGSKK---FTVKYSKSNIFQSDNFQDKFDQL---IDLPDDISFSSQRYRIALNVL------VSAEKLLLKKYADPQNNNQIKTVDSNKEIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMP----DIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYPFNGKFNELCHLEETLVKIPSLGYSKDTESQETSVVIGDFRIIVRNIFLE----CKICHYLQSIKSTYGAESLIYAECWKLFTEDLIPVYKETFEHSFHAFYPEIEDQRFTLQEAL----LKVYEFCFNKSTDTLCNYGKIMFLTSLLTAINSANEGFLIFTHKDNSVTRSGENKINGENN--FAHRFPLLREYMRTIWKPSTPCSSDILASTSTMIHCLLAIITLDIKTAYKTCKQINSSSTTENDVSEKKLFQQEMTNLINASHQILTNITRLLVDQLN--HSAKTPAFRMSQVNSTNSKQNGHNNNQTYLEDIILTTQSRFKRVVWLDKSAENSRQKFVEQAINVAEQEIEDVICFAINKNTYQFINGFEVVGDNVIYLEGIKVYCSNFTESRCLAYIYRIKNFQEGIREKWELIPMEYEWKNEEQDLIASDLIFKRKLKLEESYRYAVKVFLIAANNKKTLIGQNPVSKLGTRFGYHFNLYETKLRTTANQNSRQGIIFSLLY 5250
            LR  Q+SCG +H+V+L  NGDVY+FG  +  QLG G ++++  P +V  +   S ++T GS  T +L  +G+VF FG+    ++  P I+D+         N +P       + Y ++  +     +  +++     +++H  +  +      A  + I L   ++ E    + LLIN   G+ K   D ++ +         DP Y V+W       +++   +    + + +  + + Q +   L   + LP      + R   AL++L       + + L +   +  +    +  V S ++   V RF      W YS ++ ++I+FS    I + G+GL+ G GE T  IK++E  G D             ++T      L  ETD V   +   ++   +M   P++L +   YV  A ++G S+D G HG++ I TD GV F+FK SK S+NGT V  GQIP++ Y  R+P       K K+   +  + +  +      +  +S+    S +++L+W +T L     EL  L+      T     L  LE L+      T  L+++R +   +YP                 + + G +   E+ + +  IG  R ++R I  E    C +   L +    Y ++ L          E ++     TF   FH+FYP    Q   L + L      + E  F  S+  L     +  + S L   +          +    + RS   +++ EN+    HRFPLL  +M  + +     S   + S   ++  +L I+ L ++ + +   ++ SS    N          E+T     S           VD LN  HS K  A R ++ +   S   G+ +                                              D ICF+++K     + GF V G   I+   ++V   +   +    + +R  +         EL+   Y   +   D+  +++   + + L+E+ +YAV+   +     +T  G   ++ +    G  F      L +     +R G I  +LY
Sbjct:  940 LRAVQVSCGFHHSVVLMENGDVYTFGYGQHGQLGHGDVNSRGCPTLVQALPGPSTQVTAGSNHTAVLLMDGQVFTFGSFSKGQLGRP-ILDVPYW------NAKPAPMPNIGSKYGRKATWIGASGDQTFLRIDEALINSHVLATSE----IFASKHIIGLVPASISEPPPFKCLLINKVDGSCKTFNDSEQEDLQGF-GVCLDPVYDVIWRFRPN--TRELWCYNAVVADARLPSAADMQSRCSILSPELALPTGSRALTTRSHAALHILGCLDTLAAMQDLKMGVASTEEETQAVMKVYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFSADTDILLGGLGLFGGRGEYTAKIKLFE-LGPDGG----------DHETDGD---LLAETD-VLAYDCAAREKYAMMFDEPVLLQAGWWYVAWARVSGPSSDCGSHGQASITTDDGVVFQFKSSKKSNNGTDVNAGQIPQLLY--RLPTSDGSASKGKQQTSEPVHILKRS-----FARTVSVECFESLLSILHWSWTTLVLGVEELRGLKGFQFTAT-----LLDLERLRFVG---TCCLRLLRVYTCEIYP-----------------VSATGKAVVEETSKLAECIGKTRTLLRKILSEGVDHCMV--KLDNDPQGYLSQPLS-------LLEAVLQECHNTFTACFHSFYPTPALQWACLCDLLNCLDQDIQEANFKTSSSRL-----LAAVMSALCHTSVKLTSIFPIAYDGEVLLRSIVKQVSTENDSTLVHRFPLLVAHMEKLSQSEENISG--MTSFREVLEKMLVIVVLPVRNSLRRENELFSSHLVSNTCGLLASIVSELTASALGSE----------VDGLNSLHSVKASANRFTKTSQGRSWNTGNGS---------------------------------------------PDAICFSVDKPGIVVV-GFSVYGGGGIHEYELEVLVDDSEHAGDSTHSHRWTSL--------ELVKGTYTTDDSPSDI--AEIRLDKVVPLKENVKYAVR---LRNYGSRTANGDGGMTTVQCPDGVTFTFSTCSLSSNGTNQTR-GQIPQILY 1882          

HSP 3 Score: 170.629 bits (431), Expect = 6.751e-41
Identity = 169/630 (26.83%), Postives = 260/630 (41.27%), Query Frame = 1
Query: 5575 YFTIIESNHPYEQAKLLHNTIKFPDSVDAISITFDGHCVTAQPEDFLVVKARTNTANGNQTENKWKIIFKNLSNII--------SDWPKKAVIIQGNEIAIEFHTASLY-EESLESTYGFKCSIVGH--CSKIDAFIELLENALTYLASRCATSL------LEFRKKSKVIKLLHETNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSC--SSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQVTSQMSNIEV-LFNYNHK---------------GNNPFINI----NEKLFGGHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIRAAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNKDKND-KP-KYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLK--EHLNKIFLTP 7335
            ++ +IES HPY+ A ++H  + FP+ V  ++I FD  C TAQ ED L +     T   +    K   + +NL++ I        S WP   +++ GNE      TAS Y ++   S YGFKC  +G+      D  +  LE  L  L   CA +L      L    + +    + E   LQ C+ +  IL +GL+LS  PT+ + L  +    I S + +F+  F+         +C   S   +L++WLQ                   P  Y D  K    T+++ N+          + ++  DQY + V      +EV     + K                 +P +       +  +GG   P   V +E  I+ +  Y +ITMMK YE +SFEE+R A        S+ +  R +  + ++  +W P A G Y L +TID I             +ID      VK+ P   I   T+  K K++ +P K   F  K S+GLR+RS PS  S  +GI+  N  + + +E+  ++ VW+RL                              N ETI                   KK V  N+  +TE WCL   +HL K  L P
Sbjct: 2019 HYAVIESEHPYKPACVMHYKVTFPECVRWMTIEFDPQCGTAQSEDVLRLLIPVRTVQNSGYGPKLTSVHENLNSWIELKKFSGSSGWPTMVLVLPGNEALFSLETASDYVKDDKASFYGFKCFAIGYEFSPGPDEGVIQLEKELANLGGVCAAALMKKDLALPIGNELEEDLEILEEAALQVCKTHSGILGKGLALSHSPTILEALEGNLPLQIQSNEQSFLDDFI---------ACVPGSSGGRLARWLQ-------------------PDSYADPQK----TSLILNKDDIRCGWPTTITVQTKDQYGDVVHVPNMKVEVKAVPVSQKKMSLQQDQAKKPQRIPGSPAVTAASSNTDMTYGGLASPKLDVSYEPMIVKEARYIAITMMKVYENYSFEELRFASPTPKR-PSENMLIRVN-NDGTYCANWTPGAIGLYTLHVTIDGI-------------EIDAGLEVKVKDPPKGMIPPGTQLVKPKSEPQPNKVRKFVAKDSAGLRIRSHPSLQSEQIGIVKVNGTITFIDEIHNDDGVWLRL------------------------------NDETI-------------------KKYVP-NMNGYTEAWCLSFNQHLGKSLLVP 2551          

HSP 4 Score: 111.694 bits (278), Expect = 3.451e-23
Identity = 134/591 (22.67%), Postives = 252/591 (42.64%), Query Frame = 1
Query:  247 KTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKKC-----------SDW-SNRNQEIPVSEQFCLINQLPDNVTSESLISNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELA--KYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKITNFHGFPSTPGWKYYLFANYTKLGCCLINEDETYSEQLFMKLFKLNSEKFLVEECEKSID---MTQHLILKFEIEQ-----SKIFSNPSTLIETCPSLSLACEVLNLEEFCVVRNQSGEIFY----KDIDNVERNNNVENWTRLLYTDYVAAKFHKLIGGIDNKFICAISDDG--LWRININRHSQPRTLCLDRLMPNSRFISKTWASG------SCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            K PKI+ + L  +++ I++T  S+P +C + LQ++L  L+  QP    SE  ++++ LF+LLL I             RS  M                           N S  ++L  ++ ACLFS+  + G     L A++ +L  NG       IQ P ++  L++             DW SN  ++  +  ++ L     D      L ++G +L+ L   GL KIG+G++G+++G +Y +   +   K    W+G  +   LL+  +   S      +T  +I+ + L+ DG V L   +  G       +  LF +   +     + D+ +     +++F  ++E  L +E +  +    +    I  F++E+     S  F   S ++                EF +++  +G+I+Y    + +   +   +   W  L  T   + K      G D      +++DG   +  + ++     +    R     +        G      +C+  + +++SK+G++    KD+I+S S+     L  + VTQ+++GK+H   L +NG + TFGVNN  QCG
Sbjct:  195 KLPKIIEVGLCEVFELIKETRFSHPSLCLRSLQALLNVLQGQQPEGLQSEPPEVLESLFQLLLEITV-----------RSTGM---------------------------NDSTGQSLTALSCACLFSLVASWGETGRTLQAISAILTNNGS-HACQTIQVPTILNSLQRSVQAVLVGKIQIQDWFSNGIKKAALMHKWPLKEISVDEDDQCLLQNDGFFLYLLCKDGLYKIGSGYSGTVRGHIYNSTSRIRNRKEKKSWLGY-AQGYLLYRDVNNHS------MTAIRISPETLEQDGTVMLPDCHTEG-------QNILFTDGEYINQIAASRDDGF----VVRIFATSTEPVLQQELQLKLARKCLHACGISLFDLEKDLHIISTGFDEESAILGAG------------REFALMKTANGKIYYTGKYQSLGIKQGGPSAGKWVELPITK--SPKIVHFSVGHDGSHALLVAEDGSIFFTGSASKGEDGESTKSRRQSKPYKPKKIIKMEGKIVVYTACNNGSSSVISKDGELYMFGKDAIYSDSSSLVTDLKGHFVTQVAMGKAHTCVLMKNGEVWTFGVNNKGQCG 714          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Human
Match: MYCBP2 (MYC binding protein 2 [Source:HGNC Symbol;Acc:HGNC:23386])

HSP 1 Score: 421.779 bits (1083), Expect = 5.790e-117
Identity = 376/1279 (29.40%), Postives = 579/1279 (45.27%), Query Frame = 1
Query: 9331 MRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLL--------EKHKSIDKSNKPQISLIEEKNLKVYSQQLWAV---GSAV------FYRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINF-EKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPM-------DITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAI-----YQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKE--LQDNHDIESK--------SLHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGV--IHPNEFENPQNVKIKLEKPFIPLNLLIIFAG---KSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSH-------------CDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENP-------NLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPS-DQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + F + +  +  L +A++ +LR      ++ + + WLL NV   +SL  ++W     L        E+    +K++K      +EK+ +V    L  +   G A       F+R+L  I               L +M ++  SL          F QS   F  +S VF  ++ +L+  DD        IS       ++  +       D+T +     +S      SL D +T+ FWES   + +    I +     C + I  +   VSV++D +RD+ N  VT+   +   A+      +QV ++  HIGW++  L   +          H++  E        G  N  +RVR VKVL   +  ST    +      +    + ETL+ F  +T+ +F    +   +   E++E  L  + + E K         L + +V I+F     T  + +V +            HI+  I +E T++  + +       N N   ++      D +  + CF+LL+ VLALSG+  G +YL  Q  L++DL  LL+  S ++++QV   + R+   V+P  L  I+ GV  + P +  +  +   K +  +  L +L +F G   K+L++Q+K+K  +                 LP    +S+               +  +  I +LI  ++  +   AW    +     I E  +A+ +  +   + +P        L+  +  L + +     +  + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + TK H R     +  + K         V+ HE C R K    +   D+ T+K ++   ++                         KP+   +E CRFC   S    +     C   +CQ  + +ACS K  PCGH C GV    KNE      C P      C +    S   LKQD DD+CMICFT+ LS  P I L+ C H+ H  C RR ++  W G R++F F  CP CK KI H  L+DLL+P   L ++V+RKAL+RLE+EGL  S  +          P  +A+++Y YY+CYKC+ +Y+GGEARC+ +                  DP  EL C ACSDV++A++CPKH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct: 3506 LAFVIQHHDLEGLEIAMKQALRKSACRVFAMEAFNWLLCNVIQTTSLHDILWHFVASLTPAPVEPEEEEDEENKTSKENSE--QEKDTRVCEHPLSDIVIAGEAAHPLPHTFHRLLQTISDLMMSLPSGS---SLQQMALRCWSL---------KFKQSDHQFLHQSNVFHHINNILSKSDDGDSEESFSISIQSGFEAMSQELCIVMCLKDLTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKNITIN----CVKGI--NARYVSVHVDNSRDLGN-KVTSMTFLTGKAVEDLCRIKQVDLDSRHIGWVTSELPGGDN---------HIIKIE------LKGPEN-TLRVRQVKVLGWKDGESTKIAGQISASVAQQRNCEAETLRVFRLITSQVFGKLISGDAEPTPEQEEKALLSSPEGEEKVYNATSDADLKEHMVGIIFSRSKLTNLQKQVCA------------HIVQAIRMEATRVREEWEHAISSKENANSQPND-----EDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPSRLASII-GVKSLPPADISDIIHSTEKGD--WNKLGILDMFLGCIAKALTVQLKAKGTTITGTAGTTVGKGVTTVTLPMIFNSSYLRRGESHWWMKGSTPTQISEIIIKLIKDMAAGHLSEAWSRVTKN---AIAETIIALTKMEE--EFRSPVRCIATTRLWLALASLCVLDQ----DHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNVCG------------------NLCTDCDRFLHLHRRTKTHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFREHT-----------------------GKPTTSSSEACRFCGSRSGTELSAVGSVCSDADCQEYAKIACS-KTHPCGHPCGGV----KNEEH----CLP------CLHGCDKSATSLKQDADDMCMICFTEALSAAPAIQLD-CSHIFHLQCCRRVLENRWLGPRITFGFISCPICKNKINHIVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITTPGVRFYNDPAGYAMNRYAYYVCYKCRKAYFGGEARCDAE-----------AGRGDDYDP-RELICGACSDVSRAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSIPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF 4640          

HSP 2 Score: 171.785 bits (434), Expect = 2.941e-41
Identity = 243/1090 (22.29%), Postives = 438/1090 (40.18%), Query Frame = 1
Query: 2098 LRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVV-PIQCKSVRITTGSFSTGILSQNGKVFIFGN----KITSPQIIDLISNPNDLTDNLQPIFFNFSTNNYKKQIIFCILKQNIFYMKRKPLTLSTHRKSYHQDQFKFLAKDNTILL---TLDEQ---RGLLINISSGTIKIMPDYDEGNFSSLMNSYFDPRYSVLWSIDSGHGSKK---FTVKYSKSNIFQSDNFQDKFDQL---IDLPDDISFSSQRYRIALNVL------VSAEKLLLKKYADPQNNNQIKTVDSNKEIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMP----DIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYPFNGKFNELCHLEETLVKIPSLGYSKDTESQETSVVIGDFRIIVRNIFLE----CKICHYLQSIKSTYGAESLIYAECWKLFTEDLIPVYKETFEHSFHAFYPEIEDQRFTLQEAL----LKVYEFCFNKSTDTLCNYGKIMFLTSLLTAINSANEGFLIFTHKDNSVTRSGENKINGENN--FAHRFPLLREYMRTIWKPSTPCSSDILASTSTMIHCLLAIITLDIKTAYKTCKQINSSSTTENDVSEKKLFQQEMTNLINASHQILTNITRLLVDQLN--HSAKTPAFRMSQVNSTNSKQNGHNNNQTYLEDIILTTQSRFKRVVWLDKSAENSRQKFVEQAINVAEQEIEDVICFAINKNTYQFINGFEVVGDNVIYLEGIKVYCSNFTESRCLAYIYRIKNFQEGIREKWELIPMEYEWKNEEQDLIASDLIFKRKLKLEESYRYAVKVFLIAANNKKTLIGQNPVSKLGTRFGYHFNLYETKLRTTANQNSRQGIIFSLLY 5250
            LR  Q+SCG +H+V+L  NGDVY+FG  +  QLG G ++++  P +V  +   S ++T GS  T +L  +G+VF FG+    ++  P I+D+         N +P       + Y ++  +     +  +++     +++H  +  +      A  + I L   ++ E    + LLIN   G+ K   D ++ +         DP Y V+W       +++   +    + + +  + + Q +   L   + LP      + R   AL++L       + + L +   +  +    +  V S ++   V RF      W YS ++ ++I+FS    I + G+GL+ G GE T  IK++E  G D             ++T      L  ETD V   +   ++   +M   P++L +   YV  A ++G S+D G HG++ I TD GV F+FK SK S+NGT V  GQIP++ Y  R+P       K K+   +  + +  +      +  +S+    S +++L+W +T L     EL  L+      T     L  LE L+      T  L+++R +   +YP                 + + G +   E+ + +  IG  R ++R I  E    C +   L +    Y ++ L          E ++     TF   FH+FYP    Q   L + L      + E  F  S+  L     +  + S L   +          +    + RS   +++ EN+    HRFPLL  +M  + +     S   + S   ++  +L I+ L ++ + +   ++ SS    N          E+T     S           VD LN  HS K  A R ++ +   S   G+ +                                              D ICF+++K     + GF V G   I+   ++V   +   +    + +R  +         EL+   Y   +   D+  +++   + + L+E+ +YAV+   +     +T  G   ++ +    G  F      L +     +R G I  +LY
Sbjct:  902 LRAVQVSCGFHHSVVLMENGDVYTFGYGQHGQLGHGDVNSRGCPTLVQALPGPSTQVTAGSNHTAVLLMDGQVFTFGSFSKGQLGRP-ILDVPYW------NAKPAPMPNIGSKYGRKATWIGASGDQTFLRIDEALINSHVLATSE----IFASKHIIGLVPASISEPPPFKCLLINKVDGSCKTFNDSEQEDLQGF-GVCLDPVYDVIWRFRPN--TRELWCYNAVVADARLPSAADMQSRCSILSPELALPTGSRALTTRSHAALHILGCLDTLAAMQDLKMGVASTEEETQAVMKVYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFSADTDILLGGLGLFGGRGEYTAKIKLFE-LGPDGG----------DHETDGD---LLAETD-VLAYDCAAREKYAMMFDEPVLLQAGWWYVAWARVSGPSSDCGSHGQASITTDDGVVFQFKSSKKSNNGTDVNAGQIPQLLY--RLPTSDGSASKGKQQTSEPVHILKRS-----FARTVSVECFESLLSILHWSWTTLVLGVEELRGLKGFQFTAT-----LLDLERLRFVG---TCCLRLLRVYTCEIYP-----------------VSATGKAVVEETSKLAECIGKTRTLLRKILSEGVDHCMV--KLDNDPQGYLSQPLS-------LLEAVLQECHNTFTACFHSFYPTPALQWACLCDLLNCLDQDIQEANFKTSSSRL-----LAAVMSALCHTSVKLTSIFPIAYDGEVLLRSIVKQVSTENDSTLVHRFPLLVAHMEKLSQSEENISG--MTSFREVLEKMLVIVVLPVRNSLRRENELFSSHLVSNTCGLLASIVSELTASALGSE----------VDGLNSLHSVKASANRFTKTSQGRSWNTGNGS---------------------------------------------PDAICFSVDKPGIVVV-GFSVYGGGGIHEYELEVLVDDSEHAGDSTHSHRWTSL--------ELVKGTYTTDDSPSDI--AEIRLDKVVPLKENVKYAVR---LRNYGSRTANGDGGMTTVQCPDGVTFTFSTCSLSSNGTNQTR-GQIPQILY 1844          

HSP 3 Score: 170.244 bits (430), Expect = 7.088e-41
Identity = 169/630 (26.83%), Postives = 260/630 (41.27%), Query Frame = 1
Query: 5575 YFTIIESNHPYEQAKLLHNTIKFPDSVDAISITFDGHCVTAQPEDFLVVKARTNTANGNQTENKWKIIFKNLSNII--------SDWPKKAVIIQGNEIAIEFHTASLY-EESLESTYGFKCSIVGH--CSKIDAFIELLENALTYLASRCATSL------LEFRKKSKVIKLLHETNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSC--SSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQVTSQMSNIEV-LFNYNHK---------------GNNPFINI----NEKLFGGHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIRAAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNKDKND-KP-KYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLK--EHLNKIFLTP 7335
            ++ +IES HPY+ A ++H  + FP+ V  ++I FD  C TAQ ED L +     T   +    K   + +NL++ I        S WP   +++ GNE      TAS Y ++   S YGFKC  +G+      D  +  LE  L  L   CA +L      L    + +    + E   LQ C+ +  IL +GL+LS  PT+ + L  +    I S + +F+  F+         +C   S   +L++WLQ                   P  Y D  K    T+++ N+          + ++  DQY + V      +EV     + K                 +P +       +  +GG   P   V +E  I+ +  Y +ITMMK YE +SFEE+R A        S+ +  R +  + ++  +W P A G Y L +TID I             +ID      VK+ P   I   T+  K K++ +P K   F  K S+GLR+RS PS  S  +GI+  N  + + +E+  ++ VW+RL                              N ETI                   KK V  N+  +TE WCL   +HL K  L P
Sbjct: 1981 HYAVIESEHPYKPACVMHYKVTFPECVRWMTIEFDPQCGTAQSEDVLRLLIPVRTVQNSGYGPKLTSVHENLNSWIELKKFSGSSGWPTMVLVLPGNEALFSLETASDYVKDDKASFYGFKCFAIGYEFSPGPDEGVIQLEKELANLGGVCAAALMKKDLALPIGNELEEDLEILEEAALQVCKTHSGILGKGLALSHSPTILEALEGNLPLQIQSNEQSFLDDFI---------ACVPGSSGGRLARWLQ-------------------PDSYADPQK----TSLILNKDDIRCGWPTTITVQTKDQYGDVVHVPNMKVEVKAVPVSQKKMSLQQDQAKKPQRIPGSPAVTAASSNTDMTYGGLASPKLDVSYEPMIVKEARYIAITMMKVYENYSFEELRFASPTPKR-PSENMLIRVN-NDGTYCANWTPGAIGLYTLHVTIDGI-------------EIDAGLEVKVKDPPKGMIPPGTQLVKPKSEPQPNKVRKFVAKDSAGLRIRSHPSLQSEQIGIVKVNGTITFIDEIHNDDGVWLRL------------------------------NDETI-------------------KKYVP-NMNGYTEAWCLSFNQHLGKSLLVP 2513          

HSP 4 Score: 111.694 bits (278), Expect = 3.595e-23
Identity = 136/591 (23.01%), Postives = 252/591 (42.64%), Query Frame = 1
Query:  247 KTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKKC-----------SDW-SNRNQEIPVSEQFCLINQLPDNVTSESLISNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELA--KYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKITNFHGFPSTPGWKYYLFANYTKLGCCLINEDETYSEQLFMKLFKLNSEKFLVEECE-KSIDMTQHL--ILKFEIEQ-----SKIFSNPSTLIETCPSLSLACEVLNLEEFCVVRNQSGEIFY----KDIDNVERNNNVENWTRLLYTDYVAAKFHKLIGGIDNKFICAISDDG--LWRININRHSQPRTLCLDRLMPNSRFISKTWASG------SCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            K PKI+ + L  +++ I++T  S+P +C + LQ++L  L+  QP    SE  ++++ LF+LLL I             RS  M                           N S  ++L  ++ ACLFS+  + G     L A++ +L  NG       IQ P ++  L++             DW SN  ++  +  ++ L     D      L ++G +L+ L   GL KIG+G++G+++G +Y +   +   K    W+G  +   LL+  +   S      +T  +I+ + L+ DG V L   +  G       +  LF +   +     + D+ +     +++F  ++E  L +E + K      H   I  F++E+     S  F   S ++                EF +++  +G+I+Y    + +   +   +   W  L  T   + K      G D      +++DG   +  + ++     +    R     +        G      +C+  + +++SK+G++    KD+I+S S+     L  + VTQ+++GK+H   L +NG + TFGVNN  QCG
Sbjct:  157 KLPKIIEVGLCEVFELIKETRFSHPSLCLRSLQALLNVLQGQQPEGLQSEPPEVLESLFQLLLEITV-----------RSTGM---------------------------NDSTGQSLTALSCACLFSLVASWGETGRTLQAISAILTNNGS-HACQTIQVPTILNSLQRSVQAVLVGKIQIQDWFSNGIKKAALMHKWPLKEISVDEDDQCLLQNDGFFLYLLCKDGLYKIGSGYSGTVRGHIYNSTSRIRNRKEKKSWLGY-AQGYLLYRDVNNHS------MTAIRISPETLEQDGTVMLPDCHTEG-------QNILFTDGEYINQIAASRDDGF----VVRIFATSTEPVLQQELQLKLARKCLHACGISLFDLEKDLHIISTGFDEESAILGAG------------REFALMKTANGKIYYTGKYQSLGIKQGGPSAGKWVELPITK--SPKIVHFSVGHDGSHALLVAEDGSIFFTGSASKGEDGESTKSRRQSKPYKPKKIIKMEGKIVVYTACNNGSSSVISKDGELYMFGKDAIYSDSSSLVTDLKGHFVTQVAMGKAHTCVLMKNGEVWTFGVNNKGQCG 676          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Human
Match: MYCBP2 (MYC binding protein 2 [Source:HGNC Symbol;Acc:HGNC:23386])

HSP 1 Score: 244.588 bits (623), Expect = 7.156e-72
Identity = 135/265 (50.94%), Postives = 171/265 (64.53%), Query Frame = 1
Query: 12148 VCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            +CMICFT+ LS  P I L +C H+ H  C RR ++  W G R++F F  CP CK KI H  L+DLL+P   L ++V+RKAL+RLE+EGL  S  +          P  +A+++Y YY+CYKC+ +Y+GGEARC+ +                  DP  EL C ACSDV++A++CPKH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +C     F
Sbjct:    1 MCMICFTEALSAAPAIQL-DCSHIFHLQCCRRVLENRWLGPRITFGFISCPICKNKINHIVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITTPGVRFYNDPAGYAMNRYAYYVCYKCRKAYFGGEARCDAE-----------AGRGDDYDP-RELICGACSDVSRAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSIPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCEMPTLF 252          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Human
Match: RCBTB2 (RCC1 and BTB domain containing protein 2 [Source:HGNC Symbol;Acc:HGNC:1914])

HSP 1 Score: 70.8626 bits (172), Expect = 3.665e-11
Identity = 59/232 (25.43%), Postives = 103/232 (44.40%), Query Frame = 1
Query: 1711 SKDNLALVSKEGQVLFLEKDSI---------HSLSTCYGAL-LSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCGCVSVDNDGKYNEIMQEIDNNNVD--SCSQIRSKHQVPTIKPQKLLIYS-DTNASSGIKNRSN-----------FLRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVVPIQCKSVRITTGSFST---GILSQNGKVFIFG 2325
            S  ++ L + EG+V     ++          H L  C+ +  LS   V +++ G  H   L+ +G +  +G NN  Q G  S  N      +   + N  V   +C Q+     V T    ++ ++  + N   G+ N  N            +R+Q+++CG+ HT++LT  G VY++G N + QLG G  SN+  P  V ++   +       ST      +Q G V+++G
Sbjct:  107 SGPHIVLATTEGEVFTWGHNAYSQLGNGTTNHGLVPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTVNQPIPRRVTGCLQNKVVVTIACGQMCCMAVVDT---GEVYVWGYNGNGQLGLGNSGNQPTPCRVAALQGIRVQRVACGYAHTLVLTDEGQVYAWGANSYGQLGTGNKSNQSYPTPVTVEKDRIIEIAACHSTHTSAAKTQGGHVYMWG 335          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Celegans
Match: rpm-1 (E3 ubiquitin-protein ligase rpm-1 [Source:UniProtKB/Swiss-Prot;Acc:Q17551])

HSP 1 Score: 291.582 bits (745), Expect = 4.884e-78
Identity = 184/526 (34.98%), Postives = 265/526 (50.38%), Query Frame = 1
Query: 11410 WNNLSSTARVLKSGEKK----MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPSDQNER---------CRFCNETSTNVDNKF--ACLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            W  LS   + ++  E +    +C NHDD  T+A V C  C                  + LC EC   +HL K  + H   NL +Q  +  D        +N H+ C R+K   F++      L  ++ ++ + +   +T++                +P+ Q+           CRFC       D      C  ++C   +  AC   +  C H+C G+    +NE +    C P C+  TC  +         QDGDDVC+ICFT+ L   P I L  C HM H+HC R  ++  W G R+ F F +CP C Q IEH  LQDL+EP   + +EV  KA +RLE++GL+ +P + D        PEE+AL +Y Y LC+KCK +Y+GGE+RC+  +            +S   +P  EL C  CSD +  ++CP+H  ++LEYKCR+CCSIAV+FCFGTTHFC  CHD+   ++  P   LP CP GP    +    CPL + HPPTG+EFA+GC +CR + TF
Sbjct: 3314 WLELSERWKTVQDEEDQEPVLLCENHDDGHTVAQVFCVDCD-----------------VALCKECFTVMHLHKKNRNHGVKNL-VQSSTQHD--------INIHQGCARMKFLNFLILFHGEALNGMVEVAADTLFPTSTSSI---------------QPAMQSSSAFLGIHPMTCRFCGNNVPVEDQSLDGTCTHEDCVNYAKTAC-QVMHTCNHFCGGI----RNEEE----CLP-CM--TCKREDA------AQDGDDVCVICFTERLGAAPCIRL-GCGHMFHFHCVRMILERRWNGPRIVFRFMQCPLCIQPIEHSGLQDLIEPLKTIRQEVVDKAKMRLEYDGLLTTPALTDPRSEFYNQPEEYALDRYMYVLCHKCKKAYFGGESRCQAAL------------DSSQFNPE-ELLCGGCSDTSGVQVCPRHGVEYLEYKCRFCCSIAVYFCFGTTHFCAPCHDDFQRLMSLPKHLLPTCPVGPRSTPMEEQTCPLKMKHPPTGDEFAMGCGICRNISTF 3766          

HSP 2 Score: 132.109 bits (331), Expect = 1.018e-29
Identity = 183/776 (23.58%), Postives = 321/776 (41.37%), Query Frame = 1
Query: 5041 FKRKLKLEESYRYAVKVFLIAANNKKTLIGQNPVSKL----GTRFGYHFNLYETKLRTTANQNSRQGIIFSLL---YSFSTKPQSVTDNQRLERKCVKMCLIELLAQVKYGLVTMIRETNPEELLSIGQKLFIDTYLPFFCHQLQLVSNVSKKIT---------CLSITFVRETLIVIQENWKTTDKLINS-EKD-----------YFTIIESNHPYEQAKLLHNTIKFPDSVDAISITFDGHCVTAQPEDFLVVKARTNTANGNQTENKWKIIFKNLSNIISDWPKKAVIIQGNEIAIEFHTASLYEESL-ESTYGFKCSIVGHCSKIDAFIELLENALTYLASRCATSLLEFRKKSKVIKLLH--ETNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSCSSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQVTSQMSNIEVLFNYNHKGNNPFININEKLFGGHPVPNTTV----PFERTIIGKDIYQSITMMKNYEAHSFEEIRAAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSD-----NITLKIDVTKSSLVKNGPVEKIRKRTENNKDKNDKPKYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDS-----FNQWYG------YYPSDPLDQRPILSIEPVMSNQETIPFRRKAV 7215
            F   + L     YAVKV ++   N KT  G+  V+++    G R  +      ++  TT  +     +I+S+L    S   K +++ D   L        L+ L+A                    IG  +     LP  C  L  +S+++  +           L +    E LI +  N    +++ +S + D             T++ES HPY+        + F +  D I + F   C TAQ +D L +  + +       E+ +  I +      S+WP   +I+ GN +      +S  E +  E  +G+  ++ G+    +     LE  L +L++     + +       I+ L   E +     E + S+L +GLSLS  PTL++  +K Q     S    F+++F+ G         S+ A  L+KWL + SVV  S C+L L+         D+L       IVG        K + L+L   DQY+ +V      +EV  +  H+  NP   I++ L  G+ +P++ +    PF+  I+    Y +I  M  Y  +S EEIR     E + K  R+  + S + + F   W P   GKY +   +D   + ++ T +     +   K  +TK S  + G  +    RT +    +D            SG+R+R   +  S  +G+IP   ++ + EE+  ++  W+RL  ++      NQ  G      Y+   PL QR ++ ++     ++ +  RRK +
Sbjct: 1588 FPEYVLLSPGVTYAVKVNMM--KNTKTFCGEGGVTQVHLLNGARL-FFSGCSMSQNGTTVQRGQLPYLIYSILDQSNSLQIKQETIYDTFTL--------LLRLMAN------------------KIGAAITEGGALPACCQHL--MSHINPHVMVYMERFPDKALEMMSTMEQLIPMVSNLNGVERVFHSYDSDDSGCDTPYSGIVTTVVESQHPYKPNTSSSMVLLF-EEADYICVRFSPDCQTAQFDDQLTIYLKID-------EHSYMPIERCYG---SEWPSYPMILPGNCLMFVLDASSAVEGATSEQMFGYHVTVTGYLVGYNDSTMRLEQDLVWLSANACRIMTQLPINPSNIEHLSTAEDDTRHLFEKHGSLLKKGLSLSHSPTLSELCTKGQPPPAQSADLQFLREFLSGHT-------STSAGFLAKWLPTGSVVDASKCQLSLSH--------DDL-------IVG--------KAVTLKLLCKDQYDREVDCPKLQVEVFASLGHR--NPSSTIHQNLHIGN-LPSSLLIHQNPFQPIIVNHTRYMNIAAMPAYANYSVEEIRLGFMIEELVK-DRVPLK-SSDSSLFSGTWTPTTAGKYRIECKVDGSDISHTYTVEVTERPHRAGKGTITKPSGSRRG-AQMTVARTVSIPFSSD-----------FSGIRMRLGTTLASTSVGVIPRGALVEFIEEMDNDDGKWIRLTDETALLYGCNQGVGQVWCLAYH--RPL-QRELIPLKADTDREKAVKLRRKEI 2271          

HSP 3 Score: 104.375 bits (259), Expect = 2.606e-21
Identity = 84/275 (30.55%), Postives = 129/275 (46.91%), Query Frame = 1
Query: 2674 DPRYSVLWSIDSGHGSKKFTVKYSKSNIFQSDNFQDKFDQLIDLPDDISFSSQRYRIA------------LNVLVSAEKLLLKKYADPQNNNQIKTVDSNKEIF----TVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYY 3450
            DP+Y +LW  +S     K    + KS      +  D FD L  L     F+ Q Y               L+   SA  + L ++   ++  + +  D  K I        RF      W YS N+ ++I+F VS+ I + G+GLY G GE    +K+Y + G ++D           Y  Q       TETD+  V +    +   L+   PI++  N  +V+ A I+G S+D G +G+  ++ D GVTF+F++S  S+NGT V  GQIPE+YY
Sbjct:  953 DPKYDMLWYYNSAEMEIKGYDIFKKSE----KSVGDAFDSLTFLAG-AEFAVQVYDSPAYATSMSLGMQLLSATFSANVINLSEFWKEKHGEREQ--DHEKTIMDGYSVANRFDGTGGGWGYSANSVEAIQFKVSKEIRLVGVGLYGGRGEYISKLKLYRQIGTEADEL---------YVEQ------ITETDET-VYDCGAHETATLLFSQPIVIQPNHWHVVSAKISGPSSDCGANGKRHVECD-GVTFQFRKSAVSNNGTDVDVGQIPELYY 1203          

HSP 4 Score: 56.9954 bits (136), Expect = 4.736e-7
Identity = 46/178 (25.84%), Postives = 78/178 (43.82%), Query Frame = 1
Query: 1810 SPYHVTQISLGKSHGACLSR----NGYLITFGVNNYYQCGCVSVDNDGKYNEIMQEIDNNNVDSCSQIRSKHQVPTIKPQKLLIYSDTNASSGIKNRSNFLRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPK--VVPIQCKSVRITTGSFSTGILSQNGKVFIFG 2325
            +P    Q  L  + G    R     G +   GV       C      G+  E  Q     +V   S   +  Q  T+ P ++++      S G  +    +++  +SCG++HTV+L  +  V++FG+N   QLG G   +K  P+  ++P     V++  GS  T + + +G VF FG
Sbjct:  679 TPSVCAQCGLCSARGVACGRVPRPKGTMCHCGVGESTCLRCGLCRPCGEVTEPAQPGRAQHVQFSST--AAPQRSTLHPSRVIL------SQGPHD----VKVSSVSCGNFHTVLLASDRRVFTFGSNCHGQLGVGDTLSKNTPQQVILPSDTVIVQVAAGSNHTILRANDGSVFTFG 844          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Celegans
Match: F07B7.12 (pep chromosome:WBcel235:V:8854993:8862049:-1 gene:WBGene00017190.1 transcript:F07B7.12.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F07B7.12)

HSP 1 Score: 103.605 bits (257), Expect = 3.545e-21
Identity = 84/275 (30.55%), Postives = 129/275 (46.91%), Query Frame = 1
Query: 2674 DPRYSVLWSIDSGHGSKKFTVKYSKSNIFQSDNFQDKFDQLIDLPDDISFSSQRYRIA------------LNVLVSAEKLLLKKYADPQNNNQIKTVDSNKEIF----TVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYY 3450
            DP+Y +LW  +S     K    + KS      +  D FD L  L     F+ Q Y               L+   SA  + L ++   ++  + +  D  K I        RF      W YS N+ ++I+F VS+ I + G+GLY G GE    +K+Y + G ++D           Y  Q       TETD+  V +    +   L+   PI++  N  +V+ A I+G S+D G +G+  ++ D GVTF+F++S  S+NGT V  GQIPE+YY
Sbjct:  953 DPKYDMLWYYNSAEMEIKGYDIFKKSE----KSVGDAFDSLTFLAG-AEFAVQVYDSPAYATSMSLGMQLLSATFSANVINLSEFWKEKHGEREQ--DHEKTIMDGYSVANRFDGTGGGWGYSANSVEAIQFKVSKEIRLVGVGLYGGRGEYISKLKLYRQIGTEADEL---------YVEQ------ITETDET-VYDCGAHETATLLFSQPIVIQPNHWHVVSAKISGPSSDCGANGKRHVECD-GVTFQFRKSAVSNNGTDVDVGQIPELYY 1203          

HSP 2 Score: 56.9954 bits (136), Expect = 4.094e-7
Identity = 89/402 (22.14%), Postives = 159/402 (39.55%), Query Frame = 1
Query: 5041 FKRKLKLEESYRYAVKVFLIAANNKKTLIGQNPVSKL----GTRFGYHFNLYETKLRTTANQNSRQGIIFSLL---YSFSTKPQSVTDNQRLERKCVKMCLIELLAQVKYGLVTMIRETNPEELLSIGQKLFIDTYLPFFCHQLQLVSNVSKKIT---------CLSITFVRETLIVIQENWKTTDKLINS-EKD-----------YFTIIESNHPYEQAKLLHNTIKFPDSVDAISITFDGHCVTAQPEDFLVVKARTNTANGNQTENKWKIIFKNLSNIISDWPKKAVIIQGNEIAIEFHTASLYEESL-ESTYGFKCSIVGHCSKIDAFIELLENALTYLASRCATSLLEFRKKSKVIKLLH--ETNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQ 6153
            F   + L     YAVKV ++   N KT  G+  V+++    G R  +      ++  TT  +     +I+S+L    S   K +++ D   L        L+ L+A                    IG  +     LP  C  L  +S+++  +           L +    E LI +  N    +++ +S + D             T++ES HPY+        + F +  D I + F   C TAQ +D L +  + +       E+ +  I +      S+WP   +I+ GN +      +S  E +  E  +G+  ++ G+    +     LE  L +L++     + +       I+ L   E +     E + S+L +GLSLS  PTL++  +K Q
Sbjct: 1588 FPEYVLLSPGVTYAVKVNMM--KNTKTFCGEGGVTQVHLLNGARL-FFSGCSMSQNGTTVQRGQLPYLIYSILDQSNSLQIKQETIYDTFTL--------LLRLMAN------------------KIGAAITEGGALPACCQHL--MSHINPHVMVYMERFPDKALEMMSTMEQLIPMVSNLNGVERVFHSYDSDDSGCDTPYSGIVTTVVESQHPYKPNTSSSMVLLF-EEADYICVRFSPDCQTAQFDDQLTIYLKID-------EHSYMPIERCYG---SEWPSYPMILPGNCLMFVLDASSAVEGATSEQMFGYHVTVTGYLVGYNDSTMRLEQDLVWLSANACRIMTQLPINPSNIEHLSTAEDDTRHLFEKHGSLLKKGLSLSHSPTLSELCTKGQ 1947          

HSP 3 Score: 56.225 bits (134), Expect = 7.813e-7
Identity = 46/178 (25.84%), Postives = 78/178 (43.82%), Query Frame = 1
Query: 1810 SPYHVTQISLGKSHGACLSR----NGYLITFGVNNYYQCGCVSVDNDGKYNEIMQEIDNNNVDSCSQIRSKHQVPTIKPQKLLIYSDTNASSGIKNRSNFLRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPK--VVPIQCKSVRITTGSFSTGILSQNGKVFIFG 2325
            +P    Q  L  + G    R     G +   GV       C      G+  E  Q     +V   S   +  Q  T+ P ++++      S G  +    +++  +SCG++HTV+L  +  V++FG+N   QLG G   +K  P+  ++P     V++  GS  T + + +G VF FG
Sbjct:  679 TPSVCAQCGLCSARGVACGRVPRPKGTMCHCGVGESTCLRCGLCRPCGEVTEPAQPGRAQHVQFSST--AAPQRSTLHPSRVIL------SQGPHD----VKVSSVSCGNFHTVLLASDRRVFTFGSNCHGQLGVGDTLSKNTPQQVILPSDTVIVQVAAGSNHTILRANDGSVFTFG 844          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Celegans
Match: tag-30 (pep chromosome:WBcel235:IV:11850950:11854946:-1 gene:WBGene00006415.1 transcript:F38H4.7.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-30)

HSP 1 Score: 66.2402 bits (160), Expect = 4.729e-10
Identity = 49/172 (28.49%), Postives = 74/172 (43.02%), Query Frame = 1
Query: 2947 FTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLY---TGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDT-DLGVTFKFKQSKNSSNGTHVKEGQIPEIYY 3450
            + V RF +  + W +     D IKF V   I++ G GLY   +GP E    IKI     + +            +DT F                  N +  R+    P+ +     Y+  A I G  + +G  G  ++ T D  VTF+F  +  ++NGT V++GQIPEI Y
Sbjct:  450 YVVSRFQRIENRWGFC-GTSDRIKFMVDRRIFVVGFGLYGAISGPHEYKTQIKIIHCGTNKTLA---------EHDTSFVC--------------DGNSRPCRVCFKEPVEILPGITYIAAALIRGPDSYYGTKGLRRVSTHDSDVTFQFTYAAMNNNGTSVEDGQIPEIIY 597          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Celegans
Match: tag-30 (pep chromosome:WBcel235:IV:11850950:11855159:-1 gene:WBGene00006415.1 transcript:F38H4.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tag-30)

HSP 1 Score: 66.2402 bits (160), Expect = 4.729e-10
Identity = 49/172 (28.49%), Postives = 74/172 (43.02%), Query Frame = 1
Query: 2947 FTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLY---TGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDT-DLGVTFKFKQSKNSSNGTHVKEGQIPEIYY 3450
            + V RF +  + W +     D IKF V   I++ G GLY   +GP E    IKI     + +            +DT F                  N +  R+    P+ +     Y+  A I G  + +G  G  ++ T D  VTF+F  +  ++NGT V++GQIPEI Y
Sbjct:  450 YVVSRFQRIENRWGFC-GTSDRIKFMVDRRIFVVGFGLYGAISGPHEYKTQIKIIHCGTNKTLA---------EHDTSFVC--------------DGNSRPCRVCFKEPVEILPGITYIAAALIRGPDSYYGTKGLRRVSTHDSDVTFQFTYAAMNNNGTSVEDGQIPEIIY 597          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Fly
Match: hiw (gene:FBgn0030600 transcript:FBtr0073970)

HSP 1 Score: 328.946 bits (842), Expect = 4.371e-89
Identity = 200/503 (39.76%), Postives = 271/503 (53.88%), Query Frame = 1
Query: 11455 KKMCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPSDQNERCRFCNETSTN--VDNKFACLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQST-----LSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + +C+NHDD  T A + C TC                    LC +CDR+LHL++ T+ H R     +  + +         V  HESC R K    +   D+ TLK ++     +                      IS P +   RCRFC  T  +  ++    C   +CQ  ++ +C  K +PCGH C GV          ++ C P C+   C  +       L    L QD DD+CMICF + LS  P I LE C H+ HYHC +  ++  W G R++F F  CP CK  I+HP L D+LEP + L+++VKRKAL+R+++EG++     KD+D     +  + A+ +Y YY+C+KC+ +YYGGEARC+ ++                 DP  EL C  CSDVA+A++CPKH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LPQCPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct: 4808 RPLCSNHDDGETAAIIQCETCGS------------------LCGDCDRFLHLNRKTRSHKRTVCKEEEEAIR---------VELHESCGRTKLFWLLALADSKTLKAMVEFRDGSHTI-------------------ISGPQEAVGRCRFCGLTGNSGLLEIGNVCADAQCQEYAANSCL-KTKPCGHACGGVT--------GERKCLP-CLQHVCHTRENELAEELRDPKLTQDADDMCMICFVEALSCAPSIHLE-CGHVFHYHCCKAVLEKRWSGPRITFGFSLCPICKADIQHPLLSDILEPINGLKQDVKRKALMRIKYEGVV-----KDTDSKNVNM-TQLAMDRYAYYVCFKCQKAYYGGEARCDAEI-------------GEKFDP-EELVCGGCSDVARAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCDTCHDDFQRLTNIPKVKLPQCPAGPKAKQLLGDECPLHVMHPPTGEEFALGCGVCRNAQTF 5233          

HSP 2 Score: 114.775 bits (286), Expect = 2.302e-24
Identity = 121/479 (25.26%), Postives = 216/479 (45.09%), Query Frame = 1
Query: 5758 ENKWKIIFKNLSNIISDWPKKAVIIQGNEIAIEFHTASLY-EESLESTYGFKCSIVGH-----CSKIDAFIELLENALTYLASRCATSLLEFRKKSKVIKLLHE-TNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYI----NSIQTTFVKKFVEGSNYYPETSCSSPAVQLSKWLQSCSVVIVSNCRLKLAPTSM----PAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQVTSQMSNIEVLFNYNHKGNNPFIN-INEKLFG-GHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIR-AAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNKDKNDKPKYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQW--YGYYPSD 7134
            + +W ++ K   N  S W    +I+ GN +     TASLY ++   + YGFKC +VG+      +  ++ +  LE  L YL   C+ +L++        K + + + I +    + ++L +G +LS+ P LT  + ++   Y+     S +  F+K F+ G+         S   +L+ WLQ  S +  + C L      +    P++    ++      ++  ++  E+ K I              TS  S  EV    +  G N ++   +   +G G   P   + +E T+  K ++++IT MK Y  +SFEE+R A+  Q  V +    K     E+ +F + W P + G Y L +TID I L+     D             VK G +    +R    +      K   F+ + SSGLR+RS P+  S  +G++    V+ + +E+  ++ VW+RL  +S  Q    G+YP++
Sbjct: 2644 DREWIVVKK--FNTASTWLHNVLILPGNCVEFSLETASLYAQDPHNNRYGFKCLVVGYDNPTSINASNSCLIRLEQELAYLGGMCSANLMKKELNLPDDKDVEDMSGIEETINTHHTLLSKGFALSE-PQLT--VHQALESYLPIGSQSNERQFLKDFISGAP-------GSSGARLAAWLQPESRLDPNKCELNTITEPLRYGWPSQVTVTIRDQYGDAVLVPELKVEI-KAIPTGSGPNGSATGTGTSCTSVAEV----SAPGPNLWMRRASRDTWGWGGMAPPPRINYEPTVKDKMVFKAITFMKPYANYSFEELRYASPVQTRVTELLNAK---DMEDGTFSVQWTPSSVGAYCLAVTIDGIPLEEVYRVD-------------VKEGILPPPTQRNSAQRRPQAPSKLRRFQARHSSGLRIRSHPTLQSEQVGVVRVGGVISFIDEIENDDGVWLRLSTESIRQHCTMGWYPTE 3089          

HSP 3 Score: 110.153 bits (274), Expect = 5.731e-23
Identity = 127/598 (21.24%), Postives = 241/598 (40.30%), Query Frame = 1
Query:  253 PKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPP-FDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKKCSDWSNRNQEIPVSEQF--------CLINQLPDN---------VTSESLISNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELAKYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKITNFHGFPSTPGWKYYLFANYTKLGCCLINEDETYSEQ---LFMKLFKLNSEKF-----LVEECEKSID---MTQHLILKFEIEQSKIFSNPSTLIETCPSLSLACEVLNL---EEFCVVRNQSGEIFYKDIDNVERNNNVENWTRLLYTDYVAAKFHKLIG---GIDNKFICAISDDG-LWRININRHSQPRTLCLDRLMPN-------SRFISKTWASGSCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            P I+   L ++++ I D    +P++C K L+++L  ++  QP  +  E +++I+ L+ LLL      D+ T                               +P   +     + N   +A A L  + IA+G+   +L A+  +L+    L     +Q P ++  L+     +  N+  P    F         LI++ P           +TS ++  +G +++ L    LLKIGTGF GS +G +Y  NE+ +   + W+G     +        R+ +         + +D L I     L + +        G  Y LF +   L     N D+T   +   L+   + ++   F     L  +  +++        L+ +++I++ +   N        P      +V+ +   +EF +VR  +G ++Y           V     L  T+ V +K   ++    G D      ++DDG ++     R  +      +R  P        ++         +C+    A V+K G+++   KD+ H  +  + + L   HVT+++LGK+H   L+  G L +FG+NN  QCG
Sbjct:  236 PLIVGAGLRSLFELIADARHVHPLLCTKALKALLDVIQGQQPESFKLEPEELINPLYDLLL------DLAT-------------------------------MPAALNSATGAEANWSAMACAALLGLCIARGDTGKMLKAIAAMLMTPRQLSAQ-IVQLPVVLATLQHTVISAALNK--PTRPDFHSHGVPHNSLIDEFPVKLPPLSTGAPITSPAMACDGVFVYLLYGGTLLKIGTGFGGSYKGHIYAQNEDFSHERSAWLGYSGGQLYFR-----RTCRRSAGDQLQMVGLDTLAIKAMSPLSMLHMR-----EGLNYVLFTDDDSLHAICSNRDDTLVVKKLNLYHNSYNIDPPPFELPLQLARKKFRTLGYAAFEDELLNQYQIQRIQSAHNSFEPKLPAPCRDADVDVMGMACGKEFGLVRASNGRVYYYGKSAALGLKCVGRTPTLKLTELVISKAANIVHVAVGHDGIHALLVNDDGTVFFAGTARRGEDGDSSKNRRQPKAVKPKKMTKIDGHVVVHAACNNGTSAFVTKTGKLIMYGKDTAHCDAMGFVSELLEQHVTKVALGKAHCVALNAKGQLFSFGLNNKGQCG 783          

HSP 4 Score: 102.834 bits (255), Expect = 9.306e-21
Identity = 96/376 (25.53%), Postives = 160/376 (42.55%), Query Frame = 1
Query: 2674 DPRYSVLWSIDSGHGSKKFTVKYSKSNIFQSDNFQDKFDQLID----LPDDISFSSQRYRIALN------VLVSAEKLLLKKYADPQNNNQIKTVDSNK-EIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMPDIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYP 3768
            DP Y+VLW  D G   K        S+I  SD     +  L+     LPD +     R + +LN      +L SA+  +   +  P      +T ++   E   V RF      W YS ++ ++I+FS    I I G G++ G GE +  +K+++           L  +   Y+ +    +L +ET +V  +     K   ++LP P+   + + Y++ A I G S+D G  G++ + T+  V F FK SK ++NGT V  GQIP I Y     D  +     +           +   ++ +S     S V LL+W +    C   +L + +  S        L      +K       S L+++RK+   +YP
Sbjct: 1332 DPTYNVLWVFD-GAARKLRCHNVVASDINDSDANAATYRSLLSPELSLPDRVDSRVARSQASLNLLACLDILTSAQDNIPGCFEQPLLKQTQQTAETQAGEFQVVNRFDNFGGGWGYSGHSVEAIRFSADTDIVICGFGMFGGRGEYSCKLKLFD-----------LGGDGGGYEKEG---ILISETKEVPYECGARSKH-HILLPKPVSAVAGRWYLVWARIAGPSSDCGSCGQASVTTEDQVVFSFKSSKKANNGTDVNSGQIPAILYRLVTQDCKQTPAQMDADP----VQRISRAFANSVSRECFESLVVLLSWSW---DCFKLQLREERDRSRPLQLQQSLQYLGYVIK-------SCLRLLRKYTIEIYP 1677          

HSP 5 Score: 65.4698 bits (158), Expect = 1.915e-9
Identity = 30/75 (40.00%), Postives = 47/75 (62.67%), Query Frame = 1
Query: 2104 IQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVVPIQCKSVRITTGSFSTGILSQNGKVFIFGN 2328
            + Q++CG +HTV+LT+ G+VY+FG+N++ QLG G L     P  V +     ++  GS  T +L+  G V+ FGN
Sbjct:  968 VVQVACGLHHTVVLTLAGEVYTFGSNQYGQLGSGDLQPVSGPVRVQVPGAISQVAAGSNHTVLLTSKGMVYTFGN 1042          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Fly
Match: hiw (gene:FBgn0030600 transcript:FBtr0346087)

HSP 1 Score: 328.946 bits (842), Expect = 4.371e-89
Identity = 200/503 (39.76%), Postives = 271/503 (53.88%), Query Frame = 1
Query: 11455 KKMCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPSDQNERCRFCNETSTN--VDNKFACLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQST-----LSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + +C+NHDD  T A + C TC                    LC +CDR+LHL++ T+ H R     +  + +         V  HESC R K    +   D+ TLK ++     +                      IS P +   RCRFC  T  +  ++    C   +CQ  ++ +C  K +PCGH C GV          ++ C P C+   C  +       L    L QD DD+CMICF + LS  P I LE C H+ HYHC +  ++  W G R++F F  CP CK  I+HP L D+LEP + L+++VKRKAL+R+++EG++     KD+D     +  + A+ +Y YY+C+KC+ +YYGGEARC+ ++                 DP  EL C  CSDVA+A++CPKH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LPQCPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct: 4808 RPLCSNHDDGETAAIIQCETCGS------------------LCGDCDRFLHLNRKTRSHKRTVCKEEEEAIR---------VELHESCGRTKLFWLLALADSKTLKAMVEFRDGSHTI-------------------ISGPQEAVGRCRFCGLTGNSGLLEIGNVCADAQCQEYAANSCL-KTKPCGHACGGVT--------GERKCLP-CLQHVCHTRENELAEELRDPKLTQDADDMCMICFVEALSCAPSIHLE-CGHVFHYHCCKAVLEKRWSGPRITFGFSLCPICKADIQHPLLSDILEPINGLKQDVKRKALMRIKYEGVV-----KDTDSKNVNM-TQLAMDRYAYYVCFKCQKAYYGGEARCDAEI-------------GEKFDP-EELVCGGCSDVARAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCDTCHDDFQRLTNIPKVKLPQCPAGPKAKQLLGDECPLHVMHPPTGEEFALGCGVCRNAQTF 5233          

HSP 2 Score: 114.775 bits (286), Expect = 2.302e-24
Identity = 121/479 (25.26%), Postives = 216/479 (45.09%), Query Frame = 1
Query: 5758 ENKWKIIFKNLSNIISDWPKKAVIIQGNEIAIEFHTASLY-EESLESTYGFKCSIVGH-----CSKIDAFIELLENALTYLASRCATSLLEFRKKSKVIKLLHE-TNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYI----NSIQTTFVKKFVEGSNYYPETSCSSPAVQLSKWLQSCSVVIVSNCRLKLAPTSM----PAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQVTSQMSNIEVLFNYNHKGNNPFIN-INEKLFG-GHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIR-AAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNKDKNDKPKYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQW--YGYYPSD 7134
            + +W ++ K   N  S W    +I+ GN +     TASLY ++   + YGFKC +VG+      +  ++ +  LE  L YL   C+ +L++        K + + + I +    + ++L +G +LS+ P LT  + ++   Y+     S +  F+K F+ G+         S   +L+ WLQ  S +  + C L      +    P++    ++      ++  ++  E+ K I              TS  S  EV    +  G N ++   +   +G G   P   + +E T+  K ++++IT MK Y  +SFEE+R A+  Q  V +    K     E+ +F + W P + G Y L +TID I L+     D             VK G +    +R    +      K   F+ + SSGLR+RS P+  S  +G++    V+ + +E+  ++ VW+RL  +S  Q    G+YP++
Sbjct: 2644 DREWIVVKK--FNTASTWLHNVLILPGNCVEFSLETASLYAQDPHNNRYGFKCLVVGYDNPTSINASNSCLIRLEQELAYLGGMCSANLMKKELNLPDDKDVEDMSGIEETINTHHTLLSKGFALSE-PQLT--VHQALESYLPIGSQSNERQFLKDFISGAP-------GSSGARLAAWLQPESRLDPNKCELNTITEPLRYGWPSQVTVTIRDQYGDAVLVPELKVEI-KAIPTGSGPNGSATGTGTSCTSVAEV----SAPGPNLWMRRASRDTWGWGGMAPPPRINYEPTVKDKMVFKAITFMKPYANYSFEELRYASPVQTRVTELLNAK---DMEDGTFSVQWTPSSVGAYCLAVTIDGIPLEEVYRVD-------------VKEGILPPPTQRNSAQRRPQAPSKLRRFQARHSSGLRIRSHPTLQSEQVGVVRVGGVISFIDEIENDDGVWLRLSTESIRQHCTMGWYPTE 3089          

HSP 3 Score: 110.153 bits (274), Expect = 5.731e-23
Identity = 127/598 (21.24%), Postives = 241/598 (40.30%), Query Frame = 1
Query:  253 PKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPP-FDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKKCSDWSNRNQEIPVSEQF--------CLINQLPDN---------VTSESLISNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELAKYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKITNFHGFPSTPGWKYYLFANYTKLGCCLINEDETYSEQ---LFMKLFKLNSEKF-----LVEECEKSID---MTQHLILKFEIEQSKIFSNPSTLIETCPSLSLACEVLNL---EEFCVVRNQSGEIFYKDIDNVERNNNVENWTRLLYTDYVAAKFHKLIG---GIDNKFICAISDDG-LWRININRHSQPRTLCLDRLMPN-------SRFISKTWASGSCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            P I+   L ++++ I D    +P++C K L+++L  ++  QP  +  E +++I+ L+ LLL      D+ T                               +P   +     + N   +A A L  + IA+G+   +L A+  +L+    L     +Q P ++  L+     +  N+  P    F         LI++ P           +TS ++  +G +++ L    LLKIGTGF GS +G +Y  NE+ +   + W+G     +        R+ +         + +D L I     L + +        G  Y LF +   L     N D+T   +   L+   + ++   F     L  +  +++        L+ +++I++ +   N        P      +V+ +   +EF +VR  +G ++Y           V     L  T+ V +K   ++    G D      ++DDG ++     R  +      +R  P        ++         +C+    A V+K G+++   KD+ H  +  + + L   HVT+++LGK+H   L+  G L +FG+NN  QCG
Sbjct:  236 PLIVGAGLRSLFELIADARHVHPLLCTKALKALLDVIQGQQPESFKLEPEELINPLYDLLL------DLAT-------------------------------MPAALNSATGAEANWSAMACAALLGLCIARGDTGKMLKAIAAMLMTPRQLSAQ-IVQLPVVLATLQHTVISAALNK--PTRPDFHSHGVPHNSLIDEFPVKLPPLSTGAPITSPAMACDGVFVYLLYGGTLLKIGTGFGGSYKGHIYAQNEDFSHERSAWLGYSGGQLYFR-----RTCRRSAGDQLQMVGLDTLAIKAMSPLSMLHMR-----EGLNYVLFTDDDSLHAICSNRDDTLVVKKLNLYHNSYNIDPPPFELPLQLARKKFRTLGYAAFEDELLNQYQIQRIQSAHNSFEPKLPAPCRDADVDVMGMACGKEFGLVRASNGRVYYYGKSAALGLKCVGRTPTLKLTELVISKAANIVHVAVGHDGIHALLVNDDGTVFFAGTARRGEDGDSSKNRRQPKAVKPKKMTKIDGHVVVHAACNNGTSAFVTKTGKLIMYGKDTAHCDAMGFVSELLEQHVTKVALGKAHCVALNAKGQLFSFGLNNKGQCG 783          

HSP 4 Score: 102.834 bits (255), Expect = 9.306e-21
Identity = 96/376 (25.53%), Postives = 160/376 (42.55%), Query Frame = 1
Query: 2674 DPRYSVLWSIDSGHGSKKFTVKYSKSNIFQSDNFQDKFDQLID----LPDDISFSSQRYRIALN------VLVSAEKLLLKKYADPQNNNQIKTVDSNK-EIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMPDIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYP 3768
            DP Y+VLW  D G   K        S+I  SD     +  L+     LPD +     R + +LN      +L SA+  +   +  P      +T ++   E   V RF      W YS ++ ++I+FS    I I G G++ G GE +  +K+++           L  +   Y+ +    +L +ET +V  +     K   ++LP P+   + + Y++ A I G S+D G  G++ + T+  V F FK SK ++NGT V  GQIP I Y     D  +     +           +   ++ +S     S V LL+W +    C   +L + +  S        L      +K       S L+++RK+   +YP
Sbjct: 1332 DPTYNVLWVFD-GAARKLRCHNVVASDINDSDANAATYRSLLSPELSLPDRVDSRVARSQASLNLLACLDILTSAQDNIPGCFEQPLLKQTQQTAETQAGEFQVVNRFDNFGGGWGYSGHSVEAIRFSADTDIVICGFGMFGGRGEYSCKLKLFD-----------LGGDGGGYEKEG---ILISETKEVPYECGARSKH-HILLPKPVSAVAGRWYLVWARIAGPSSDCGSCGQASVTTEDQVVFSFKSSKKANNGTDVNSGQIPAILYRLVTQDCKQTPAQMDADP----VQRISRAFANSVSRECFESLVVLLSWSW---DCFKLQLREERDRSRPLQLQQSLQYLGYVIK-------SCLRLLRKYTIEIYP 1677          

HSP 5 Score: 65.4698 bits (158), Expect = 1.915e-9
Identity = 30/75 (40.00%), Postives = 47/75 (62.67%), Query Frame = 1
Query: 2104 IQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVVPIQCKSVRITTGSFSTGILSQNGKVFIFGN 2328
            + Q++CG +HTV+LT+ G+VY+FG+N++ QLG G L     P  V +     ++  GS  T +L+  G V+ FGN
Sbjct:  968 VVQVACGLHHTVVLTLAGEVYTFGSNQYGQLGSGDLQPVSGPVRVQVPGAISQVAAGSNHTVLLTSKGMVYTFGN 1042          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Fly
Match: CG6678 (gene:FBgn0038917 transcript:FBtr0084148)

HSP 1 Score: 56.9954 bits (136), Expect = 2.328e-7
Identity = 26/77 (33.77%), Postives = 44/77 (57.14%), Query Frame = 1
Query: 2101 RIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVVPIQC--KSVRITTGSFSTGILSQNGKVFIFG 2325
            R++Q+ CGH H V+L  NGDV+++GN    QLG   L  +E P+++      K  +I  G + +  +S  G ++ +G
Sbjct:  175 RVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLAELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYTWG 251          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Zebrafish
Match: mycbp2 (MYC binding protein 2 [Source:NCBI gene;Acc:368439])

HSP 1 Score: 428.713 bits (1101), Expect = 3.495e-119
Identity = 378/1269 (29.79%), Postives = 580/1269 (45.71%), Query Frame = 1
Query: 9331 MRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIW--------CMFNLLEKHKSIDKSNKPQISLIEEKNLKVYSQQLWAV---GSAVF---YRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINF-EKSQVFSCLSELLNHLDDS---KVFNGRIISTHENSIK----INSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAI-----YQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYN--CFTTSYQNRIEKKELQDNHDIESKS-----LHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDIL-FGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAG---KSLSIQMKSKSCS--QQSGLKPFQDFLQKINNLPNFIQTSH-------------CDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECF--MAINQNSDFINWENPNLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKP-SDQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + F + +  +  L +A++ +LR      ++ + + WLL NV   +SL  ++W          F   E+    +K NK   +L +EK+L V    L  +   G A     +     +   S+L     S   L +M ++  SL          F QS   F  +S VF  ++ +L+  DD    + FN  + S +E   +    +    D+T +     +S      SL D +T+ FWES   + +    I +     C + I  +   VSV++D +RDI N  VT+ + +   A+      +Q+ ++  H+GW++  L   +          HV+  E        G  N  +RVR VKVL   E  S     +      +    + ETL+ F  +T+ +F    C         E+K L  + + E K+     L + +V I+F     T  + +V +            HI+  I +E T++  + +       N N    +      D +  + CF+LL+ VLALSG+  G +YL  Q  L++DL  LL+  S ++++QV   + R+   V+P  L  ++    + P +  +  +   K +  +  L +L +F G   K+L++Q+K+K  +    +G+   +        LP    +S+                  A  I +L+  ++  +   AW    +  + +       M     S         L+  +  L + +     +  + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + T+ H R     +  + K         V+ HE C R K    +   D+ T+K ++   ++                         KP S  ++ CRFC        +     C  Q+CQ  + +ACS K  PCGH C GV    KNE     +C P C+   C   +T     LKQD DD+CMICFT+ LS  P I L+ C H+ H  C RR ++  W G R++F F  CP CK KI H  L+DLL+P   L ++V+RKAL+RLE+EGL  S  +  S       P  FA+++Y YY+C+KCK +Y+GGEARC+ +                  DP  EL C ACSDV++A++C KH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct: 3412 LAFVIQHHDLEGLEVAMKHALRKSACRVFAMEAFNWLLCNVTQTTSLHDILWHFVASLTPSPFETEEEEDEENKGNKE--NLEQEKDLGVCEHPLSDIIIAGEAAHPLPHTFHCLLQTISDLMMSLPSGSSLQQMALRCWSL---------KFKQSDHQFLHQSNVFHHINNILSKSDDGDSEESFNISVQSGYEAISQELCVVTCLKDLTSVVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKSITIS----CVKGI--NASYVSVHVDNSRDIGN-KVTSMIFLCGKAVEDLCRIKQIDLDSRHMGWVTSELPGGDH---------HVIKIE------LKGPEN-TLRVRQVKVLGWKEGESIKIAGQISASVAQQKNCEAETLRVFRLITSQVFGKLICGDAEPTPEQEEKNLLSSPEGEDKAPSDADLKEHMVGIIFSRSKLTNLQKQVCA------------HIVQAIRMEATRVREEWEHAISSKENANSQPSDD-----DASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPMRLASVIGVKALPPADISDIIHSTEKGD--WTKLGILDMFLGCIAKALTVQLKAKGTTIVGTAGMAAGKGV--TTVTLPMIFNSSYIRRGESHWWMKGSTPPQIAEIIIKLVKDMAAGHLSDAWSRVTKNAIAETIIALTKMEEEHRSPVRCIATTRLWLALASLCVLDQ----DHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNACG------------------NLCTDCDRFLHLHRRTRTHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFREHT-----------------------GKPASSSSDACRFCGTRHGTELSAVGSVCSDQDCQEYAKLACS-KTHPCGHPCGGV----KNED----LCLP-CL-HGCDKTATC----LKQDADDMCMICFTEALSAAPAIQLD-CSHVFHLQCTRRVLENRWLGPRITFGFMSCPICKNKINHLVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITMSGARFFNNPAGFAMNRYAYYVCFKCKKAYFGGEARCDAE-----------AGQGDDYDP-RELICGACSDVSRAQMCSKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSVPKEELPHCPAGPKGKQLEGSECPLHVVHPPTGEEFALGCGVCRNAHTF 4543          

HSP 2 Score: 163.31 bits (412), Expect = 6.500e-39
Identity = 163/621 (26.25%), Postives = 260/621 (41.87%), Query Frame = 1
Query: 5572 DYFTIIESNHPYEQAKLLHNTIKFPDSVDAI--SITFDGHCVTAQPEDFLVVKARTNTANGNQTENKWKIIFKNLSNIISDWPKKAVIIQGNEIAIEFHTASLY-EESLESTYGFKCSIVGH--CSKIDAFIELLENALTYLASRCATSLLEFRKKSKVIKLLH-ETNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSC--SSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQV------------------TSQMSNIEVLFNYNHKGNNPFININEKLFGGHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIRAAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNKDKND-KP-KYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLK--EHLNKIFLTPAKI 7344
            +++ ++ES+HPY+QA +      FPD +  I  S+ F G                ++ A  ++T N W  + K   +  S WP   +++ GNE      TAS Y ++   S YGFKC  VG+     +D  I  LE  L YL S CA +L+   KK   + +   +    Q C+ +  +L +GL+LS  PT+ + L  +   ++ + + +F++ F+         +C  SS   +L++WLQ                   P  Y D  K    T+++ N+          + ++  DQY + V                  + Q  N++ L       +N      +  FGGHP P     +E  II +  Y +ITMMK YE +SFEE+R A        S+ +  R +  + ++  +W P A G Y + +TID I             +ID      VK+ P   I   T+  K K + +P K   F  K S+GLR+RS PS  S  +GI+  N  + + +E+  ++ VW+RL                              N ET+                   KK V  N+  +TE WCL   +HL +  L P  +
Sbjct: 2005 NHYAVLESDHPYKQAGVTQYKFSFPD-IQQIYRSLHFSG---------------LSSKALAHETINSWTELKKFSGS--SGWPTAVLVLPGNEALFSLETASDYVKDEKASFYGFKCVAVGYEFNPGLDEGIIQLEKELAYLGSVCAAALM---KKDLALPIGKSDCFFAQVCKSHSGLLGKGLALSHSPTILEALEGNLPLHLQTNEHSFLEDFI---------TCVQSSSGGRLARWLQ-------------------PDSYADPQK----TSLILNKDDIRCGWPTTVVVQTKDQYGDVVHVPNMKVEVKAVPVSQKKSIQQENMKKLQRLPGTSSNSATG-TDLTFGGHPAPKLEATYEPMIIKEARYIAITMMKAYENYSFEELRFASPTPKR-PSENMLIR-ANTDGTYSANWTPGAVGLYTIHVTIDGI-------------EIDAGLEVEVKDPPKGMIPPGTQMVKPKAEPQPSKVRKFVAKDSAGLRVRSHPSLQSEQIGIVQVNGTITFIDEIHNDDGVWLRL------------------------------NDETV-------------------KKYVP-NMNGYTEAWCLSFNQHLGRSLLVPVDV 2506          

HSP 3 Score: 158.303 bits (399), Expect = 2.015e-37
Identity = 188/774 (24.29%), Postives = 332/774 (42.89%), Query Frame = 1
Query: 2098 LRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVV-PIQCKSVRITTGSFSTGILSQNGKVFIFGN----KITSPQIIDLISNPNDLTDNLQPIFFNFSTNNYKKQIIFCILKQNIFYMKRKPLTLSTHRKSYHQDQFKFLAKDNTILL---TLDEQ---RGLLINISSGTIKIMPDYDEGNFSSLMNSYFDPRYSVLWS-IDSGHGSKKFTVKYSKSNIFQSDNFQDKFDQL---IDLPDDISFSSQRYRIALNVL------VSAEKLLLKKYADPQNNNQIKTVDSNKEIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMP-DIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYPFNGKFNELCHLEETLVKIPSLGYSKDTESQETSVVIGDFRIIVRNIFLEC--KICHYLQSIKSTYGAESLIYAECWKLFTEDLIPVYKETFEHSFHAFYPEIEDQRFTLQEAL----LKVYEFCFNKSTDTLCNYGKIMFLTSLLTAINSANEGFLIFTHKDNSVTRSGENKINGENN--FAHRFPLLREYMRTI 4329
            LR  Q+SCG +H+V+L  NGDVY+FG  +  QLG G ++++  P +V  +   S ++T GS  T +L  +G+VF FG+    ++  P I+D+         N +P         Y ++  +     +  +++     +++H  +  +      A  + I L   ++ E    + LLIN   G+ +   D ++ +         DP Y V+W  +        +    + + +  + + Q     L   + LP     S+ R   AL++L       + ++L +   +  +    +  V S ++   V RF      W YS ++ ++I+F     I + G+GL+ G GE T  IK++E  G D             ++T      L  ETD V   +   ++   +M   P++L     YV  A ++G S+D G HG++ I TD GV F+FK SK S+NGT V  GQIP++ Y  R+P +     K  +++   ++    T   +  +S++   S +++L+W +T L     EL  L+      T     L  LE L+      T  L+++R +I  ++P +     +                   ES + +  +G  R +++ I  E        L +    Y ++ L          E ++     TF   FH+FYP    Q   L + L      + E  F  S+  L     +  + S L   +      L   +    + RS   +++ EN+   AHRFPLL  +M  +
Sbjct:  925 LRAVQVSCGFHHSVVLMENGDVYTFGYGQHGQLGHGDVNSRGSPTLVQALPGPSTQVTAGSNHTAVLLMDGQVFTFGSFSKGQLGRP-ILDMPYW------NAKPSPMPNIGAKYGRKATWIGASGDQTFLRIDEALINSHVLATSE----IFANKHIIGLVPTSISEPPPFKCLLINKLDGSCRTFNDSEQEDLQGF-GLCLDPVYDVIWRFLPVTREMCCYNAVIADARVPTASDIQALCSILSPELALPSGSHASTTRSHGALHILGCLDTLAAMQELKMGVASAEEETQAVMKVYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFCADADILLGGLGLFGGRGEYTAKIKLFE-LGPDGG----------DHETDGD---LLAETD-VLAYDCAAREKYAMMFDEPVLLQLGWWYVAWARVSGPSSDCGSHGQATITTDDGVVFQFKSSKKSNNGTDVNAGQIPQLLY--RLPSNDGNASKGKQQTSEPVHILKRT--FARTVSVDCFESLLSILHWSWTTLVLGVEELRGLKGFQFTAT-----LLDLERLRFVG---TCCLRLLRVYICDIFPISASTKAIVE-----------------ESSKLAECVGKTRSLLKKILSEGMDNCLTKLDNDPQGYLSQPLT-------LLEAVLQECHNTFTACFHSFYPTPALQWACLCDLLNCLDQDIQEANFRTSSSRL-----LAAVMSALCNTSVKLTSILPIAYDGEVLLRSLVKQVSTENDSALAHRFPLLVAHMEKL 1630          

HSP 4 Score: 119.013 bits (297), Expect = 1.463e-25
Identity = 134/594 (22.56%), Postives = 252/594 (42.42%), Query Frame = 1
Query:  247 KTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKKC-----------SDW-SNRNQEIPVSEQFCLINQLPDNVTSESLISNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELA--KYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKITNFHGFPSTPGWKYYLFANYTKLGCCLINEDETYSEQLFMKLFKLNSEKFLVEECE-KSIDMTQHL--ILKFEIEQ-----SKIFSNPSTLIETCPSLSLACEVLNLEEFCVVRNQSGEIFY----KDIDNVERNNNVENWTRLLYTDYVAAKFHKLIGGIDNKFICAISDDGLWRI-----------NINRHSQPRTLCLDRLMPNSRFISKTWASGSCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            K PKI+ + L  +++ I++T  S+P +C + LQ++L  L+  QP  + +E  D+++ LF LLL               RS  M                           N    + L  ++ ACLFS+ +A G+    L AV+ +L  NG       IQ P ++  L++             +W  N  +   +  ++ L     D+     L ++G++L+ L   GL K+G+G++G+++G VY +   +   K    W+G     +L       R      M    KIN + L+ +G + +      G       +  +F +   +      +D+ +     ++++  +S+  L +E + K      H   I  F++E+     S  F   + LI                EF +++  SG+I+Y    + +   +   +   W  L  T   + K  +   G D      +++DG               +     QP+     +++   +  +K     +C+  + ++V+K+G++    KD+I+S STC  + L  + VTQ+++GK+H   L+++G + TFGVNN  QCG
Sbjct:  186 KLPKIIGIGLCGVFELIKETRFSHPSLCLRSLQALLDMLQGQQPESFQTEPPDVLESLFHLLL-----------ETTVRSTGM---------------------------NDPTGQTLTALSCACLFSLVVAWGDTGKTLQAVSAILTNNGS-HACQTIQVPTILNALQRSVQAVLVGKIQIQEWFGNGIKRAALMNKWVLKEVNIDDDEHCLLQTDGSFLYLLCKDGLYKVGSGYSGTVRGHVYNSTSRIRNRKEKRSWLGFAQGCLLY------RDMNSHNMAAI-KINPETLEQEGTITVPGLQADG-------QNIIFTDGEYINQIAACKDDGF----VVRIYATSSDPALQQELQLKLARKCLHACGISLFDLEKDLHIISTGFDEEAALIGAG------------REFALMKTASGKIYYTGKYQSLGIKQGGPSSGKWVELPVTK--SPKIVQFSVGHDGSHALLVAEDGSVFFTGSASKGEDGESTKSRRQPKPYKPKKMI---KLETKMAVYTACNNGSSSIVTKDGELYMFGKDAIYSDSTCQVSDLKGHFVTQVAMGKAHTCVLTKSGEVWTFGVNNKGQCG 705          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Zebrafish
Match: mycbp2 (MYC binding protein 2 [Source:NCBI gene;Acc:368439])

HSP 1 Score: 428.328 bits (1100), Expect = 4.583e-119
Identity = 378/1269 (29.79%), Postives = 580/1269 (45.71%), Query Frame = 1
Query: 9331 MRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIW--------CMFNLLEKHKSIDKSNKPQISLIEEKNLKVYSQQLWAV---GSAVF---YRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINF-EKSQVFSCLSELLNHLDDS---KVFNGRIISTHENSIK----INSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAI-----YQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYN--CFTTSYQNRIEKKELQDNHDIESKS-----LHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDIL-FGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAG---KSLSIQMKSKSCS--QQSGLKPFQDFLQKINNLPNFIQTSH-------------CDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECF--MAINQNSDFINWENPNLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKP-SDQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + F + +  +  L +A++ +LR      ++ + + WLL NV   +SL  ++W          F   E+    +K NK   +L +EK+L V    L  +   G A     +     +   S+L     S   L +M ++  SL          F QS   F  +S VF  ++ +L+  DD    + FN  + S +E   +    +    D+T +     +S      SL D +T+ FWES   + +    I +     C + I  +   VSV++D +RDI N  VT+ + +   A+      +Q+ ++  H+GW++  L   +          HV+  E        G  N  +RVR VKVL   E  S     +      +    + ETL+ F  +T+ +F    C         E+K L  + + E K+     L + +V I+F     T  + +V +            HI+  I +E T++  + +       N N    +      D +  + CF+LL+ VLALSG+  G +YL  Q  L++DL  LL+  S ++++QV   + R+   V+P  L  ++    + P +  +  +   K +  +  L +L +F G   K+L++Q+K+K  +    +G+   +        LP    +S+                  A  I +L+  ++  +   AW    +  + +       M     S         L+  +  L + +     +  + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + T+ H R     +  + K         V+ HE C R K    +   D+ T+K ++   ++                         KP S  ++ CRFC        +     C  Q+CQ  + +ACS K  PCGH C GV    KNE     +C P C+   C   +T     LKQD DD+CMICFT+ LS  P I L+ C H+ H  C RR ++  W G R++F F  CP CK KI H  L+DLL+P   L ++V+RKAL+RLE+EGL  S  +  S       P  FA+++Y YY+C+KCK +Y+GGEARC+ +                  DP  EL C ACSDV++A++C KH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct: 3574 LAFVIQHHDLEGLEVAMKHALRKSACRVFAMEAFNWLLCNVTQTTSLHDILWHFVASLTPSPFETEEEEDEENKGNKE--NLEQEKDLGVCEHPLSDIIIAGEAAHPLPHTFHCLLQTISDLMMSLPSGSSLQQMALRCWSL---------KFKQSDHQFLHQSNVFHHINNILSKSDDGDSEESFNISVQSGYEAISQELCVVTCLKDLTSVVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKSITIS----CVKGI--NASYVSVHVDNSRDIGN-KVTSMIFLCGKAVEDLCRIKQIDLDSRHMGWVTSELPGGDH---------HVIKIE------LKGPEN-TLRVRQVKVLGWKEGESIKIAGQISASVAQQKNCEAETLRVFRLITSQVFGKLICGDAEPTPEQEEKNLLSSPEGEDKAPSDADLKEHMVGIIFSRSKLTNLQKQVCA------------HIVQAIRMEATRVREEWEHAISSKENANSQPSDD-----DASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPMRLASVIGVKALPPADISDIIHSTEKGD--WTKLGILDMFLGCIAKALTVQLKAKGTTIVGTAGMAAGKGV--TTVTLPMIFNSSYIRRGESHWWMKGSTPPQIAEIIIKLVKDMAAGHLSDAWSRVTKNAIAETIIALTKMEEEHRSPVRCIATTRLWLALASLCVLDQ----DHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNACG------------------NLCTDCDRFLHLHRRTRTHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFREHT-----------------------GKPASSSSDACRFCGTRHGTELSAVGSVCSDQDCQEYAKLACS-KTHPCGHPCGGV----KNED----LCLP-CL-HGCDKTATC----LKQDADDMCMICFTEALSAAPAIQLD-CSHVFHLQCTRRVLENRWLGPRITFGFMSCPICKNKINHLVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITMSGARFFNNPAGFAMNRYAYYVCFKCKKAYFGGEARCDAE-----------AGQGDDYDP-RELICGACSDVSRAQMCSKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSVPKEELPHCPAGPKGKQLEGSECPLHVVHPPTGEEFALGCGVCRNAHTF 4705          

HSP 2 Score: 162.925 bits (411), Expect = 9.226e-39
Identity = 163/618 (26.38%), Postives = 259/618 (41.91%), Query Frame = 1
Query: 5572 DYFTIIESNHPYEQAKLLHNTIKFPDSVDAI--SITFDGHCVTAQPEDFLVVKARTNTANGNQTENKWKIIFKNLSNIISDWPKKAVIIQGNEIAIEFHTASLY-EESLESTYGFKCSIVGH--CSKIDAFIELLENALTYLASRCATSLLEFRKKSKVIKLLH-ETNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSC--SSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQV------------------TSQMSNIEVLFNYNHKGNNPFININEKLFGGHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIRAAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNKDKND-KP-KYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLK--EHLNKIFLTP 7335
            +++ ++ES+HPY+QA +      FPD +  I  S+ F G                ++ A  ++T N W  + K   +  S WP   +++ GNE      TAS Y ++   S YGFKC  VG+     +D  I  LE  L YL S CA +L+   KK   + +   +    Q C+ +  +L +GL+LS  PT+ + L  +   ++ + + +F++ F+         +C  SS   +L++WLQ                   P  Y D  K    T+++ N+          + ++  DQY + V                  + Q  N++ L       +N      +  FGGHP P     +E  II +  Y +ITMMK YE +SFEE+R A        S+ +  R +  + ++  +W P A G Y + +TID I             +ID      VK+ P   I   T+  K K + +P K   F  K S+GLR+RS PS  S  +GI+  N  + + +E+  ++ VW+RL                              N ET+                   KK V  N+  +TE WCL   +HL +  L P
Sbjct: 2005 NHYAVLESDHPYKQAGVTQYKFSFPD-IQQIYRSLHFSG---------------LSSKALAHETINSWTELKKFSGS--SGWPTAVLVLPGNEALFSLETASDYVKDEKASFYGFKCVAVGYEFNPGLDEGIIQLEKELAYLGSVCAAALM---KKDLALPIGKSDCFFAQVCKSHSGLLGKGLALSHSPTILEALEGNLPLHLQTNEHSFLEDFI---------TCVQSSSGGRLARWLQ-------------------PDSYADPQK----TSLILNKDDIRCGWPTTVVVQTKDQYGDVVHVPNMKVEVKAVPVSQKKSIQQENMKKLQRLPGTSSNSATG-TDLTFGGHPAPKLEATYEPMIIKEARYIAITMMKAYENYSFEELRFASPTPKR-PSENMLIR-ANTDGTYSANWTPGAVGLYTIHVTIDGI-------------EIDAGLEVEVKDPPKGMIPPGTQMVKPKAEPQPSKVRKFVAKDSAGLRVRSHPSLQSEQIGIVQVNGTITFIDEIHNDDGVWLRL------------------------------NDETV-------------------KKYVP-NMNGYTEAWCLSFNQHLGRSLLVP 2503          

HSP 3 Score: 157.918 bits (398), Expect = 2.630e-37
Identity = 188/774 (24.29%), Postives = 331/774 (42.76%), Query Frame = 1
Query: 2098 LRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVV-PIQCKSVRITTGSFSTGILSQNGKVFIFG----NKITSPQIIDLISNPNDLTDNLQPIFFNFSTNNYKKQIIFCILKQNIFYMKRKPLTLSTHRKSYHQDQFKFLAKDNTILL---TLDEQ---RGLLINISSGTIKIMPDYDEGNFSSLMNSYFDPRYSVLWS-IDSGHGSKKFTVKYSKSNIFQSDNFQDKFDQL---IDLPDDISFSSQRYRIALNVL------VSAEKLLLKKYADPQNNNQIKTVDSNKEIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMP-DIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYPFNGKFNELCHLEETLVKIPSLGYSKDTESQETSVVIGDFRIIVRNIFLEC--KICHYLQSIKSTYGAESLIYAECWKLFTEDLIPVYKETFEHSFHAFYPEIEDQRFTLQEAL----LKVYEFCFNKSTDTLCNYGKIMFLTSLLTAINSANEGFLIFTHKDNSVTRSGENKINGENN--FAHRFPLLREYMRTI 4329
            LR  Q+SCG +H+V+L  NGDVY+FG  +  QLG G ++++  P +V  +   S ++T GS  T +L  +G+VF FG     ++  P I+D+         N +P         Y ++  +     +  +++     +++H  +  +      A  + I L   ++ E    + LLIN   G+ +   D ++ +         DP Y V+W  +        +    + + +  + + Q     L   + LP     S+ R   AL++L       + ++L +   +  +    +  V S ++   V RF      W YS ++ ++I+F     I + G+GL+ G GE T  IK++E  G D             ++T      L  ETD V   +   ++   +M   P++L     YV  A ++G S+D G HG++ I TD GV F+FK SK S+NGT V  GQIP++ Y  R+P +     K  +++   ++    T   +  +S++   S +++L+W +T L     EL  L+      T     L  LE L+      T  L+++R +I  ++P +     +                   ES + +  +G  R +++ I  E        L +    Y ++ L          E ++     TF   FH+FYP    Q   L + L      + E  F  S+  L     +  + S L   +      L   +    + RS   +++ EN+   AHRFPLL  +M  +
Sbjct:  925 LRAVQVSCGFHHSVVLMENGDVYTFGYGQHGQLGHGDVNSRGSPTLVQALPGPSTQVTAGSNHTAVLLMDGQVFTFGSFSKGQLGRP-ILDMPYW------NAKPSPMPNIGAKYGRKATWIGASGDQTFLRIDEALINSHVLATSE----IFANKHIIGLVPTSISEPPPFKCLLINKLDGSCRTFNDSEQEDLQGF-GLCLDPVYDVIWRFLPVTREMCCYNAVIADARVPTASDIQALCSILSPELALPSGSHASTTRSHGALHILGCLDTLAAMQELKMGVASAEEETQAVMKVYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFCADADILLGGLGLFGGRGEYTAKIKLFE-LGPDGG----------DHETDGD---LLAETD-VLAYDCAAREKYAMMFDEPVLLQLGWWYVAWARVSGPSSDCGSHGQATITTDDGVVFQFKSSKKSNNGTDVNAGQIPQLLY--RLPSNDGNASKGKQQTSEPVHILKRT--FARTVSVDCFESLLSILHWSWTTLVLGVEELRGLKGFQFTAT-----LLDLERLRFVG---TCCLRLLRVYICDIFPISASTKAIVE-----------------ESSKLAECVGKTRSLLKKILSEGMDNCLTKLDNDPQGYLSQPLT-------LLEAVLQECHNTFTACFHSFYPTPALQWACLCDLLNCLDQDIQEANFRTSSSRL-----LAAVMSALCNTSVKLTSILPIAYDGEVLLRSLVKQVSTENDSALAHRFPLLVAHMEKL 1630          

HSP 4 Score: 119.013 bits (297), Expect = 1.329e-25
Identity = 132/594 (22.22%), Postives = 252/594 (42.42%), Query Frame = 1
Query:  247 KTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKKC-----------SDW-SNRNQEIPVSEQFCLINQLPDNVTSESLISNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELA--KYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKITNFHGFPSTPGWKYYLFANYTKLGCCLINEDETYSEQLFMKLFKLNSEKFLVEECEKSID---MTQHLILKFEIEQ-----SKIFSNPSTLIETCPSLSLACEVLNLEEFCVVRNQSGEIFY----KDIDNVERNNNVENWTRLLYTDYVAAKFHKLIGGIDNKFICAISDDGLWRI-----------NINRHSQPRTLCLDRLMPNSRFISKTWASGSCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            K PKI+ + L  +++ I++T  S+P +C + LQ++L  L+  QP  + +E  D+++ LF LLL               RS  M                           N    + L  ++ ACLFS+ +A G+    L AV+ +L  NG       IQ P ++  L++             +W  N  +   +  ++ L     D+     L ++G++L+ L   GL K+G+G++G+++G VY +   +   K    W+G     +L       R      M    KIN + L+ +G + +      G       +  +F +   +      +D+ +     ++++  +S+  L +E +  +    +    I  F++E+     S  F   + LI                EF +++  SG+I+Y    + +   +   +   W  L  T   + K  +   G D      +++DG               +     QP+     +++   +  +K     +C+  + ++V+K+G++    KD+I+S STC  + L  + VTQ+++GK+H   L+++G + TFGVNN  QCG
Sbjct:  186 KLPKIIGIGLCGVFELIKETRFSHPSLCLRSLQALLDMLQGQQPESFQTEPPDVLESLFHLLL-----------ETTVRSTGM---------------------------NDPTGQTLTALSCACLFSLVVAWGDTGKTLQAVSAILTNNGS-HACQTIQVPTILNALQRSVQAVLVGKIQIQEWFGNGIKRAALMNKWVLKEVNIDDDEHCLLQTDGSFLYLLCKDGLYKVGSGYSGTVRGHVYNSTSRIRNRKEKRSWLGFAQGCLLY------RDMNSHNMAAI-KINPETLEQEGTITVPGLQADG-------QNIIFTDGEYINQIAACKDDGF----VVRIYATSSDPALQQELQLKLARKCLHACGISLFDLEKDLHIISTGFDEEAALIGAG------------REFALMKTASGKIYYTGKYQSLGIKQGGPSSGKWVELPVTK--SPKIVQFSVGHDGSHALLVAEDGSVFFTGSASKGEDGESTKSRRQPKPYKPKKMI---KLETKMAVYTACNNGSSSIVTKDGELYMFGKDAIYSDSTCQVSDLKGHFVTQVAMGKAHTCVLTKSGEVWTFGVNNKGQCG 705          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Zebrafish
Match: mycbp2 (MYC binding protein 2 [Source:NCBI gene;Acc:368439])

HSP 1 Score: 427.943 bits (1099), Expect = 5.257e-119
Identity = 378/1269 (29.79%), Postives = 580/1269 (45.71%), Query Frame = 1
Query: 9331 MRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIW--------CMFNLLEKHKSIDKSNKPQISLIEEKNLKVYSQQLWAV---GSAVF---YRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINF-EKSQVFSCLSELLNHLDDS---KVFNGRIISTHENSIK----INSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAI-----YQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYN--CFTTSYQNRIEKKELQDNHDIESKS-----LHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDIL-FGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAG---KSLSIQMKSKSCS--QQSGLKPFQDFLQKINNLPNFIQTSH-------------CDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECF--MAINQNSDFINWENPNLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKP-SDQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + F + +  +  L +A++ +LR      ++ + + WLL NV   +SL  ++W          F   E+    +K NK   +L +EK+L V    L  +   G A     +     +   S+L     S   L +M ++  SL          F QS   F  +S VF  ++ +L+  DD    + FN  + S +E   +    +    D+T +     +S      SL D +T+ FWES   + +    I +     C + I  +   VSV++D +RDI N  VT+ + +   A+      +Q+ ++  H+GW++  L   +          HV+  E        G  N  +RVR VKVL   E  S     +      +    + ETL+ F  +T+ +F    C         E+K L  + + E K+     L + +V I+F     T  + +V +            HI+  I +E T++  + +       N N    +      D +  + CF+LL+ VLALSG+  G +YL  Q  L++DL  LL+  S ++++QV   + R+   V+P  L  ++    + P +  +  +   K +  +  L +L +F G   K+L++Q+K+K  +    +G+   +        LP    +S+                  A  I +L+  ++  +   AW    +  + +       M     S         L+  +  L + +     +  + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + T+ H R     +  + K         V+ HE C R K    +   D+ T+K ++   ++                         KP S  ++ CRFC        +     C  Q+CQ  + +ACS K  PCGH C GV    KNE     +C P C+   C   +T     LKQD DD+CMICFT+ LS  P I L+ C H+ H  C RR ++  W G R++F F  CP CK KI H  L+DLL+P   L ++V+RKAL+RLE+EGL  S  +  S       P  FA+++Y YY+C+KCK +Y+GGEARC+ +                  DP  EL C ACSDV++A++C KH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct: 3443 LAFVIQHHDLEGLEVAMKHALRKSACRVFAMEAFNWLLCNVTQTTSLHDILWHFVASLTPSPFETEEEEDEENKGNKE--NLEQEKDLGVCEHPLSDIIIAGEAAHPLPHTFHCLLQTISDLMMSLPSGSSLQQMALRCWSL---------KFKQSDHQFLHQSNVFHHINNILSKSDDGDSEESFNISVQSGYEAISQELCVVTCLKDLTSVVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKSITIS----CVKGI--NASYVSVHVDNSRDIGN-KVTSMIFLCGKAVEDLCRIKQIDLDSRHMGWVTSELPGGDH---------HVIKIE------LKGPEN-TLRVRQVKVLGWKEGESIKIAGQISASVAQQKNCEAETLRVFRLITSQVFGKLICGDAEPTPEQEEKNLLSSPEGEDKAPSDADLKEHMVGIIFSRSKLTNLQKQVCA------------HIVQAIRMEATRVREEWEHAISSKENANSQPSDD-----DASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPMRLASVIGVKALPPADISDIIHSTEKGD--WTKLGILDMFLGCIAKALTVQLKAKGTTIVGTAGMAAGKGV--TTVTLPMIFNSSYIRRGESHWWMKGSTPPQIAEIIIKLVKDMAAGHLSDAWSRVTKNAIAETIIALTKMEEEHRSPVRCIATTRLWLALASLCVLDQ----DHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNACG------------------NLCTDCDRFLHLHRRTRTHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFREHT-----------------------GKPASSSSDACRFCGTRHGTELSAVGSVCSDQDCQEYAKLACS-KTHPCGHPCGGV----KNED----LCLP-CL-HGCDKTATC----LKQDADDMCMICFTEALSAAPAIQLD-CSHVFHLQCTRRVLENRWLGPRITFGFMSCPICKNKINHLVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITMSGARFFNNPAGFAMNRYAYYVCFKCKKAYFGGEARCDAE-----------AGQGDDYDP-RELICGACSDVSRAQMCSKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSVPKEELPHCPAGPKGKQLEGSECPLHVVHPPTGEEFALGCGVCRNAHTF 4574          

HSP 2 Score: 190.274 bits (482), Expect = 4.359e-47
Identity = 173/636 (27.20%), Postives = 275/636 (43.24%), Query Frame = 1
Query: 5572 DYFTIIESNHPYEQAKLLHNTIKFPDSVDAISITFDGHCVTAQPEDF--LVVKAR-------TNTANGNQTENKWKIIFKNLSNIISDWPKKAVIIQGNEIAIEFHTASLY-EESLESTYGFKCSIVGH--CSKIDAFIELLENALTYLASRCATSLLEFRKKSKVIKLLHETNI---------LQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSC--SSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQV------------------TSQMSNIEVLFNYNHKGNNPFININEKLFGGHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIRAAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNKDKND-KP-KYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLK--EHLNKIFLTPAKI 7344
            +++ ++ES+HPY+QA +    + FPD V  +++ FD  C TAQPED   L++ +R       ++ A  ++T N W  + K   +  S WP   +++ GNE      TAS Y ++   S YGFKC  VG+     +D  I  LE  L YL S CA +L+   KK   + + +E            LQ C+ +  +L +GL+LS  PT+ + L  +   ++ + + +F++ F+         +C  SS   +L++WLQ                   P  Y D  K    T+++ N+          + ++  DQY + V                  + Q  N++ L       +N      +  FGGHP P     +E  II +  Y +ITMMK YE +SFEE+R A        S+ +  R +  + ++  +W P A G Y + +TID I             +ID      VK+ P   I   T+  K K + +P K   F  K S+GLR+RS PS  S  +GI+  N  + + +E+  ++ VW+RL                              N ET+                   KK V  N+  +TE WCL   +HL +  L P  +
Sbjct: 2005 NHYAVLESDHPYKQAGVTQYKVSFPDCVRWMTVEFDPQCGTAQPEDVLRLLIPSRSLHFSGLSSKALAHETINSWTELKKFSGS--SGWPTAVLVLPGNEALFSLETASDYVKDEKASFYGFKCVAVGYEFNPGLDEGIIQLEKELAYLGSVCAAALM---KKDLALPIGNELEEDLEILEEASLQVCKSHSGLLGKGLALSHSPTILEALEGNLPLHLQTNEHSFLEDFI---------TCVQSSSGGRLARWLQ-------------------PDSYADPQK----TSLILNKDDIRCGWPTTVVVQTKDQYGDVVHVPNMKVEVKAVPVSQKKSIQQENMKKLQRLPGTSSNSATG-TDLTFGGHPAPKLEATYEPMIIKEARYIAITMMKAYENYSFEELRFASPTPKR-PSENMLIR-ANTDGTYSANWTPGAVGLYTIHVTIDGI-------------EIDAGLEVEVKDPPKGMIPPGTQMVKPKAEPQPSKVRKFVAKDSAGLRVRSHPSLQSEQIGIVQVNGTITFIDEIHNDDGVWLRL------------------------------NDETV-------------------KKYVP-NMNGYTEAWCLSFNQHLGRSLLVPVDV 2537          

HSP 3 Score: 158.688 bits (400), Expect = 1.583e-37
Identity = 188/774 (24.29%), Postives = 332/774 (42.89%), Query Frame = 1
Query: 2098 LRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVV-PIQCKSVRITTGSFSTGILSQNGKVFIFGN----KITSPQIIDLISNPNDLTDNLQPIFFNFSTNNYKKQIIFCILKQNIFYMKRKPLTLSTHRKSYHQDQFKFLAKDNTILL---TLDEQ---RGLLINISSGTIKIMPDYDEGNFSSLMNSYFDPRYSVLWS-IDSGHGSKKFTVKYSKSNIFQSDNFQDKFDQL---IDLPDDISFSSQRYRIALNVL------VSAEKLLLKKYADPQNNNQIKTVDSNKEIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMP-DIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYPFNGKFNELCHLEETLVKIPSLGYSKDTESQETSVVIGDFRIIVRNIFLEC--KICHYLQSIKSTYGAESLIYAECWKLFTEDLIPVYKETFEHSFHAFYPEIEDQRFTLQEAL----LKVYEFCFNKSTDTLCNYGKIMFLTSLLTAINSANEGFLIFTHKDNSVTRSGENKINGENN--FAHRFPLLREYMRTI 4329
            LR  Q+SCG +H+V+L  NGDVY+FG  +  QLG G ++++  P +V  +   S ++T GS  T +L  +G+VF FG+    ++  P I+D+         N +P         Y ++  +     +  +++     +++H  +  +      A  + I L   ++ E    + LLIN   G+ +   D ++ +         DP Y V+W  +        +    + + +  + + Q     L   + LP     S+ R   AL++L       + ++L +   +  +    +  V S ++   V RF      W YS ++ ++I+F     I + G+GL+ G GE T  IK++E  G D             ++T      L  ETD V   +   ++   +M   P++L     YV  A ++G S+D G HG++ I TD GV F+FK SK S+NGT V  GQIP++ Y  R+P +     K  +++   ++    T   +  +S++   S +++L+W +T L     EL  L+      T     L  LE L+      T  L+++R +I  ++P +     +                   ES + +  +G  R +++ I  E        L +    Y ++ L          E ++     TF   FH+FYP    Q   L + L      + E  F  S+  L     +  + S L   +      L   +    + RS   +++ EN+   AHRFPLL  +M  +
Sbjct:  925 LRAVQVSCGFHHSVVLMENGDVYTFGYGQHGQLGHGDVNSRGSPTLVQALPGPSTQVTAGSNHTAVLLMDGQVFTFGSFSKGQLGRP-ILDMPYW------NAKPSPMPNIGAKYGRKATWIGASGDQTFLRIDEALINSHVLATSE----IFANKHIIGLVPTSISEPPPFKCLLINKLDGSCRTFNDSEQEDLQGF-GLCLDPVYDVIWRFLPVTREMCCYNAVIADARVPTASDIQALCSILSPELALPSGSHASTTRSHGALHILGCLDTLAAMQELKMGVASAEEETQAVMKVYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFCADADILLGGLGLFGGRGEYTAKIKLFE-LGPDGG----------DHETDGD---LLAETD-VLAYDCAAREKYAMMFDEPVLLQLGWWYVAWARVSGPSSDCGSHGQATITTDDGVVFQFKSSKKSNNGTDVNAGQIPQLLY--RLPSNDGNASKGKQQTSEPVHILKRT--FARTVSVDCFESLLSILHWSWTTLVLGVEELRGLKGFQFTAT-----LLDLERLRFVG---TCCLRLLRVYICDIFPISASTKAIVE-----------------ESSKLAECVGKTRSLLKKILSEGMDNCLTKLDNDPQGYLSQPLT-------LLEAVLQECHNTFTACFHSFYPTPALQWACLCDLLNCLDQDIQEANFRTSSSRL-----LAAVMSALCNTSVKLTSILPIAYDGEVLLRSLVKQVSTENDSALAHRFPLLVAHMEKL 1630          

HSP 4 Score: 119.013 bits (297), Expect = 1.476e-25
Identity = 132/594 (22.22%), Postives = 252/594 (42.42%), Query Frame = 1
Query:  247 KTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKKC-----------SDW-SNRNQEIPVSEQFCLINQLPDNVTSESLISNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELA--KYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKITNFHGFPSTPGWKYYLFANYTKLGCCLINEDETYSEQLFMKLFKLNSEKFLVEECEKSID---MTQHLILKFEIEQ-----SKIFSNPSTLIETCPSLSLACEVLNLEEFCVVRNQSGEIFY----KDIDNVERNNNVENWTRLLYTDYVAAKFHKLIGGIDNKFICAISDDGLWRI-----------NINRHSQPRTLCLDRLMPNSRFISKTWASGSCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            K PKI+ + L  +++ I++T  S+P +C + LQ++L  L+  QP  + +E  D+++ LF LLL               RS  M                           N    + L  ++ ACLFS+ +A G+    L AV+ +L  NG       IQ P ++  L++             +W  N  +   +  ++ L     D+     L ++G++L+ L   GL K+G+G++G+++G VY +   +   K    W+G     +L       R      M    KIN + L+ +G + +      G       +  +F +   +      +D+ +     ++++  +S+  L +E +  +    +    I  F++E+     S  F   + LI                EF +++  SG+I+Y    + +   +   +   W  L  T   + K  +   G D      +++DG               +     QP+     +++   +  +K     +C+  + ++V+K+G++    KD+I+S STC  + L  + VTQ+++GK+H   L+++G + TFGVNN  QCG
Sbjct:  186 KLPKIIGIGLCGVFELIKETRFSHPSLCLRSLQALLDMLQGQQPESFQTEPPDVLESLFHLLL-----------ETTVRSTGM---------------------------NDPTGQTLTALSCACLFSLVVAWGDTGKTLQAVSAILTNNGS-HACQTIQVPTILNALQRSVQAVLVGKIQIQEWFGNGIKRAALMNKWVLKEVNIDDDEHCLLQTDGSFLYLLCKDGLYKVGSGYSGTVRGHVYNSTSRIRNRKEKRSWLGFAQGCLLY------RDMNSHNMAAI-KINPETLEQEGTITVPGLQADG-------QNIIFTDGEYINQIAACKDDGF----VVRIYATSSDPALQQELQLKLARKCLHACGISLFDLEKDLHIISTGFDEEAALIGAG------------REFALMKTASGKIYYTGKYQSLGIKQGGPSSGKWVELPVTK--SPKIVQFSVGHDGSHALLVAEDGSVFFTGSASKGEDGESTKSRRQPKPYKPKKMI---KLETKMAVYTACNNGSSSIVTKDGELYMFGKDAIYSDSTCQVSDLKGHFVTQVAMGKAHTCVLTKSGEVWTFGVNNKGQCG 705          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Zebrafish
Match: CR759903.1 (pep chromosome:GRCz11:CHR_ALT_CTG9_2_1:17220635:17279981:-1 gene:ENSDARG00000115276.1 transcript:ENSDART00000180393.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR759903.1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.965e-12
Identity = 65/266 (24.44%), Postives = 116/266 (43.61%), Query Frame = 1
Query:  247 KTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKKC-----------SDW-SNRNQEIPVSEQFCLINQLPDNVTSESLISNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEEL--AKYCTGWMGIVSN 1002
            K PKI+ + L  +++ I++T  S+P +C + LQ++L  L+  QP  + +E  D+++ LF LLL               RS  M                           N    + L  ++ ACLFS+ +A G+    L AV+ +L  NG       IQ P ++  L++             +W  N  +   +  ++ L     D+     L ++G++L+ L   GL K+G+G++G+++G VY +   +   K    W+G    
Sbjct:  129 KLPKIIGIGLCGVFELIKETRFSHPSLCLRSLQALLDMLQGQQPESFQTEPPDVLESLFHLLL-----------ETTVRSTGM---------------------------NDPTGQTLTALSCACLFSLVVAWGDTGKTLQAVSAILTNNG-SHACQTIQVPTILNALQRSVQAVLVGKIQIQEWFGNGIKRAALMNKWVLKEVNIDDDEHCLLQTDGSFLYLLCKDGLYKVGSGYSGTVRGHVYNSTSRIRNRKEKRSWLGFAQG 355          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Zebrafish
Match: si:ch211-281g13.5 (si:ch211-281g13.5 [Source:ZFIN;Acc:ZDB-GENE-090311-7])

HSP 1 Score: 69.707 bits (169), Expect = 9.570e-11
Identity = 55/210 (26.19%), Postives = 89/210 (42.38%), Query Frame = 1
Query: 1708 CSKDNLALVSKEGQVLFLEKDSI-HSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCGCVSVDNDGKYNEIMQEIDNNNVDSCSQIRSKHQVPTIKPQKLLIYSDTNASSGIKNRSNFLRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVVPIQC--KSVRITTGSFSTGILSQNGKVFIFGN 2328
            C +    L++ +G+VL +++ ++   L +     L    V QI+ G  H   LS +G L  +G N + Q G                              K Q  T  PQ L    +             + + QIS G  H+ +L+++G V+ +G+N   QLG G   ++ +P +V   C  K+V I+ G   T  LS+ G VF FG+
Sbjct:   83 CGEAGAVLLADDGKVLIMDQSTVCRPLKS-----LENRQVIQIACGDQHSMALSNDGQLFVWGENTHGQLGL----------------------------RKEQAGTQSPQHLQSLCE-------------IPVAQISAGGNHSFVLSLSGVVFGWGSNSAGQLGLGDTKDRFVPTIVKSLCGKKTVSISCGGEHTATLSKGGTVFTFGS 246          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Xenopus
Match: vim (vimentin [Source:Xenbase;Acc:XB-GENE-493024])

HSP 1 Score: 424.476 bits (1090), Expect = 9.543e-118
Identity = 375/1276 (29.39%), Postives = 571/1276 (44.75%), Query Frame = 1
Query: 9331 MRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLL--------EKHKSIDKSNKPQISLIEEKNLKVYSQQLWAV---GSAV------FYRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINF-EKSQVFSCLSELLNHLDDS---KVFNGRIISTHENSIKINSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTA----IYQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKE--LQDNHDIESKS-----LHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILF----------GVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAGKSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSH-------------CDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENP-------NLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKP-SDQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + F + +  +  L +A++ +LR      ++ + + WLL NV   +SL  ++W     L        E     +K+NK      +EK+ +V    L  +   G A       F+R+L  I               L +M ++  SL          F QS   F  +S VF  ++ +L+  DD    + FN  + S  E S  +    D+T +     +S      SL D +T+ FWES   + +    I +     C + I  +   VSV++D +RD+ N   + T    KT       +Q  ++  HIGW++  L   +   N I I                G  N  +RVR VKVL   +  +     +      +    + ETL+ F  +T+ +F    +   +   E++E  L  + + E K+     L + +V I+F     T  + +V +            HI+  I +E  ++  + +       N N   ++      D +  + CF+LL+ VLALSG+  G +YL  Q  L++DL  LL+  S ++++QV   + R+   V+P  L  I+            +IH  E  +   + I        L++ +    K+L++Q+K+K    +               LP    +S+               +  +  I +LI  ++  +   AW    +     I E  +A+ +  +   + +P        L+  +  L + +     +  + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + TK H R     +  + K         V+ HE C R K    +   D+ T+K ++   +                       +  KP S  +E CRFC   +    +     C   +CQ  +  ACS K   CGH C GV    KNE      C P C+   C   +T     LKQD DD+CMICFT+ LS  P I L+ C H+ H  C RR ++  W G R++F F  CP CK KI H  L+DLL+P   L ++V+RKAL+RLE+EGL  S  +          P  +A+++Y YY+CYKCK +Y+GGEARC+ +                  DP  EL C ACSDV++A++CPKH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct: 3273 LAFVIQHHDLEGLEIAMKQALRKSACRVFAMEAFNWLLCNVIQTTSLHDILWHFVASLTPAPVEPEEDEDEENKANKENAE--QEKDTRVCEHPLSDIVIAGEAAHPLPDTFHRLLQTISDLMMSLPGGS---SLQQMALRCWSL---------KFKQSDHQFLHQSNVFRHINNILSKSDDGDSEESFNISVQSGFEGSCLVTGLKDMTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKSITIN----CVKGI--NTRYVSVHIDNSRDLGNKVTSLTFLSGKTVEDLCRIKQADLDSRHIGWVTSELPGGDN--NIIKIEL-------------KGPEN-TLRVRQVKVLGWKDGETIKIPGQISASVAQQRNCESETLRVFRLITSQVFGKLISGDAEPTPEQEEKTLLSSPEGEEKAPSDADLKEHMVGIIFSRSKLTNLQKQVCA------------HIVQAIRMEAMRVREEWEHAISSKENANSQPND-----EDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFHLLHTASPRVQRQVTSLLRRVLPEVTPSRLASIIGVKSLPPADISDIIHSTEKGDWNKMGI--------LDMFLGCIAKALTVQLKAKGTPIKGTAGTSAGKGVTTVTLPMIFNSSYLRRGESHWWMKGSTPTQISEIIIKLIKDMAAGHLSEAWSRVTKN---AIAETIIALTKMEE--EYRSPVRCIATTRLWLAVASLCVLDQ----DHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNACG------------------NLCTDCDRFLHLHRRTKSHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFRE-----------------------QTGKPASSSSETCRFCGSRNGTELSAVGSVCSDSDCQEYAKTACS-KTHSCGHPCGGV----KNEDH----CLP-CLH-GCDKNAT----SLKQDADDMCMICFTEALSAAPAIQLD-CSHVFHMQCCRRVLENRWLGPRITFGFMSCPICKNKINHTVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSDAITTPGVRFYNDPASYAMNRYAYYVCYKCKKAYFGGEARCDAE-----------AGQGDDYDP-RELICGACSDVSRAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSLPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF 4400          

HSP 2 Score: 165.622 bits (418), Expect = 1.625e-39
Identity = 242/1037 (23.34%), Postives = 426/1037 (41.08%), Query Frame = 1
Query: 2098 LRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVV-PIQCKSVRITTGSFSTGILSQNGKVFIFGN----KITSPQIIDLISNPNDLTDNLQPIFFNFSTNNYKKQIIFCILKQNIFYMKRKPLTLSTHRKSYHQDQFKFLAKDNTILLT---LDEQ---RGLLINISSGTIKIMPDYDEGNFSSLMNSYFDPRYSVLWSIDSGHGSKK----FTVKYSKSNIFQSDNFQDKFDQL---IDLPDDISFSSQRYRIALNVL------VSAEKLLLKKYADPQNNNQIKTVDSNKEIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMP----DIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYPFNGKFNELCHLEETLVKIPSLGYSKDTESQETSVVIGDFRIIVRNIFLECKICHYLQSIKSTYGAESLIYAECWKLFTEDLIPVYKETFEHSFHAFYPEIEDQRFTLQEAL----LKVYEFCFNKSTDTLCNYGKIMFLTSLLTAI-NSANEGFLIF--THKDNSVTRSGENKINGENN--FAHRFPLLREYMRTIWKPSTPCSSDILASTSTMIHCLLAIITLDIKTAYKTCKQINSSSTTENDVSEKKLFQQEMTNLINASHQILTNITRLLVDQLN--HSAKTPAFRMSQVNSTNSKQNGHNNNQTYLEDIILTTQSRFKRVVWLDKSAENSRQKFVEQAINVAEQEIEDVICFAINKNTYQFINGFEVVGDNVIYLEGIKVYCSNFTESRCLAYIYRIKNFQEGIREKWELIPMEYEWKNEEQDLIASDLIFKRKLKLEESYRYAVKV 5091
            LR  Q+SCG +H+VIL  NGDVY+FG  +  QLG G +S +  P ++  +   S ++T GS  T +L  +G+VF FG+    ++  P I+D+         N +P       + Y ++  +     +  +++     +++H  +  +      A  + I L    + E    + LLIN   G      D ++ +         DP + V+W      GS K    +    + S +  + + Q +   L   + LP      + R   AL++L       + + L +   +  +    +  V S ++   V RF      W YS ++ ++I+F     I + G+GL+ G GE T  IK++E  G D             ++T      L  ETD V   +   ++   +M   P++L +   YV  A ++G S+D G HG++ I TD GV F+FK SK S+NGT V  GQIP++ Y  R+P       K K    +  + +  +      +  +S++   S +++L+W +T L     EL  L+       Y+  LL  LE L+      T  L++++ +I  +YP +     +  +EET         SK  E       IG  R ++R I  E      + +  +    +   Y        E ++     TF   FH+FYP    Q   L + L      + E  F  S+  L        L ++++A+ N++ +   IF   +    + RS   +++ EN+   AHRFPLL   M  + +     S   + S   ++  +L I+ L ++ + +   ++ SS    N          E+T     S           VD LN  HS K+   R ++ +   S   G+ +                                              D ICF+++K     + GF V G   I+   ++V   +   S   A+ +R  +         EL+   Y   +   D+  +++   + + L+E+ +YAV++
Sbjct:  784 LRAVQVSCGFHHSVILMENGDVYTFGYGQHGQLGHGDVSCRGCPTLIQALPGPSTQVTAGSNHTAVLLMDGQVFTFGSFSKGQLGRP-ILDVPYW------NAKPAPMPNIGSKYGRKATWVGASGDQTFLRIDEALINSHVLATSE----IFASRHIIGLVPAYMTEPPPFKCLLINKVDGNCATFNDSEQEDLQGF-GVCLDPIHDVIWRF---QGSTKELWCYNAVIADSRLPSAPDMQLRCSILSPELALPIGQKAVTTRSHAALHILGCLDTLAAMQDLKMGVSSIEEETQSVMKVYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFCADTDILLGGLGLFGGRGEYTAKIKLFE-LGPDGG----------DHETDGD---LLAETD-VLAYDCAAREKYAMMFDEPVLLQAGWWYVAWARVSGPSSDCGSHGQASITTDDGVVFQFKSSKKSNNGTDVNAGQIPQLLY--RLPTSDGSATKGKPQTTEPVHILKRS-----FARTVSVDCFESLLSILHWSWTTLVLGVEELRSLK----GFQYTATLL-DLERLRFVG---TCCLRLLKVYICEIYPVSATTKAV--VEET---------SKLAE------CIGKTRTLLRKILSE-----GVDNCMTKLDNDPEGYLSQPMSLLEAVLQECHNTFTACFHSFYPTPALQWACLCDLLNCLDQDIQEANFKPSSSRL--------LAAVMSALCNTSVKLTSIFPIAYDGEVLLRSMVKQVSTENDTALAHRFPLLVSAMEKLSQTEENVSG--ITSFREVLEKMLVIVVLPVRNSLRRENELFSSHLVSNTCGLLASIVSELTASALGSE----------VDGLNSLHSVKSSPNRFTKTSQGRSWNTGNGS---------------------------------------------PDAICFSVDKPGLVVV-GFCVYGGGGIHEYELEVLVDDSDHSGDAAHSHRWTSL--------ELMKGTYTTDDSPSDI--AEIRLDKAVPLKENMKYAVRL 1677          

HSP 3 Score: 113.62 bits (283), Expect = 7.928e-24
Identity = 133/591 (22.50%), Postives = 251/591 (42.47%), Query Frame = 1
Query:  247 KTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKKC-----------SDWSNRNQEIPVSEQFCLINQLPDNVTSESLI-SNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELA--KYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKITNFHGFPSTPGWKYYLFANYTKLGCCLINEDETYSEQLFMKLFKLNSEKFLVEECE-KSIDMTQHL--ILKFEIEQSKIFSNPSTLIETCPSLSLACEVLNL-EEFCVVRNQSGEIF----YKDIDNVERNNNVENWTRLLYTDYVAAKFHKLIGGIDNKFICAISDDGL------------WRININRHSQPRTLCLDRLMPNSRFISKTWASGSCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            K PKI+ + L  +++ I++T  S+P +C + LQ++L  L+  QP    SE  ++++ L +L+L I       T R                                   N S  + L  ++ ACLFS+ ++ G    +L A++ +L  NG     + IQ P ++  L++             DW     +     Q   +  +P +   + L+ S+G +L+ L   GL KIG+G++G+++G +Y +   +   +    W+G     +L             + +T  +IN + L+ DG V +   N  G       +  LF++   +     ++D+ +     +++F  ++E  L +E + K      H   I  F++E+         +I T     LA  VL    EF +++  SG+++    Y+ +   +   +   W  L  T   + K  +   G D       +DDG                  +R           +  + + +  T    +C+  + +++SK+G++    KD+I+S S+     L  + VTQ+++GK+H   L++ G + TFGVNN  QCG
Sbjct:   79 KLPKIIEIGLCEVFELIKETRFSHPSLCLRSLQALLNVLQGQQPEGLQSEPPEVLESLLQLILEI-------TVRSTGS-------------------------------NDSTGQTLTAVSCACLFSLVVSWGETGKILQAISAILTNNGSHACQN-IQVPTILNSLQRSVQAVLVGKIQIQDWFTSGIKKAALMQKWSLRDIPVDEDEQCLLQSDGFFLYLLCKDGLYKIGSGYSGTVRGHIYNSTSRIKSRREKKSWLGYAQGYLLYRD-------TSNQGMTAKRINPETLEQDGTVTVPDGNTDG-------QNILFSDGEFINQIAASKDDGF----VVRIFATSTEPVLQQELQLKLARKCLHACGISLFDLEKDL------HIISTGFDEELA--VLGAGREFALMKTASGKVYYTGKYQSLGIKQGGPSTGKWVELPITK--SPKIVQFSVGHDGSHALLTADDGSVFFTGTASKGEDGESTKSRRQSKPYKPKKMMKMDGKIVVAT----ACNNGSSSIISKDGELYMFGKDAIYSDSSNLVTDLKGHVVTQVAMGKAHTCVLTKKGEVWTFGVNNKGQCG 598          

HSP 4 Score: 98.9821 bits (245), Expect = 2.097e-19
Identity = 108/458 (23.58%), Postives = 190/458 (41.48%), Query Frame = 1
Query: 5836 GNEIAIEFHTASLY-EESLESTYGFKCSIVGH--------CSKIDAFIELLENALTYLASRCATSLLEFRKKSKVIKLLHETNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSCSSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQVTSQMSNIEV----------------LFNYNHKGNNPF---ININEKLFGGHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIR-AAGFQETVCKSQRIKYRWSEEENSFFID---WIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNKDKNDKPKYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQW 7113
            GNE      TAS Y ++   S YGFKC  +G+        C     ++E L     ++ S       E  +  +++    E   LQ C+ +  IL +GL+LS  PT+ + L  S    I S + +F++ F+      P +S      +L++WLQ                   P  Y D  K    T+++ N+          + ++  DQY + V      +EV                +  +     +P     +  +  FGG P P     +E  I+ +  Y +ITMMK YE +SFEE+R A+   +   ++  I+      + ++  D   W+            ID I          + +K+      +V  G  + ++ ++E   +K  K     F  K S+GLR+RS PS  S  +GI+  N  + + +E+  ++ VW+RL+ ++  ++
Sbjct: 1805 GNEAVFSLETASDYVKDEKASFYGFKCFAIGYEYSPGSDECLFFSFYVEKLNFQFIFIGS-------ELEEDLEIV----EEAALQVCKTHSGILGKGLALSHSPTILEALEGSLPLQIQSNEQSFLEDFI---TCVPGSS----GGRLARWLQ-------------------PDSYADPQK----TSLILNKDDVRCGWPTTITVQTKDQYGDVVHVPNMKVEVKAVPVSQKKTSLQQEQVKKFPRIPGSPSTTNTSGTDMTFGGLPSPKLDASYEPMIVKEARYIAITMMKAYENYSFEELRYASPMPKRPSENMLIRV---NNDGTYLFDLFMWL------------IDGIYA-------GLEVKVKDPPKGMVPPG-TQLVKPKSEPQPNKVRK-----FVAKDSAGLRIRSHPSLQSEQIGIVKVNGTIAFVDEIHNDDGVWLRLNDETVKKY 2193          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Xenopus
Match: vim (vimentin [Source:Xenbase;Acc:XB-GENE-493024])

HSP 1 Score: 424.091 bits (1089), Expect = 1.064e-117
Identity = 376/1276 (29.47%), Postives = 572/1276 (44.83%), Query Frame = 1
Query: 9331 MRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLL--------EKHKSIDKSNKPQISLIEEKNLKVYSQQLWAV---GSAV------FYRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINF-EKSQVFSCLSELLNHLDDS---KVFNGRIISTHENSIKINSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTA----IYQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKE--LQDNHDIESKS-----LHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILF----------GVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAGKSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSH-------------CDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENP-------NLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKP-SDQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + F + +  +  L +A++ +LR      ++ + + WLL NV   +SL  ++W     L        E     +K+NK      +EK+ +V    L  +   G A       F+R+L  I           S   L +M ++  SL          F QS   F  +S VF  ++ +L+  DD    + FN  + S  E S  +    D+T +     +S      SL D +T+ FWES   + +    I +     C + I  +   VSV++D +RD+ N   + T    KT       +Q  ++  HIGW++  L   +   N I I                G  N  +RVR VKVL   +  +     +      +    + ETL+ F  +T+ +F    +   +   E++E  L  + + E K+     L + +V I+F     T  + +V +            HI+  I +E  ++  + +       N N   ++      D +  + CF+LL+ VLALSG+  G +YL  Q  L++DL  LL+  S ++++QV   + R+   V+P  L  I+            +IH  E  +   + I        L++ +    K+L++Q+K+K    +               LP    +S+               +  +  I +LI  ++  +   AW    +     I E  +A+ +  +   + +P        L+  +  L + +     +  + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + TK H R     +  + K         V+ HE C R K    +   D+ T+K ++   +                       +  KP S  +E CRFC   +    +     C   +CQ  +  ACS K   CGH C GV    KNE      C P C+   C   +T     LKQD DD+CMICFT+ LS  P I L+ C H+ H  C RR ++  W G R++F F  CP CK KI H  L+DLL+P   L ++V+RKAL+RLE+EGL  S  +          P  +A+++Y YY+CYKCK +Y+GGEARC+ +                  DP  EL C ACSDV++A++CPKH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct: 3188 LAFVIQHHDLEGLEIAMKQALRKSACRVFAMEAFNWLLCNVIQTTSLHDILWHFVASLTPAPVEPEEDEDEENKANKENAE--QEKDTRVCEHPLSDIVIAGEAAHPLPDTFHRLLQTISDLMMSLPGGSS---LQQMALRCWSL---------KFKQSDHQFLHQSNVFRHINNILSKSDDGDSEESFNISVQSGFEGSCLVTGLKDMTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKSITIN----CVKGI--NTRYVSVHIDNSRDLGNKVTSLTFLSGKTVEDLCRIKQADLDSRHIGWVTSELPGGDN--NIIKIEL-------------KGPEN-TLRVRQVKVLGWKDGETIKIPGQISASVAQQRNCESETLRVFRLITSQVFGKLISGDAEPTPEQEEKTLLSSPEGEEKAPSDADLKEHMVGIIFSRSKLTNLQKQVCA------------HIVQAIRMEAMRVREEWEHAISSKENANSQPND-----EDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFHLLHTASPRVQRQVTSLLRRVLPEVTPSRLASIIGVKSLPPADISDIIHSTEKGDWNKMGI--------LDMFLGCIAKALTVQLKAKGTPIKGTAGTSAGKGVTTVTLPMIFNSSYLRRGESHWWMKGSTPTQISEIIIKLIKDMAAGHLSEAWSRVTKN---AIAETIIALTKMEE--EYRSPVRCIATTRLWLAVASLCVLDQ----DHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNACG------------------NLCTDCDRFLHLHRRTKSHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFRE-----------------------QTGKPASSSSETCRFCGSRNGTELSAVGSVCSDSDCQEYAKTACS-KTHSCGHPCGGV----KNEDH----CLP-CL-HGCDKNAT----SLKQDADDMCMICFTEALSAAPAIQLD-CSHVFHMQCCRRVLENRWLGPRITFGFMSCPICKNKINHTVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSDAITTPGVRFYNDPASYAMNRYAYYVCYKCKKAYFGGEARCDAE-----------AGQGDDYDP-RELICGACSDVSRAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSLPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF 4315          

HSP 2 Score: 163.696 bits (413), Expect = 6.131e-39
Identity = 242/1039 (23.29%), Postives = 427/1039 (41.10%), Query Frame = 1
Query: 2098 LRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVV-PIQCKSVRITTGSFSTGILSQNGKVFIFGN----KITSPQIIDLISNPNDLTDNLQPIFFNFSTNNYKKQIIFCILKQNIFYMKRKPLTLSTHRKSYHQDQFKFLAKDNTILLT---LDEQ---RGLLINISSGTIKIMPDYDEGNFSSLMNSYFDPRYSVLWSIDSGHGSKK----FTVKYSKSNIFQSDNFQDKFDQL---IDLPDDISFSSQRYRIALNVL------VSAEKLLLKKYADPQNNNQIKTVDSNKEIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMP----DIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYPFNGKFNELCHLEETLVKIPSLGYSKDTESQETSVVIGDFRIIVRNIFLECKICHYLQSIKSTYGAESLIYAECWKLFTEDLIPVYKETFEHSFHAFYPEIEDQRFTLQEAL----LKVYEFCFNKSTDTLCNYGKIMFLTSLLTAI-NSANEGFLIF--THKDNSVTRSGENKINGENN--FAHRFPLLREYMRTIWKPSTPCSSDILASTSTMIHCLLAIITLDIKTAYKTCKQINSSSTTENDVSEKKLFQQEMTNLINASHQILTNITRLLVDQLN--HSAKTPAFRMSQVNSTNSKQNGHNNNQTYLEDIILTTQSRFKRVVWLDKSAENSRQKFVEQAINVAEQEIEDVICFAINKNTYQFINGFEVVGDNVIYLEGIKVYCSNFT--ESRCLAYIYRIKNFQEGIREKWELIPMEYEWKNEEQDLIASDLIFKRKLKLEESYRYAVKV 5091
            LR  Q+SCG +H+VIL  NGDVY+FG  +  QLG G +S +  P ++  +   S ++T GS  T +L  +G+VF FG+    ++  P I+D+         N +P       + Y ++  +     +  +++     +++H  +  +      A  + I L    + E    + LLIN   G      D ++ +         DP + V+W      GS K    +    + S +  + + Q +   L   + LP      + R   AL++L       + + L +   +  +    +  V S ++   V RF      W YS ++ ++I+F     I + G+GL+ G GE T  IK++E  G D             ++T      L  ETD V   +   ++   +M   P++L +   YV  A ++G S+D G HG++ I TD GV F+FK SK S+NGT V  GQIP++ Y  R+P       K K    +  + +  +      +  +S++   S +++L+W +T L     EL  L+       Y+  LL  LE L+      T  L++++ +I  +YP +     +  +EET         SK  E       IG  R ++R I  E      + +  +    +   Y        E ++     TF   FH+FYP    Q   L + L      + E  F  S+  L        L ++++A+ N++ +   IF   +    + RS   +++ EN+   AHRFPLL   M  + +     S   + S   ++  +L I+ L ++ + +   ++ SS    N          E+T     S           VD LN  HS K+   R ++ +   S   G+ +                                              D ICF+++K     + GF V G   I+   ++V   + +   S   A+ +R  +         EL+   Y   +   D+  +++   + + L+E+ +YAV++
Sbjct:  844 LRAVQVSCGFHHSVILMENGDVYTFGYGQHGQLGHGDVSCRGCPTLIQALPGPSTQVTAGSNHTAVLLMDGQVFTFGSFSKGQLGRP-ILDVPYW------NAKPAPMPNIGSKYGRKATWVGASGDQTFLRIDEALINSHVLATSE----IFASRHIIGLVPAYMTEPPPFKCLLINKVDGNCATFNDSEQEDLQGF-GVCLDPIHDVIWRF---QGSTKELWCYNAVIADSRLPSAPDMQLRCSILSPELALPIGQKAVTTRSHAALHILGCLDTLAAMQDLKMGVSSIEEETQSVMKVYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFCADTDILLGGLGLFGGRGEYTAKIKLFE-LGPDGG----------DHETDGD---LLAETD-VLAYDCAAREKYAMMFDEPVLLQAGWWYVAWARVSGPSSDCGSHGQASITTDDGVVFQFKSSKKSNNGTDVNAGQIPQLLY--RLPTSDGSATKGKPQTTEPVHILKRS-----FARTVSVDCFESLLSILHWSWTTLVLGVEELRSLK----GFQYTATLL-DLERLRFVG---TCCLRLLKVYICEIYPVSATTKAV--VEET---------SKLAE------CIGKTRTLLRKILSE-----GVDNCMTKLDNDPEGYLSQPMSLLEAVLQECHNTFTACFHSFYPTPALQWACLCDLLNCLDQDIQEANFKPSSSRL--------LAAVMSALCNTSVKLTSIFPIAYDGEVLLRSMVKQVSTENDTALAHRFPLLVSAMEKLSQTEENVSG--ITSFREVLEKMLVIVVLPVRNSLRRENELFSSHLVSNTCGLLASIVSELTASALGSE----------VDGLNSLHSVKSSPNRFTKTSQGRSWNTGNGS---------------------------------------------PDAICFSVDKPGLVVV-GFCVYGGGGIHEYELEVLVDDVSIDHSGDAAHSHRWTSL--------ELMKGTYTTDDSPSDI--AEIRLDKAVPLKENMKYAVRL 1739          

HSP 3 Score: 120.553 bits (301), Expect = 8.100e-26
Identity = 128/534 (23.97%), Postives = 213/534 (39.89%), Query Frame = 1
Query: 5836 GNEIAIEFHTASLY-EESLESTYGFKCSIVGH--------CSKIDAFIELLENALTYLASRCATSLLEFRKKSKVIKLLHETNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSCSSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQVTSQMSNIEV----------------LFNYNHKGNNPFI---NINEKLFGGHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIR-AAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNKDKNDKPKYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLK--EHLNKIFLTPAKI 7344
            GNE      TAS Y ++   S YGFKC  +G+        C     ++E L     ++ S       E  +  +++    E   LQ C+ +  IL +GL+LS  PT+ + L  S    I S + +F++ F+      P +S      +L++WLQ                   P  Y D  K    T+++ N+          + ++  DQY + V      +EV                +  +     +P     +  +  FGG P P     +E  I+ +  Y +ITMMK YE +SFEE+R A+   +   ++  I+      + ++  +W P A G Y + +TID I     +    + +K+      +V  G  + ++ ++E   +K  K     F  K S+GLR+RS PS  S  +GI+  N  + + +E+  ++ VW+RL                              N ET+                   KK V  N+  + E WCL   +HL K  L P  +
Sbjct: 1858 GNEAVFSLETASDYVKDEKASFYGFKCFAIGYEYSPGSDECLFFSFYVEKLNFQFIFIGS-------ELEEDLEIV----EEAALQVCKTHSGILGKGLALSHSPTILEALEGSLPLQIQSNEQSFLEDFI---TCVPGSS----GGRLARWLQ-------------------PDSYADPQK----TSLILNKDDVRCGWPTTITVQTKDQYGDVVHVPNMKVEVKAVPVSQKKTSLQQEQVKKFPRIPGSPSTTNTSGTDMTFGGLPSPKLDASYEPMIVKEARYIAITMMKAYENYSFEELRYASPMPKRPSENMLIRV---NNDGTYCANWTPGAVGLYTIHVTIDGI-----EIDAGLEVKVKDPPKGMVPPG-TQLVKPKSEPQPNKVRK-----FVAKDSAGLRIRSHPSLQSEQIGIVKVNGTIAFVDEIHNDDGVWLRL------------------------------NDETV-------------------KKYVH-NMNGYNEAWCLSFNQHLGKSLLAPVDV 2286          

HSP 4 Score: 77.7962 bits (190), Expect = 5.534e-13
Identity = 70/306 (22.88%), Postives = 132/306 (43.14%), Query Frame = 1
Query:  247 KTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKKC-----------SDWSNRNQEIPVSEQFCLINQLPDNVTSESLI-SNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELA--KYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKIT 1122
            K PKI+ + L  +++ I++T  S+P +C + LQ++L  L+  QP    SE  ++++ L +L+L I       T R                                   N S  + L  ++ ACLFS+ ++ G    +L A++ +L  NG     + IQ P ++  L++             DW     +     Q   +  +P +   + L+ S+G +L+ L   GL KIG+G++G+++G +Y +   +   +    W+G     +L             + +T  +IN + L+ DG V + + 
Sbjct:  134 KLPKIIEIGLCEVFELIKETRFSHPSLCLRSLQALLNVLQGQQPEGLQSEPPEVLESLLQLILEI-------TVRSTGS-------------------------------NDSTGQTLTAVSCACLFSLVVSWGETGKILQAISAILTNNGSHACQN-IQVPTILNSLQRSVQAVLVGKIQIQDWFTSGIKKAALMQKWSLRDIPVDEDEQCLLQSDGFFLYLLCKDGLYKIGSGYSGTVRGHIYNSTSRIKSRREKKSWLGYAQGYLLYRD-------TSNQGMTAKRINPETLEQDGTVTVPVA 393          

HSP 5 Score: 58.151 bits (139), Expect = 5.675e-7
Identity = 27/71 (38.03%), Postives = 47/71 (66.20%), Query Frame = 1
Query: 1705 SCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            +C+  + +++SK+G++    KD+I+S S+     L  + VTQ+++GK+H   L++ G + TFGVNN  QCG
Sbjct:  552 ACNNGSSSIISKDGELYMFGKDAIYSDSSNLVTDLKGHVVTQVAMGKAHTCVLTKKGEVWTFGVNNKGQCG 622          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Xenopus
Match: vim (vimentin [Source:Xenbase;Acc:XB-GENE-493024])

HSP 1 Score: 424.091 bits (1089), Expect = 1.098e-117
Identity = 376/1276 (29.47%), Postives = 572/1276 (44.83%), Query Frame = 1
Query: 9331 MRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLL--------EKHKSIDKSNKPQISLIEEKNLKVYSQQLWAV---GSAV------FYRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINF-EKSQVFSCLSELLNHLDDS---KVFNGRIISTHENSIKINSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTA----IYQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKE--LQDNHDIESKS-----LHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILF----------GVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAGKSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSH-------------CDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENP-------NLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKP-SDQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + F + +  +  L +A++ +LR      ++ + + WLL NV   +SL  ++W     L        E     +K+NK      +EK+ +V    L  +   G A       F+R+L  I           S   L +M ++  SL          F QS   F  +S VF  ++ +L+  DD    + FN  + S  E S  +    D+T +     +S      SL D +T+ FWES   + +    I +     C + I  +   VSV++D +RD+ N   + T    KT       +Q  ++  HIGW++  L   +   N I I                G  N  +RVR VKVL   +  +     +      +    + ETL+ F  +T+ +F    +   +   E++E  L  + + E K+     L + +V I+F     T  + +V +            HI+  I +E  ++  + +       N N   ++      D +  + CF+LL+ VLALSG+  G +YL  Q  L++DL  LL+  S ++++QV   + R+   V+P  L  I+            +IH  E  +   + I        L++ +    K+L++Q+K+K    +               LP    +S+               +  +  I +LI  ++  +   AW    +     I E  +A+ +  +   + +P        L+  +  L + +     +  + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + TK H R     +  + K         V+ HE C R K    +   D+ T+K ++   +                       +  KP S  +E CRFC   +    +     C   +CQ  +  ACS K   CGH C GV    KNE      C P C+   C   +T     LKQD DD+CMICFT+ LS  P I L+ C H+ H  C RR ++  W G R++F F  CP CK KI H  L+DLL+P   L ++V+RKAL+RLE+EGL  S  +          P  +A+++Y YY+CYKCK +Y+GGEARC+ +                  DP  EL C ACSDV++A++CPKH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct: 3260 LAFVIQHHDLEGLEIAMKQALRKSACRVFAMEAFNWLLCNVIQTTSLHDILWHFVASLTPAPVEPEEDEDEENKANKENAE--QEKDTRVCEHPLSDIVIAGEAAHPLPDTFHRLLQTISDLMMSLPGGSS---LQQMALRCWSL---------KFKQSDHQFLHQSNVFRHINNILSKSDDGDSEESFNISVQSGFEGSCLVTGLKDMTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKSITIN----CVKGI--NTRYVSVHIDNSRDLGNKVTSLTFLSGKTVEDLCRIKQADLDSRHIGWVTSELPGGDN--NIIKIEL-------------KGPEN-TLRVRQVKVLGWKDGETIKIPGQISASVAQQRNCESETLRVFRLITSQVFGKLISGDAEPTPEQEEKTLLSSPEGEEKAPSDADLKEHMVGIIFSRSKLTNLQKQVCA------------HIVQAIRMEAMRVREEWEHAISSKENANSQPND-----EDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFHLLHTASPRVQRQVTSLLRRVLPEVTPSRLASIIGVKSLPPADISDIIHSTEKGDWNKMGI--------LDMFLGCIAKALTVQLKAKGTPIKGTAGTSAGKGVTTVTLPMIFNSSYLRRGESHWWMKGSTPTQISEIIIKLIKDMAAGHLSEAWSRVTKN---AIAETIIALTKMEE--EYRSPVRCIATTRLWLAVASLCVLDQ----DHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNACG------------------NLCTDCDRFLHLHRRTKSHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFRE-----------------------QTGKPASSSSETCRFCGSRNGTELSAVGSVCSDSDCQEYAKTACS-KTHSCGHPCGGV----KNEDH----CLP-CLH-GCDKNAT----SLKQDADDMCMICFTEALSAAPAIQLD-CSHVFHMQCCRRVLENRWLGPRITFGFMSCPICKNKINHTVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSDAITTPGVRFYNDPASYAMNRYAYYVCYKCKKAYFGGEARCDAE-----------AGQGDDYDP-RELICGACSDVSRAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSLPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF 4387          

HSP 2 Score: 165.622 bits (418), Expect = 1.679e-39
Identity = 242/1037 (23.34%), Postives = 426/1037 (41.08%), Query Frame = 1
Query: 2098 LRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVV-PIQCKSVRITTGSFSTGILSQNGKVFIFGN----KITSPQIIDLISNPNDLTDNLQPIFFNFSTNNYKKQIIFCILKQNIFYMKRKPLTLSTHRKSYHQDQFKFLAKDNTILLT---LDEQ---RGLLINISSGTIKIMPDYDEGNFSSLMNSYFDPRYSVLWSIDSGHGSKK----FTVKYSKSNIFQSDNFQDKFDQL---IDLPDDISFSSQRYRIALNVL------VSAEKLLLKKYADPQNNNQIKTVDSNKEIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMP----DIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYPFNGKFNELCHLEETLVKIPSLGYSKDTESQETSVVIGDFRIIVRNIFLECKICHYLQSIKSTYGAESLIYAECWKLFTEDLIPVYKETFEHSFHAFYPEIEDQRFTLQEAL----LKVYEFCFNKSTDTLCNYGKIMFLTSLLTAI-NSANEGFLIF--THKDNSVTRSGENKINGENN--FAHRFPLLREYMRTIWKPSTPCSSDILASTSTMIHCLLAIITLDIKTAYKTCKQINSSSTTENDVSEKKLFQQEMTNLINASHQILTNITRLLVDQLN--HSAKTPAFRMSQVNSTNSKQNGHNNNQTYLEDIILTTQSRFKRVVWLDKSAENSRQKFVEQAINVAEQEIEDVICFAINKNTYQFINGFEVVGDNVIYLEGIKVYCSNFTESRCLAYIYRIKNFQEGIREKWELIPMEYEWKNEEQDLIASDLIFKRKLKLEESYRYAVKV 5091
            LR  Q+SCG +H+VIL  NGDVY+FG  +  QLG G +S +  P ++  +   S ++T GS  T +L  +G+VF FG+    ++  P I+D+         N +P       + Y ++  +     +  +++     +++H  +  +      A  + I L    + E    + LLIN   G      D ++ +         DP + V+W      GS K    +    + S +  + + Q +   L   + LP      + R   AL++L       + + L +   +  +    +  V S ++   V RF      W YS ++ ++I+F     I + G+GL+ G GE T  IK++E  G D             ++T      L  ETD V   +   ++   +M   P++L +   YV  A ++G S+D G HG++ I TD GV F+FK SK S+NGT V  GQIP++ Y  R+P       K K    +  + +  +      +  +S++   S +++L+W +T L     EL  L+       Y+  LL  LE L+      T  L++++ +I  +YP +     +  +EET         SK  E       IG  R ++R I  E      + +  +    +   Y        E ++     TF   FH+FYP    Q   L + L      + E  F  S+  L        L ++++A+ N++ +   IF   +    + RS   +++ EN+   AHRFPLL   M  + +     S   + S   ++  +L I+ L ++ + +   ++ SS    N          E+T     S           VD LN  HS K+   R ++ +   S   G+ +                                              D ICF+++K     + GF V G   I+   ++V   +   S   A+ +R  +         EL+   Y   +   D+  +++   + + L+E+ +YAV++
Sbjct:  824 LRAVQVSCGFHHSVILMENGDVYTFGYGQHGQLGHGDVSCRGCPTLIQALPGPSTQVTAGSNHTAVLLMDGQVFTFGSFSKGQLGRP-ILDVPYW------NAKPAPMPNIGSKYGRKATWVGASGDQTFLRIDEALINSHVLATSE----IFASRHIIGLVPAYMTEPPPFKCLLINKVDGNCATFNDSEQEDLQGF-GVCLDPIHDVIWRF---QGSTKELWCYNAVIADSRLPSAPDMQLRCSILSPELALPIGQKAVTTRSHAALHILGCLDTLAAMQDLKMGVSSIEEETQSVMKVYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFCADTDILLGGLGLFGGRGEYTAKIKLFE-LGPDGG----------DHETDGD---LLAETD-VLAYDCAAREKYAMMFDEPVLLQAGWWYVAWARVSGPSSDCGSHGQASITTDDGVVFQFKSSKKSNNGTDVNAGQIPQLLY--RLPTSDGSATKGKPQTTEPVHILKRS-----FARTVSVDCFESLLSILHWSWTTLVLGVEELRSLK----GFQYTATLL-DLERLRFVG---TCCLRLLKVYICEIYPVSATTKAV--VEET---------SKLAE------CIGKTRTLLRKILSE-----GVDNCMTKLDNDPEGYLSQPMSLLEAVLQECHNTFTACFHSFYPTPALQWACLCDLLNCLDQDIQEANFKPSSSRL--------LAAVMSALCNTSVKLTSIFPIAYDGEVLLRSMVKQVSTENDTALAHRFPLLVSAMEKLSQTEENVSG--ITSFREVLEKMLVIVVLPVRNSLRRENELFSSHLVSNTCGLLASIVSELTASALGSE----------VDGLNSLHSVKSSPNRFTKTSQGRSWNTGNGS---------------------------------------------PDAICFSVDKPGLVVV-GFCVYGGGGIHEYELEVLVDDSDHSGDAAHSHRWTSL--------ELMKGTYTTDDSPSDI--AEIRLDKAVPLKENMKYAVRL 1717          

HSP 3 Score: 113.62 bits (283), Expect = 8.264e-24
Identity = 133/591 (22.50%), Postives = 251/591 (42.47%), Query Frame = 1
Query:  247 KTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKKC-----------SDWSNRNQEIPVSEQFCLINQLPDNVTSESLI-SNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELA--KYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKITNFHGFPSTPGWKYYLFANYTKLGCCLINEDETYSEQLFMKLFKLNSEKFLVEECE-KSIDMTQHL--ILKFEIEQSKIFSNPSTLIETCPSLSLACEVLNL-EEFCVVRNQSGEIF----YKDIDNVERNNNVENWTRLLYTDYVAAKFHKLIGGIDNKFICAISDDGL------------WRININRHSQPRTLCLDRLMPNSRFISKTWASGSCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            K PKI+ + L  +++ I++T  S+P +C + LQ++L  L+  QP    SE  ++++ L +L+L I       T R                                   N S  + L  ++ ACLFS+ ++ G    +L A++ +L  NG     + IQ P ++  L++             DW     +     Q   +  +P +   + L+ S+G +L+ L   GL KIG+G++G+++G +Y +   +   +    W+G     +L             + +T  +IN + L+ DG V +   N  G       +  LF++   +     ++D+ +     +++F  ++E  L +E + K      H   I  F++E+         +I T     LA  VL    EF +++  SG+++    Y+ +   +   +   W  L  T   + K  +   G D       +DDG                  +R           +  + + +  T    +C+  + +++SK+G++    KD+I+S S+     L  + VTQ+++GK+H   L++ G + TFGVNN  QCG
Sbjct:   79 KLPKIIEIGLCEVFELIKETRFSHPSLCLRSLQALLNVLQGQQPEGLQSEPPEVLESLLQLILEI-------TVRSTGS-------------------------------NDSTGQTLTAVSCACLFSLVVSWGETGKILQAISAILTNNGSHACQN-IQVPTILNSLQRSVQAVLVGKIQIQDWFTSGIKKAALMQKWSLRDIPVDEDEQCLLQSDGFFLYLLCKDGLYKIGSGYSGTVRGHIYNSTSRIKSRREKKSWLGYAQGYLLYRD-------TSNQGMTAKRINPETLEQDGTVTVPDGNTDG-------QNILFSDGEFINQIAASKDDGF----VVRIFATSTEPVLQQELQLKLARKCLHACGISLFDLEKDL------HIISTGFDEELA--VLGAGREFALMKTASGKVYYTGKYQSLGIKQGGPSTGKWVELPITK--SPKIVQFSVGHDGSHALLTADDGSVFFTGTASKGEDGESTKSRRQSKPYKPKKMMKMDGKIVVAT----ACNNGSSSIISKDGELYMFGKDAIYSDSSNLVTDLKGHVVTQVAMGKAHTCVLTKKGEVWTFGVNNKGQCG 598          

HSP 4 Score: 99.3673 bits (246), Expect = 2.079e-19
Identity = 108/458 (23.58%), Postives = 190/458 (41.48%), Query Frame = 1
Query: 5836 GNEIAIEFHTASLY-EESLESTYGFKCSIVGH--------CSKIDAFIELLENALTYLASRCATSLLEFRKKSKVIKLLHETNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSCSSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQVTSQMSNIEV----------------LFNYNHKGNNPF---ININEKLFGGHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIR-AAGFQETVCKSQRIKYRWSEEENSFFID---WIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNKDKNDKPKYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQW 7113
            GNE      TAS Y ++   S YGFKC  +G+        C     ++E L     ++ S       E  +  +++    E   LQ C+ +  IL +GL+LS  PT+ + L  S    I S + +F++ F+      P +S      +L++WLQ                   P  Y D  K    T+++ N+          + ++  DQY + V      +EV                +  +     +P     +  +  FGG P P     +E  I+ +  Y +ITMMK YE +SFEE+R A+   +   ++  I+      + ++  D   W+            ID I          + +K+      +V  G  + ++ ++E   +K  K     F  K S+GLR+RS PS  S  +GI+  N  + + +E+  ++ VW+RL+ ++  ++
Sbjct: 1845 GNEAVFSLETASDYVKDEKASFYGFKCFAIGYEYSPGSDECLFFSFYVEKLNFQFIFIGS-------ELEEDLEIV----EEAALQVCKTHSGILGKGLALSHSPTILEALEGSLPLQIQSNEQSFLEDFI---TCVPGSS----GGRLARWLQ-------------------PDSYADPQK----TSLILNKDDVRCGWPTTITVQTKDQYGDVVHVPNMKVEVKAVPVSQKKTSLQQEQVKKFPRIPGSPSTTNTSGTDMTFGGLPSPKLDASYEPMIVKEARYIAITMMKAYENYSFEELRYASPMPKRPSENMLIRV---NNDGTYLFDLFMWL------------IDGIYA-------GLEVKVKDPPKGMVPPG-TQLVKPKSEPQPNKVRK-----FVAKDSAGLRIRSHPSLQSEQIGIVKVNGTIAFVDEIHNDDGVWLRLNDETVKKY 2233          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Xenopus
Match: vim (vimentin [Source:Xenbase;Acc:XB-GENE-493024])

HSP 1 Score: 424.091 bits (1089), Expect = 1.100e-117
Identity = 376/1276 (29.47%), Postives = 572/1276 (44.83%), Query Frame = 1
Query: 9331 MRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLL--------EKHKSIDKSNKPQISLIEEKNLKVYSQQLWAV---GSAV------FYRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINF-EKSQVFSCLSELLNHLDDS---KVFNGRIISTHENSIKINSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTA----IYQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKE--LQDNHDIESKS-----LHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILF----------GVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAGKSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSH-------------CDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENP-------NLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKP-SDQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + F + +  +  L +A++ +LR      ++ + + WLL NV   +SL  ++W     L        E     +K+NK      +EK+ +V    L  +   G A       F+R+L  I           S   L +M ++  SL          F QS   F  +S VF  ++ +L+  DD    + FN  + S  E S  +    D+T +     +S      SL D +T+ FWES   + +    I +     C + I  +   VSV++D +RD+ N   + T    KT       +Q  ++  HIGW++  L   +   N I I                G  N  +RVR VKVL   +  +     +      +    + ETL+ F  +T+ +F    +   +   E++E  L  + + E K+     L + +V I+F     T  + +V +            HI+  I +E  ++  + +       N N   ++      D +  + CF+LL+ VLALSG+  G +YL  Q  L++DL  LL+  S ++++QV   + R+   V+P  L  I+            +IH  E  +   + I        L++ +    K+L++Q+K+K    +               LP    +S+               +  +  I +LI  ++  +   AW    +     I E  +A+ +  +   + +P        L+  +  L + +     +  + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + TK H R     +  + K         V+ HE C R K    +   D+ T+K ++   +                       +  KP S  +E CRFC   +    +     C   +CQ  +  ACS K   CGH C GV    KNE      C P C+   C   +T     LKQD DD+CMICFT+ LS  P I L+ C H+ H  C RR ++  W G R++F F  CP CK KI H  L+DLL+P   L ++V+RKAL+RLE+EGL  S  +          P  +A+++Y YY+CYKCK +Y+GGEARC+ +                  DP  EL C ACSDV++A++CPKH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct: 3270 LAFVIQHHDLEGLEIAMKQALRKSACRVFAMEAFNWLLCNVIQTTSLHDILWHFVASLTPAPVEPEEDEDEENKANKENAE--QEKDTRVCEHPLSDIVIAGEAAHPLPDTFHRLLQTISDLMMSLPGGSS---LQQMALRCWSL---------KFKQSDHQFLHQSNVFRHINNILSKSDDGDSEESFNISVQSGFEGSCLVTGLKDMTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKSITIN----CVKGI--NTRYVSVHIDNSRDLGNKVTSLTFLSGKTVEDLCRIKQADLDSRHIGWVTSELPGGDN--NIIKIEL-------------KGPEN-TLRVRQVKVLGWKDGETIKIPGQISASVAQQRNCESETLRVFRLITSQVFGKLISGDAEPTPEQEEKTLLSSPEGEEKAPSDADLKEHMVGIIFSRSKLTNLQKQVCA------------HIVQAIRMEAMRVREEWEHAISSKENANSQPND-----EDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFHLLHTASPRVQRQVTSLLRRVLPEVTPSRLASIIGVKSLPPADISDIIHSTEKGDWNKMGI--------LDMFLGCIAKALTVQLKAKGTPIKGTAGTSAGKGVTTVTLPMIFNSSYLRRGESHWWMKGSTPTQISEIIIKLIKDMAAGHLSEAWSRVTKN---AIAETIIALTKMEE--EYRSPVRCIATTRLWLAVASLCVLDQ----DHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNACG------------------NLCTDCDRFLHLHRRTKSHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFRE-----------------------QTGKPASSSSETCRFCGSRNGTELSAVGSVCSDSDCQEYAKTACS-KTHSCGHPCGGV----KNEDH----CLP-CL-HGCDKNAT----SLKQDADDMCMICFTEALSAAPAIQLD-CSHVFHMQCCRRVLENRWLGPRITFGFMSCPICKNKINHTVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSDAITTPGVRFYNDPASYAMNRYAYYVCYKCKKAYFGGEARCDAE-----------AGQGDDYDP-RELICGACSDVSRAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSLPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF 4397          

HSP 2 Score: 167.548 bits (423), Expect = 5.029e-40
Identity = 242/1037 (23.34%), Postives = 426/1037 (41.08%), Query Frame = 1
Query: 2098 LRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVV-PIQCKSVRITTGSFSTGILSQNGKVFIFGN----KITSPQIIDLISNPNDLTDNLQPIFFNFSTNNYKKQIIFCILKQNIFYMKRKPLTLSTHRKSYHQDQFKFLAKDNTILLT---LDEQ---RGLLINISSGTIKIMPDYDEGNFSSLMNSYFDPRYSVLWSIDSGHGSKK----FTVKYSKSNIFQSDNFQDKFDQL---IDLPDDISFSSQRYRIALNVL------VSAEKLLLKKYADPQNNNQIKTVDSNKEIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMP----DIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYPFNGKFNELCHLEETLVKIPSLGYSKDTESQETSVVIGDFRIIVRNIFLECKICHYLQSIKSTYGAESLIYAECWKLFTEDLIPVYKETFEHSFHAFYPEIEDQRFTLQEAL----LKVYEFCFNKSTDTLCNYGKIMFLTSLLTAI-NSANEGFLIF--THKDNSVTRSGENKINGENN--FAHRFPLLREYMRTIWKPSTPCSSDILASTSTMIHCLLAIITLDIKTAYKTCKQINSSSTTENDVSEKKLFQQEMTNLINASHQILTNITRLLVDQLN--HSAKTPAFRMSQVNSTNSKQNGHNNNQTYLEDIILTTQSRFKRVVWLDKSAENSRQKFVEQAINVAEQEIEDVICFAINKNTYQFINGFEVVGDNVIYLEGIKVYCSNFTESRCLAYIYRIKNFQEGIREKWELIPMEYEWKNEEQDLIASDLIFKRKLKLEESYRYAVKV 5091
            LR  Q+SCG +H+VIL  NGDVY+FG  +  QLG G +S +  P ++  +   S ++T GS  T +L  +G+VF FG+    ++  P I+D+         N +P       + Y ++  +     +  +++     +++H  +  +      A  + I L    + E    + LLIN   G      D ++ +         DP + V+W      GS K    +    + S +  + + Q +   L   + LP      + R   AL++L       + + L +   +  +    +  V S ++   V RF      W YS ++ ++I+F     I + G+GL+ G GE T  IK++E  G D             ++T      L  ETD V   +   ++   +M   P++L +   YV  A ++G S+D G HG++ I TD GV F+FK SK S+NGT V  GQIP++ Y  R+P       K K    +  + +  +      +  +S++   S +++L+W +T L     EL  L+       Y+  LL  LE L+      T  L++++ +I  +YP +     +  +EET         SK  E       IG  R ++R I  E      + +  +    +   Y        E ++     TF   FH+FYP    Q   L + L      + E  F  S+  L        L ++++A+ N++ +   IF   +    + RS   +++ EN+   AHRFPLL   M  + +     S   + S   ++  +L I+ L ++ + +   ++ SS    N          E+T     S           VD LN  HS K+   R ++ +   S   G+ +                                              D ICF+++K     + GF V G   I+   ++V   +   S   A+ +R  +         EL+   Y   +   D+  +++   + + L+E+ +YAV++
Sbjct:  850 LRAVQVSCGFHHSVILMENGDVYTFGYGQHGQLGHGDVSCRGCPTLIQALPGPSTQVTAGSNHTAVLLMDGQVFTFGSFSKGQLGRP-ILDVPYW------NAKPAPMPNIGSKYGRKATWVGASGDQTFLRIDEALINSHVLATSE----IFASRHIIGLVPAYMTEPPPFKCLLINKVDGNCATFNDSEQEDLQGF-GVCLDPIHDVIWRF---QGSTKELWCYNAVIADSRLPSAPDMQLRCSILSPELALPIGQKAVTTRSHAALHILGCLDTLAAMQDLKMGVSSIEEETQSVMKVYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFCADTDILLGGLGLFGGRGEYTAKIKLFE-LGPDGG----------DHETDGD---LLAETD-VLAYDCAAREKYAMMFDEPVLLQAGWWYVAWARVSGPSSDCGSHGQASITTDDGVVFQFKSSKKSNNGTDVNAGQIPQLLY--RLPTSDGSATKGKPQTTEPVHILKRS-----FARTVSVDCFESLLSILHWSWTTLVLGVEELRSLK----GFQYTATLL-DLERLRFVG---TCCLRLLKVYICEIYPVSATTKAV--VEET---------SKLAE------CIGKTRTLLRKILSE-----GVDNCMTKLDNDPEGYLSQPMSLLEAVLQECHNTFTACFHSFYPTPALQWACLCDLLNCLDQDIQEANFKPSSSRL--------LAAVMSALCNTSVKLTSIFPIAYDGEVLLRSMVKQVSTENDTALAHRFPLLVSAMEKLSQTEENVSG--ITSFREVLEKMLVIVVLPVRNSLRRENELFSSHLVSNTCGLLASIVSELTASALGSE----------VDGLNSLHSVKSSPNRFTKTSQGRSWNTGNGS---------------------------------------------PDAICFSVDKPGLVVV-GFCVYGGGGIHEYELEVLVDDSDHSGDAAHSHRWTSL--------ELMKGTYTTDDSPSDI--AEIRLDKAVPLKENMKYAVRL 1743          

HSP 3 Score: 108.227 bits (269), Expect = 4.163e-22
Identity = 110/437 (25.17%), Postives = 186/437 (42.56%), Query Frame = 1
Query: 5836 GNEIAIEFHTASLY-EESLESTYGFKCSIVGH--------CSKIDAFIELLENALTYLASRCATSLLEFRKKSKVIKLLHETNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSCSSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQVTSQMSNIEV-LFNYNHK----------------GNNPFININ--EKLFGGHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIR-AAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNKDKNDKPKYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEEL 7059
            GNE      TAS Y ++   S YGFKC  +G+        C     ++E L     ++ S       E  +  +++    E   LQ C+ +  IL +GL+LS  PT+ + L  S    I S + +F++ F+      P +S      +L++WLQ                   P  Y D  K    T+++ N+          + ++  DQY + V      +EV     + K                G+    N +  +  FGG P P     +E  I+ +  Y +ITMMK YE +SFEE+R A+   +   ++  I+      + ++  +W P A G Y + +TID I     +    + +K+      +V  G  + ++ ++E   +K  K     F  K S+GLR+RS PS  S  +GI+  N  + + +E+
Sbjct: 1871 GNEAVFSLETASDYVKDEKASFYGFKCFAIGYEYSPGSDECLFFSFYVEKLNFQFIFIGS-------ELEEDLEIV----EEAALQVCKTHSGILGKGLALSHSPTILEALEGSLPLQIQSNEQSFLEDFI---TCVPGSS----GGRLARWLQ-------------------PDSYADPQK----TSLILNKDDVRCGWPTTITVQTKDQYGDVVHVPNMKVEVKAVPVSQKKTSLQQEQVKKFPRIPGSPSTTNTSGTDMTFGGLPSPKLDASYEPMIVKEARYIAITMMKAYENYSFEELRYASPMPKRPSENMLIRV---NNDGTYCANWTPGAVGLYTIHVTIDGI-----EIDAGLEVKVKDPPKGMVPPG-TQLVKPKSEPQPNKVRK-----FVAKDSAGLRIRSHPSLQSEQIGIVKVNGTIAFVDEV 2252          

HSP 4 Score: 78.1814 bits (191), Expect = 4.534e-13
Identity = 70/306 (22.88%), Postives = 132/306 (43.14%), Query Frame = 1
Query:  247 KTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKKC-----------SDWSNRNQEIPVSEQFCLINQLPDNVTSESLI-SNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELA--KYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKIT 1122
            K PKI+ + L  +++ I++T  S+P +C + LQ++L  L+  QP    SE  ++++ L +L+L I       T R                                   N S  + L  ++ ACLFS+ ++ G    +L A++ +L  NG     + IQ P ++  L++             DW     +     Q   +  +P +   + L+ S+G +L+ L   GL KIG+G++G+++G +Y +   +   +    W+G     +L             + +T  +IN + L+ DG V + + 
Sbjct:  127 KLPKIIEIGLCEVFELIKETRFSHPSLCLRSLQALLNVLQGQQPEGLQSEPPEVLESLLQLILEI-------TVRSTGS-------------------------------NDSTGQTLTAVSCACLFSLVVSWGETGKILQAISAILTNNGSHACQN-IQVPTILNSLQRSVQAVLVGKIQIQDWFTSGIKKAALMQKWSLRDIPVDEDEQCLLQSDGFFLYLLCKDGLYKIGSGYSGTVRGHIYNSTSRIKSRREKKSWLGYAQGYLLYRD-------TSNQGMTAKRINPETLEQDGTVTVPVA 386          

HSP 5 Score: 58.151 bits (139), Expect = 5.448e-7
Identity = 27/71 (38.03%), Postives = 47/71 (66.20%), Query Frame = 1
Query: 1705 SCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            +C+  + +++SK+G++    KD+I+S S+     L  + VTQ+++GK+H   L++ G + TFGVNN  QCG
Sbjct:  545 ACNNGSSSIISKDGELYMFGKDAIYSDSSNLVTDLKGHVVTQVAMGKAHTCVLTKKGEVWTFGVNNKGQCG 615          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Xenopus
Match: vim (vimentin [Source:Xenbase;Acc:XB-GENE-493024])

HSP 1 Score: 423.705 bits (1088), Expect = 1.490e-117
Identity = 375/1276 (29.39%), Postives = 571/1276 (44.75%), Query Frame = 1
Query: 9331 MRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLL--------EKHKSIDKSNKPQISLIEEKNLKVYSQQLWAV---GSAV------FYRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINF-EKSQVFSCLSELLNHLDDS---KVFNGRIISTHENSIKINSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTA----IYQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKE--LQDNHDIESKS-----LHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILF----------GVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAGKSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSH-------------CDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENP-------NLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKP-SDQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + F + +  +  L +A++ +LR      ++ + + WLL NV   +SL  ++W     L        E     +K+NK      +EK+ +V    L  +   G A       F+R+L  I               L +M ++  SL          F QS   F  +S VF  ++ +L+  DD    + FN  + S  E S  +    D+T +     +S      SL D +T+ FWES   + +    I +     C + I  +   VSV++D +RD+ N   + T    KT       +Q  ++  HIGW++  L   +   N I I                G  N  +RVR VKVL   +  +     +      +    + ETL+ F  +T+ +F    +   +   E++E  L  + + E K+     L + +V I+F     T  + +V +            HI+  I +E  ++  + +       N N   ++      D +  + CF+LL+ VLALSG+  G +YL  Q  L++DL  LL+  S ++++QV   + R+   V+P  L  I+            +IH  E  +   + I        L++ +    K+L++Q+K+K    +               LP    +S+               +  +  I +LI  ++  +   AW    +     I E  +A+ +  +   + +P        L+  +  L + +     +  + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + TK H R     +  + K         V+ HE C R K    +   D+ T+K ++   +                       +  KP S  +E CRFC   +    +     C   +CQ  +  ACS K   CGH C GV    KNE      C P C+   C   +T     LKQD DD+CMICFT+ LS  P I L+ C H+ H  C RR ++  W G R++F F  CP CK KI H  L+DLL+P   L ++V+RKAL+RLE+EGL  S  +          P  +A+++Y YY+CYKCK +Y+GGEARC+ +                  DP  EL C ACSDV++A++CPKH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct: 3276 LAFVIQHHDLEGLEIAMKQALRKSACRVFAMEAFNWLLCNVIQTTSLHDILWHFVASLTPAPVEPEEDEDEENKANKENAE--QEKDTRVCEHPLSDIVIAGEAAHPLPDTFHRLLQTISDLMMSLPGGS---SLQQMALRCWSL---------KFKQSDHQFLHQSNVFRHINNILSKSDDGDSEESFNISVQSGFEGSCLVTGLKDMTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKSITIN----CVKGI--NTRYVSVHIDNSRDLGNKVTSLTFLSGKTVEDLCRIKQADLDSRHIGWVTSELPGGDN--NIIKIEL-------------KGPEN-TLRVRQVKVLGWKDGETIKIPGQISASVAQQRNCESETLRVFRLITSQVFGKLISGDAEPTPEQEEKTLLSSPEGEEKAPSDADLKEHMVGIIFSRSKLTNLQKQVCA------------HIVQAIRMEAMRVREEWEHAISSKENANSQPND-----EDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFHLLHTASPRVQRQVTSLLRRVLPEVTPSRLASIIGVKSLPPADISDIIHSTEKGDWNKMGI--------LDMFLGCIAKALTVQLKAKGTPIKGTAGTSAGKGVTTVTLPMIFNSSYLRRGESHWWMKGSTPTQISEIIIKLIKDMAAGHLSEAWSRVTKN---AIAETIIALTKMEE--EYRSPVRCIATTRLWLAVASLCVLDQ----DHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNACG------------------NLCTDCDRFLHLHRRTKSHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFRE-----------------------QTGKPASSSSETCRFCGSRNGTELSAVGSVCSDSDCQEYAKTACS-KTHSCGHPCGGV----KNEDH----CLP-CLH-GCDKNAT----SLKQDADDMCMICFTEALSAAPAIQLD-CSHVFHMQCCRRVLENRWLGPRITFGFMSCPICKNKINHTVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSDAITTPGVRFYNDPASYAMNRYAYYVCYKCKKAYFGGEARCDAE-----------AGQGDDYDP-RELICGACSDVSRAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSLPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF 4403          

HSP 2 Score: 167.162 bits (422), Expect = 6.745e-40
Identity = 242/1037 (23.34%), Postives = 426/1037 (41.08%), Query Frame = 1
Query: 2098 LRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVV-PIQCKSVRITTGSFSTGILSQNGKVFIFGN----KITSPQIIDLISNPNDLTDNLQPIFFNFSTNNYKKQIIFCILKQNIFYMKRKPLTLSTHRKSYHQDQFKFLAKDNTILLT---LDEQ---RGLLINISSGTIKIMPDYDEGNFSSLMNSYFDPRYSVLWSIDSGHGSKK----FTVKYSKSNIFQSDNFQDKFDQL---IDLPDDISFSSQRYRIALNVL------VSAEKLLLKKYADPQNNNQIKTVDSNKEIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMP----DIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYPFNGKFNELCHLEETLVKIPSLGYSKDTESQETSVVIGDFRIIVRNIFLECKICHYLQSIKSTYGAESLIYAECWKLFTEDLIPVYKETFEHSFHAFYPEIEDQRFTLQEAL----LKVYEFCFNKSTDTLCNYGKIMFLTSLLTAI-NSANEGFLIF--THKDNSVTRSGENKINGENN--FAHRFPLLREYMRTIWKPSTPCSSDILASTSTMIHCLLAIITLDIKTAYKTCKQINSSSTTENDVSEKKLFQQEMTNLINASHQILTNITRLLVDQLN--HSAKTPAFRMSQVNSTNSKQNGHNNNQTYLEDIILTTQSRFKRVVWLDKSAENSRQKFVEQAINVAEQEIEDVICFAINKNTYQFINGFEVVGDNVIYLEGIKVYCSNFTESRCLAYIYRIKNFQEGIREKWELIPMEYEWKNEEQDLIASDLIFKRKLKLEESYRYAVKV 5091
            LR  Q+SCG +H+VIL  NGDVY+FG  +  QLG G +S +  P ++  +   S ++T GS  T +L  +G+VF FG+    ++  P I+D+         N +P       + Y ++  +     +  +++     +++H  +  +      A  + I L    + E    + LLIN   G      D ++ +         DP + V+W      GS K    +    + S +  + + Q +   L   + LP      + R   AL++L       + + L +   +  +    +  V S ++   V RF      W YS ++ ++I+F     I + G+GL+ G GE T  IK++E  G D             ++T      L  ETD V   +   ++   +M   P++L +   YV  A ++G S+D G HG++ I TD GV F+FK SK S+NGT V  GQIP++ Y  R+P       K K    +  + +  +      +  +S++   S +++L+W +T L     EL  L+       Y+  LL  LE L+      T  L++++ +I  +YP +     +  +EET         SK  E       IG  R ++R I  E      + +  +    +   Y        E ++     TF   FH+FYP    Q   L + L      + E  F  S+  L        L ++++A+ N++ +   IF   +    + RS   +++ EN+   AHRFPLL   M  + +     S   + S   ++  +L I+ L ++ + +   ++ SS    N          E+T     S           VD LN  HS K+   R ++ +   S   G+ +                                              D ICF+++K     + GF V G   I+   ++V   +   S   A+ +R  +         EL+   Y   +   D+  +++   + + L+E+ +YAV++
Sbjct:  784 LRAVQVSCGFHHSVILMENGDVYTFGYGQHGQLGHGDVSCRGCPTLIQALPGPSTQVTAGSNHTAVLLMDGQVFTFGSFSKGQLGRP-ILDVPYW------NAKPAPMPNIGSKYGRKATWVGASGDQTFLRIDEALINSHVLATSE----IFASRHIIGLVPAYMTEPPPFKCLLINKVDGNCATFNDSEQEDLQGF-GVCLDPIHDVIWRF---QGSTKELWCYNAVIADSRLPSAPDMQLRCSILSPELALPIGQKAVTTRSHAALHILGCLDTLAAMQDLKMGVSSIEEETQSVMKVYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFCADTDILLGGLGLFGGRGEYTAKIKLFE-LGPDGG----------DHETDGD---LLAETD-VLAYDCAAREKYAMMFDEPVLLQAGWWYVAWARVSGPSSDCGSHGQASITTDDGVVFQFKSSKKSNNGTDVNAGQIPQLLY--RLPTSDGSATKGKPQTTEPVHILKRS-----FARTVSVDCFESLLSILHWSWTTLVLGVEELRSLK----GFQYTATLL-DLERLRFVG---TCCLRLLKVYICEIYPVSATTKAV--VEET---------SKLAE------CIGKTRTLLRKILSE-----GVDNCMTKLDNDPEGYLSQPMSLLEAVLQECHNTFTACFHSFYPTPALQWACLCDLLNCLDQDIQEANFKPSSSRL--------LAAVMSALCNTSVKLTSIFPIAYDGEVLLRSMVKQVSTENDTALAHRFPLLVSAMEKLSQTEENVSG--ITSFREVLEKMLVIVVLPVRNSLRRENELFSSHLVSNTCGLLASIVSELTASALGSE----------VDGLNSLHSVKSSPNRFTKTSQGRSWNTGNGS---------------------------------------------PDAICFSVDKPGLVVV-GFCVYGGGGIHEYELEVLVDDSDHSGDAAHSHRWTSL--------ELMKGTYTTDDSPSDI--AEIRLDKAVPLKENMKYAVRL 1677          

HSP 3 Score: 114.005 bits (284), Expect = 6.431e-24
Identity = 133/591 (22.50%), Postives = 251/591 (42.47%), Query Frame = 1
Query:  247 KTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKKC-----------SDWSNRNQEIPVSEQFCLINQLPDNVTSESLI-SNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELA--KYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKITNFHGFPSTPGWKYYLFANYTKLGCCLINEDETYSEQLFMKLFKLNSEKFLVEECE-KSIDMTQHL--ILKFEIEQSKIFSNPSTLIETCPSLSLACEVLNL-EEFCVVRNQSGEIF----YKDIDNVERNNNVENWTRLLYTDYVAAKFHKLIGGIDNKFICAISDDGL------------WRININRHSQPRTLCLDRLMPNSRFISKTWASGSCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            K PKI+ + L  +++ I++T  S+P +C + LQ++L  L+  QP    SE  ++++ L +L+L I       T R                                   N S  + L  ++ ACLFS+ ++ G    +L A++ +L  NG     + IQ P ++  L++             DW     +     Q   +  +P +   + L+ S+G +L+ L   GL KIG+G++G+++G +Y +   +   +    W+G     +L             + +T  +IN + L+ DG V +   N  G       +  LF++   +     ++D+ +     +++F  ++E  L +E + K      H   I  F++E+         +I T     LA  VL    EF +++  SG+++    Y+ +   +   +   W  L  T   + K  +   G D       +DDG                  +R           +  + + +  T    +C+  + +++SK+G++    KD+I+S S+     L  + VTQ+++GK+H   L++ G + TFGVNN  QCG
Sbjct:   79 KLPKIIEIGLCEVFELIKETRFSHPSLCLRSLQALLNVLQGQQPEGLQSEPPEVLESLLQLILEI-------TVRSTGS-------------------------------NDSTGQTLTAVSCACLFSLVVSWGETGKILQAISAILTNNGSHACQN-IQVPTILNSLQRSVQAVLVGKIQIQDWFTSGIKKAALMQKWSLRDIPVDEDEQCLLQSDGFFLYLLCKDGLYKIGSGYSGTVRGHIYNSTSRIKSRREKKSWLGYAQGYLLYRD-------TSNQGMTAKRINPETLEQDGTVTVPDGNTDG-------QNILFSDGEFINQIAASKDDGF----VVRIFATSTEPVLQQELQLKLARKCLHACGISLFDLEKDL------HIISTGFDEELA--VLGAGREFALMKTASGKVYYTGKYQSLGIKQGGPSTGKWVELPITK--SPKIVQFSVGHDGSHALLTADDGSVFFTGTASKGEDGESTKSRRQSKPYKPKKMMKMDGKIVVAT----ACNNGSSSIISKDGELYMFGKDAIYSDSSNLVTDLKGHVVTQVAMGKAHTCVLTKKGEVWTFGVNNKGQCG 598          

HSP 4 Score: 99.7525 bits (247), Expect = 1.475e-19
Identity = 108/458 (23.58%), Postives = 190/458 (41.48%), Query Frame = 1
Query: 5836 GNEIAIEFHTASLY-EESLESTYGFKCSIVGH--------CSKIDAFIELLENALTYLASRCATSLLEFRKKSKVIKLLHETNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSCSSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQVTSQMSNIEV----------------LFNYNHKGNNPF---ININEKLFGGHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIR-AAGFQETVCKSQRIKYRWSEEENSFFID---WIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNKDKNDKPKYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQW 7113
            GNE      TAS Y ++   S YGFKC  +G+        C     ++E L     ++ S       E  +  +++    E   LQ C+ +  IL +GL+LS  PT+ + L  S    I S + +F++ F+      P +S      +L++WLQ                   P  Y D  K    T+++ N+          + ++  DQY + V      +EV                +  +     +P     +  +  FGG P P     +E  I+ +  Y +ITMMK YE +SFEE+R A+   +   ++  I+      + ++  D   W+            ID I          + +K+      +V  G  + ++ ++E   +K  K     F  K S+GLR+RS PS  S  +GI+  N  + + +E+  ++ VW+RL+ ++  ++
Sbjct: 1805 GNEAVFSLETASDYVKDEKASFYGFKCFAIGYEYSPGSDECLFFSFYVEKLNFQFIFIGS-------ELEEDLEIV----EEAALQVCKTHSGILGKGLALSHSPTILEALEGSLPLQIQSNEQSFLEDFI---TCVPGSS----GGRLARWLQ-------------------PDSYADPQK----TSLILNKDDVRCGWPTTITVQTKDQYGDVVHVPNMKVEVKAVPVSQKKTSLQQEQVKKFPRIPGSPSTTNTSGTDMTFGGLPSPKLDASYEPMIVKEARYIAITMMKAYENYSFEELRYASPMPKRPSENMLIRV---NNDGTYLFDLFMWL------------IDGIYA-------GLEVKVKDPPKGMVPPG-TQLVKPKSEPQPNKVRK-----FVAKDSAGLRIRSHPSLQSEQIGIVKVNGTIAFVDEIHNDDGVWLRLNDETVKKY 2193          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Mouse
Match: Mycbp2 (MYC binding protein 2, E3 ubiquitin protein ligase [Source:MGI Symbol;Acc:MGI:2179432])

HSP 1 Score: 420.624 bits (1080), Expect = 4.072e-120
Identity = 377/1278 (29.50%), Postives = 572/1278 (44.76%), Query Frame = 1
Query: 9331 MRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLL--------EKHKSIDKSNKPQISLIEEKNLKVYSQQLWAV---GSAV------FYRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINF-EKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPM-------DITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAIYQ-----QVVIEPDHIGWISFHLENA-NQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKE--LQDNHDIESK--------SLHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAG---KSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSH-------------CDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENP-------NLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPS-DQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + F + +  +  L +A++ +LR      ++ + + WLL NV   +SL  ++W     L        E     +KSNK      +EK+ +V    L  +   G A       F+R+L  I               L +M ++  SL          F QS   F  +S VF  ++ +L+  DD        IS       ++  +       D+T +     +S      SL D +T+ FWES   + +    I +     C + I  +   VSV++D +RD+ N  VT+   +   A+ +     QV ++  HIGW++  L    NQI   I I                G  N  +RVR VKVL   +  ST    +      +    + ETL+ F  +T+ +F    +   +   E++E  L  + + E K         L + +V I+F     T  + +V +            HI+  I +E T++  + +       N N    +      D +  + CF+LL+ VLALSG+  G +YL  Q  L++DL  LL+  S ++++QV   + R+   V+P  L  I+ GV      +    +    +  +  L +L +F G   K+L++Q+K+K  +                 LP    +S+               +  +  I +LI  ++  +   AW    +     I E  +A+ +  +   + +P        L+  +  L + +     +  + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + TK H R     +  + K         V+ HE C R K    +   D+ T+K ++   ++                         KP+   +E CRFC   S    +     C   +CQ  + +ACS K  PCGH C GV    +NE      C P      C +    S   LKQD DD+CMICFT+ LS  P I L +C H+ H  C RR ++  W G R++F F  CP CK KI H  L+DLL+P   L ++V+RKAL+RLE+EGL  S  +             +A+++Y YY+CYKC+ +Y+GGEARC+ +                  DP  EL C ACSDV++A++CPKH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct:  329 LAFVIQHHDLEGLEIAMKQALRKSACRVFAMEAFNWLLCNVIQTTSLHDILWHFVAALTPSPVEAEEDEDEDNKSNKENAE--QEKDTRVCEHPLSDIVIAGEAAHPLPHTFHRLLQTISDLMMSLPSGS---SLQQMALRCWSL---------KFKQSDHQFLHQSNVFHHINNILSKSDDGDSEESFSISVQSGFEAMSQELCIVMCLKDLTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKNITIN----CVKGI--NARYVSVHVDNSRDLGN-KVTSMTFLTGKAVEELCRIKQVDLDSRHIGWVTSELPGGDNQI---IKIEL-------------KGPEN-TLRVRQVKVLGWKDGESTKIAGQISASVAQQRSCEAETLRVFRLITSQVFGKLISGDAEPTPEQEEKALLSSPEGEEKVYNATSDADLKEHMVGIIFSRSKLTNLQKQVCA------------HIVQAIRMEATRVREEWEHAISSKENANSQPSD-----EDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPNRLASII-GVKSLPPADISDIIHSTEKGDWNKLGILDMFLGCIAKALTVQLKAKGTTITGTAGTTVGKGVTTVTLPMIFNSSYLRRGESHWWMKGSTPTQISEIIIRLIKDMAAGHLSEAWSRVTKN---AIAETIIALTKMEE--EFRSPVRCIATTRLWLALASLCVLDQ----DHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNICGN------------------LCTDCDRFLHLHRRTKTHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFREHT-----------------------GKPTTSSSEACRFCGSRSGTELSAVGSVCSDADCQEYAKIACS-KTHPCGHPCGGV----RNEEH----CLP------CLHGCDKSATTLKQDADDMCMICFTEALSAAPAIQL-DCSHVFHLQCCRRVLENRWLGPRITFGFISCPICKNKINHIVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITTPGVRFYNDAAGYAMNRYAYYVCYKCRKAYFGGEARCDAE-----------AGQGDDYDP-RELICGACSDVSRAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSIPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF 1463          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Mouse
Match: Mycbp2 (MYC binding protein 2, E3 ubiquitin protein ligase [Source:MGI Symbol;Acc:MGI:2179432])

HSP 1 Score: 423.32 bits (1087), Expect = 1.565e-117
Identity = 379/1277 (29.68%), Postives = 577/1277 (45.18%), Query Frame = 1
Query: 9331 MRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLL--------EKHKSIDKSNKPQISLIEEKNLKVYSQQLWAV---GSAV------FYRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINF-EKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPM-------DITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAIYQ-----QVVIEPDHIGWISFHLENA-NQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKE--LQDNHDIESKS-----LHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGV--IHPNEFENPQNVKIKLEKPFIPLNLLIIFAG---KSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSH-------------CDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENP-------NLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPS-DQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + F + +  +  L +A++ +LR      ++ + + WLL NV   +SL  ++W     L        E     +KSNK      +EK+ +V    L  +   G A       F+R+L  I               L +M ++  SL          F QS   F  +S VF  ++ +L+  DD        IS       ++  +       D+T +     +S      SL D +T+ FWES   + +    I +     C + I  +   VSV++D +RD+ N  VT+   +   A+ +     QV ++  HIGW++  L    NQI   I I                G  N  +RVR VKVL   +  ST    +      +    + ETL+ F  +T+ +F    +   +   E++E  L  + + E K+     L + +V I+F     T  + +V +            HI+  I +E T++  + +       N N    +      D +  + CF+LL+ VLALSG+  G +YL  Q  L++DL  LL+  S ++++QV   + R+   V+P  L  I+ GV  + P +  +  +   K +  +  L +L +F G   K+L++Q+K+K  +                 LP    +S+               +  +  I +LI  ++  +   AW    +     I E  +A+ +  +   + +P        L+  +  L + +     +  + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + TK H R     +  + K         V+ HE C R K    +   D+ T+K ++   ++                         KP+   +E CRFC   S    +     C   +CQ  + +ACS K  PCGH C GV    +NE      C P      C +    S   LKQD DD+CMICFT+ LS  P I L +C H+ H  C RR ++  W G R++F F  CP CK KI H  L+DLL+P   L ++V+RKAL+RLE+EGL  S  +             +A+++Y YY+CYKC+ +Y+GGEARC+ +                  DP  EL C ACSDV++A++CPKH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct: 3505 LAFVIQHHDLEGLEIAMKQALRKSACRVFAMEAFNWLLCNVIQTTSLHDILWHFVAALTPSPVEAEEDEDEDNKSNKENAE--QEKDTRVCEHPLSDIVIAGEAAHPLPHTFHRLLQTISDLMMSLPSGS---SLQQMALRCWSL---------KFKQSDHQFLHQSNVFHHINNILSKSDDGDSEESFSISVQSGFEAMSQELCIVMCLKDLTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKNITIN----CVKGI--NARYVSVHVDNSRDLGN-KVTSMTFLTGKAVEELCRIKQVDLDSRHIGWVTSELPGGDNQI---IKIEL-------------KGPEN-TLRVRQVKVLGWKDGESTKIAGQISASVAQQRSCEAETLRVFRLITSQVFGKLISGDAEPTPEQEEKALLSSPEGEEKATSDADLKEHMVGIIFSRSKLTNLQKQVCA------------HIVQAIRMEATRVREEWEHAISSKENANSQPSD-----EDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPNRLASII-GVKSLPPADISDIIHSTEKGD--WNKLGILDMFLGCIAKALTVQLKAKGTTITGTAGTTVGKGVTTVTLPMIFNSSYLRRGESHWWMKGSTPTQISEIIIRLIKDMAAGHLSEAWSRVTKN---AIAETIIALTKMEE--EFRSPVRCIATTRLWLALASLCVLDQ----DHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNICG------------------NLCTDCDRFLHLHRRTKTHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFREHT-----------------------GKPTTSSSEACRFCGSRSGTELSAVGSVCSDADCQEYAKIACS-KTHPCGHPCGGV----RNEEH----CLP------CLHGCDKSATTLKQDADDMCMICFTEALSAAPAIQL-DCSHVFHLQCCRRVLENRWLGPRITFGFISCPICKNKINHIVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITTPGVRFYNDAAGYAMNRYAYYVCYKCRKAYFGGEARCDAE-----------AGQGDDYDP-RELICGACSDVSRAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSIPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF 4636          

HSP 2 Score: 176.022 bits (445), Expect = 1.015e-42
Identity = 244/1085 (22.49%), Postives = 437/1085 (40.28%), Query Frame = 1
Query: 2098 LRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVV-PIQCKSVRITTGSFSTGILSQNGKVFIFGN----KITSPQIIDLISNPNDLTDNLQPIFFNFSTNNYKKQIIFCILKQNIFYMKRKPLTLSTHRKSYHQDQFKFLAKDNTILL---TLDEQ---RGLLINISSGTIKIMPDYDEGNFSSLMNSYFDPRYSVLWSI-DSGHGSKKFTVKYSKSNIFQSDNFQDKFDQL---IDLPDDISFSSQRYRIALNVL------VSAEKLLLKKYADPQNNNQIKTVDSNKEIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMP----DIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYPFNGKFNELCHLEETLVKIPSLGYSKDTESQETSVVIGDFRIIVRNIFLE----CKICHYLQSIKSTYGAESLIYAECWKLFTEDLIPVYKETFEHSFHAFYPEIEDQRFTLQEALLKVYEFCFNKSTDTLCNYGKIM-FLTSLLTAINSANEGFLIFTHKDNSVTRSGENKINGENN--FAHRFPLLREYMRTIWKPSTPCSSDILASTSTMIHCLLAIITLDIKTAYKTCKQINSSSTTENDVSEKKLFQQEMTNLINASHQILTNITRLLVDQLN--HSAKTPAFRMSQVNSTNSKQNGHNNNQTYLEDIILTTQSRFKRVVWLDKSAENSRQKFVEQAINVAEQEIEDVICFAINKNTYQFINGFEVVGDNVIYLEGIKVYCSNFTESRCLAYIYRIKNFQEGIREKWELIPMEYEWKNEEQDLIASDLIFKRKLKLEESYRYAVKVFLIAANNKKTLIGQNPVSKLGTRFGYHFNLYETKLRTTANQNSRQGIIFSLLY 5250
            LR  Q+SCG +H+V+L  NGDVY+FG  +  QLG G ++++  P +V  +   S ++T GS  T +L  +G+VF FG+    ++  P I+D+         N +P       + Y ++  +     +  +++     +++H  +  +      A  + I L   ++ E    + LLIN   G+ K   D ++ +         DP Y VLW    S      +    + + +  + + Q +   L   + LP      + R   AL++L       + + L +   +  +    +  V S ++   V RF      W YS ++ ++I+FS    I + G+GL+ G GE T  IK++E  G D             ++T      L  ETD V   +   ++   +M   P++L +   YV  A ++G S+D G HG++ I TD GV F+FK SK S+NGT V  GQIP++ Y  R+P       K K+   +  + +  +      +  +S+    S +++L+W +T L     EL  L+      T     L  LE L+      T  L+++R +   +YP                 + + G +   E+ + +  IG  R ++R I  E    C +   L +    Y ++ L          E ++     TF   FH+FYP        LQ A L     C ++  +   +  +++  + S L   +          +    + RS   +++ EN+    HRFPLL  +M  + +     S   + S   ++  +L I+ L ++ + +   ++ SS    N          E+T     S           VD LN  HS K  A R ++ +   S   G+ +                                              D ICFA++K     + GF V G   I+   ++V   +   +    + +R  +         EL+   Y   +   D+  +++   + + L+E+ +YAV+   +     +T  G   ++ +    G  F      L +     +R G I  +LY
Sbjct:  907 LRAVQVSCGFHHSVVLMENGDVYTFGYGQHGQLGHGDVNSRGCPTLVQALPGPSTQVTAGSNHTAVLLMDGQVFTFGSFSKGQLGRP-ILDIPYW------NAKPAPMPNIGSKYGRKATWIGASGDQTFLRIDEALINSHVLATSE----IFASKHIIGLVPASISEPPPFKCLLINKVDGSCKTFNDSEQEDLQGF-GVCLDPVYDVLWRFRPSTRELWCYNAVVADARLPSATDMQSRCSILSPELALPTGSRALTTRSHAALHILGCLDTLAAMQDLKMGIASTEEETQAVMKVYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFSADTDILLGGLGLFGGRGEYTAKIKLFE-LGPDGG----------DHETDGD---LLAETD-VLAYDCAAREKYAMMFDEPVLLQAGWWYVAWARVSGPSSDCGSHGQASITTDDGVIFQFKSSKKSNNGTDVNAGQIPQLLY--RLPTSDGSTSKGKQQTSEPVHILKRS-----FARTVSVECFESLLSILHWSWTTLVLGVEELRGLKGFQFTAT-----LLDLERLRFVG---TCCLRLLRVYTCEIYP-----------------VSATGKAVVEETSKLAECIGKTRTLLRKILSEGVDHCMV--KLDNDPQGYLSQPL-------RLLEAVLQECHNTFTACFHSFYPTP-----ALQWACLCDLLNCLDQEANFKTSSSRLLAAVMSALCHTSVKLTSLFPIAYDGEVLLRSIVKQVSTENDSTLVHRFPLLVGHMEKLSQSEENISG--MTSFREVLEKMLVIVVLPVRNSLRRESELFSSHLVSNTCGLLASIVSELTASALGSE----------VDGLNSLHSVKASANRFTKTSQGRSWNTGNGS---------------------------------------------PDAICFAVDKPGIVVV-GFAVYGGGGIHEYELEVLVDDSEHAGDSTHSHRWTSL--------ELVKGTYTTDDSPSDI--AEIRLDKVVPLKENVKYAVR---LRNYGSRTANGDGGMTTVQCPDGVTFTFSTCSLSSNGTNQTR-GQIPQILY 1846          

HSP 3 Score: 169.859 bits (429), Expect = 6.577e-41
Identity = 168/629 (26.71%), Postives = 261/629 (41.49%), Query Frame = 1
Query: 5572 DYFTIIESNHPYEQAKLLHNTIKFPDSVDAISITFDGHCVTAQPEDFLVVKARTNTANGNQTENKWKIIFKNLSNII--------SDWPKKAVIIQGNEIAIEFHTASLY-EESLESTYGFKCSIVGH--CSKIDAFIELLENALTYLASRCATSL------LEFRKKSKVIKLLHETNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSC--SSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQVTSQMSNIEV-LFNYNHKGNNPFININEKL-----------------FGGHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIRAAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNKDKND-KP-KYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLK--EHLNKIFLTP 7335
            +++ +IES HPY+ A ++H  + FP+ V  ++I FD  C TAQ ED + +     T   +    K   + +NL++ +        S WP   +++ GNE      TAS Y ++   S YGFKC  +G+      D  +  LE  L  L   CA +L      L    + +    + E   LQ C+ +  IL +GL+LS  PT+ + L  +    I S + +F+  F+         +C   S   +L++WLQ                   P  Y D  K    T+++ N+          + ++  DQY + V      +EV     + K  +   +  +K                  FGG   P   V +E  I+ +  Y +ITMMK YE +SFEE+R A        S+ +  R +  + ++  +W P A G Y + +TID I             +ID      VK+ P   I   T+  K K D +P K   F  K S+GLR+RS PS  S  +GI+  N  + + +E+  ++ VW+RL                              N+ETI                   KK V  N+  +TE WCL   +HL K  L P
Sbjct: 1982 NHYAVIESEHPYKPACVMHYKVTFPECVRWMTIEFDPQCGTAQSEDVIRLLIPVRTIQNSGYGAKLTSVHENLNSWVELKKYSGSSGWPTMVLVLPGNEALFSLETASDYVKDDKASFYGFKCFAIGYEFSPGPDEGVIQLEKELANLGGVCAAALMKKDLALPVGNELEEDLEILEEAALQVCKTHSGILGKGLALSHSPTILEALEGNLPLQIQSNEQSFLDDFI---------ACVPGSSGGRLARWLQ-------------------PDSYADPQK----TSLILNKDDIRCGWPTTITVQTKDQYGDVVHVPNMKVEVKAVPVSQKKTSLQQDQGKKCQRIPGSPSAAASSADMTFGGLASPKLDVSYEPMIVKEARYIAITMMKVYENYSFEELRFASPTPKR-PSENMLIRVN-NDGTYCANWTPGAIGLYTVHVTIDGI-------------EIDAGLEVKVKDPPKGMIPPGTQLVKPKADPQPNKIRKFVAKDSAGLRIRSHPSLQSEQIGIVRVNGTITFIDEIHNDDGVWLRL------------------------------NEETI-------------------KKYVP-NMNGYTEAWCLSFNQHLGKSLLVP 2513          

HSP 4 Score: 108.612 bits (270), Expect = 2.019e-22
Identity = 135/591 (22.84%), Postives = 253/591 (42.81%), Query Frame = 1
Query:  247 KTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKK-----------CSDW-SNRNQEIPVSEQFCLINQLPDNVTSESLISNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELA--KYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKITNFHGFPSTPGWKYYLFANYTKLGCCLINEDETYSEQLFMKLFKLNSEKFLVEECEKSID---MTQHLILKFEIEQ-----SKIFSNPSTLIETCPSLSLACEVLNLEEFCVVRNQSGEIFY----KDIDNVERNNNVENWTRLLYTDYVAAKFHKLIGGIDNKFICAISDDG--LWRININRHSQPRTLCLDRLMPNSRFISKTWASG------SCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            K PKI+ + L  +++ I++T  S+P +C + LQ++L  L+  QP    SE  ++++ LF+LLL I             RS  M                           N S  ++L  ++ ACLFS+  + G     L A++ +L  NG       IQ P ++  L++             DW SN  ++  +  ++ L     D      L ++G +L+ L   GL KIG+G++G+++G +Y +   +   K    W+G  +   LL+  L   S      +T  +I+ + L+ DG V L   +  G       +  LF +   +     + D+ +     +++F  ++E  L +E +  +    +    I  F++E+     S  F   S ++                EF +++  +G+I+Y    + +   +   +   W  L  T   + K      G D      +++DG   +  + ++     +    R     +        G      +C+  + +++SK+G++    KD+I+S S+   + L  + VTQ+++GK+H   L +NG + TFGVNN  QCG
Sbjct:  162 KLPKIIEVGLCEVFELIKETRFSHPSLCLRSLQALLNVLQGQQPEGLQSEPPEVLESLFQLLLEITV-----------RSTGM---------------------------NDSTGQSLTALSCACLFSLVASWGETGRTLQAISAILTNNGS-HACQTIQVPTILNSLQRSVQAVLVGKIQVQDWFSNGIKKAALMHKWPLKEVSVDEDDQCLLQNDGFFLYLLCKDGLYKIGSGYSGTVRGHIYNSTSRIRNRKEKKSWLGY-AQGYLLYRDLNNHS------MTAIRISPETLEQDGTVLLPDCHTEG-------QNILFTDGEYINQIAASRDDGF----VVRIFATSTEPVLQQELQLKLARKCLHACGISLFDLEKDLHIISTGFDEESAILGAG------------REFALMKTANGKIYYTGKYQSLGIKQGGPSAGKWVELPITK--SPKIVHFSVGHDGSHALLVAEDGSVFFTGSASKGEDGESTKSRRQSKPYKPKKIIKMEGKIVVYTACNNGSSSVISKDGELYMFGKDAIYSDSSSLVSDLKGHFVTQVAMGKAHTCVLMKNGEVWTFGVNNKGQCG 681          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Mouse
Match: Mycbp2 (MYC binding protein 2, E3 ubiquitin protein ligase [Source:MGI Symbol;Acc:MGI:2179432])

HSP 1 Score: 422.935 bits (1086), Expect = 2.101e-117
Identity = 378/1277 (29.60%), Postives = 576/1277 (45.11%), Query Frame = 1
Query: 9331 MRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLLEKHK--------SIDKSNKPQISLIEEKNLKVYSQQLWAV---GSAV------FYRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINF-EKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPM-------DITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAIYQ-----QVVIEPDHIGWISFHLENA-NQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKE--LQDNHDIESKS-----LHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGV--IHPNEFENPQNVKIKLEKPFIPLNLLIIFAG---KSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSH-------------CDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENP-------NLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPS-DQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + F + +  +  L +A++ +LR      ++ + + WLL NV   +SL  ++W     L              +KSNK      +EK+ +V    L  +   G A       F+R+L  I               L +M ++  SL          F QS   F  +S VF  ++ +L+  DD        IS       ++  +       D+T +     +S      SL D +T+ FWES   + +    I +     C + I  +   VSV++D +RD+ N  VT+   +   A+ +     QV ++  HIGW++  L    NQI   I I                G  N  +RVR VKVL   +  ST    +      +    + ETL+ F  +T+ +F    +   +   E++E  L  + + E K+     L + +V I+F     T  + +V +            HI+  I +E T++  + +       N N    +      D +  + CF+LL+ VLALSG+  G +YL  Q  L++DL  LL+  S ++++QV   + R+   V+P  L  I+ GV  + P +  +  +   K +  +  L +L +F G   K+L++Q+K+K  +                 LP    +S+               +  +  I +LI  ++  +   AW    +     I E  +A+ +  +   + +P        L+  +  L + +     +  + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + TK H R     +  + K         V+ HE C R K    +   D+ T+K ++   ++                         KP+   +E CRFC   S    +     C   +CQ  + +ACS K  PCGH C GV    +NE      C P      C +    S   LKQD DD+CMICFT+ LS  P I L+ C H+ H  C RR ++  W G R++F F  CP CK KI H  L+DLL+P   L ++V+RKAL+RLE+EGL  S  +             +A+++Y YY+CYKC+ +Y+GGEARC+ +                  DP  EL C ACSDV++A++CPKH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct: 3615 LAFVIQHHDLEGLEIAMKQALRKSACRVFAMEAFNWLLCNVIQTTSLHDILWHFVAALTPSPVEAEEDEDEDNKSNKENAE--QEKDTRVCEHPLSDIVIAGEAAHPLPHTFHRLLQTISDLMMSLPSGS---SLQQMALRCWSL---------KFKQSDHQFLHQSNVFHHINNILSKSDDGDSEESFSISVQSGFEAMSQELCIVMCLKDLTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKNITIN----CVKGI--NARYVSVHVDNSRDLGN-KVTSMTFLTGKAVEELCRIKQVDLDSRHIGWVTSELPGGDNQI---IKIEL-------------KGPEN-TLRVRQVKVLGWKDGESTKIAGQISASVAQQRSCEAETLRVFRLITSQVFGKLISGDAEPTPEQEEKALLSSPEGEEKATSDADLKEHMVGIIFSRSKLTNLQKQVCA------------HIVQAIRMEATRVREEWEHAISSKENANSQPSD-----EDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPNRLASII-GVKSLPPADISDIIHSTEKGD--WNKLGILDMFLGCIAKALTVQLKAKGTTITGTAGTTVGKGVTTVTLPMIFNSSYLRRGESHWWMKGSTPTQISEIIIRLIKDMAAGHLSEAWSRVTKN---AIAETIIALTKMEE--EFRSPVRCIATTRLWLALASLCVLDQ----DHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNICG------------------NLCTDCDRFLHLHRRTKTHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFREHT-----------------------GKPTTSSSEACRFCGSRSGTELSAVGSVCSDADCQEYAKIACS-KTHPCGHPCGGV----RNEEH----CLP------CLHGCDKSATTLKQDADDMCMICFTEALSAAPAIQLD-CSHVFHLQCCRRVLENRWLGPRITFGFISCPICKNKINHIVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITTPGVRFYNDAAGYAMNRYAYYVCYKCRKAYFGGEARCDAE-----------AGQGDDYDP-RELICGACSDVSRAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSIPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF 4746          

HSP 2 Score: 175.252 bits (443), Expect = 1.450e-42
Identity = 244/1085 (22.49%), Postives = 437/1085 (40.28%), Query Frame = 1
Query: 2098 LRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVV-PIQCKSVRITTGSFSTGILSQNGKVFIFGN----KITSPQIIDLISNPNDLTDNLQPIFFNFSTNNYKKQIIFCILKQNIFYMKRKPLTLSTHRKSYHQDQFKFLAKDNTILL---TLDEQ---RGLLINISSGTIKIMPDYDEGNFSSLMNSYFDPRYSVLWSI-DSGHGSKKFTVKYSKSNIFQSDNFQDKFDQL---IDLPDDISFSSQRYRIALNVL------VSAEKLLLKKYADPQNNNQIKTVDSNKEIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMP----DIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYPFNGKFNELCHLEETLVKIPSLGYSKDTESQETSVVIGDFRIIVRNIFLE----CKICHYLQSIKSTYGAESLIYAECWKLFTEDLIPVYKETFEHSFHAFYPEIEDQRFTLQEALLKVYEFCFNKSTDTLCNYGKIM-FLTSLLTAINSANEGFLIFTHKDNSVTRSGENKINGENN--FAHRFPLLREYMRTIWKPSTPCSSDILASTSTMIHCLLAIITLDIKTAYKTCKQINSSSTTENDVSEKKLFQQEMTNLINASHQILTNITRLLVDQLN--HSAKTPAFRMSQVNSTNSKQNGHNNNQTYLEDIILTTQSRFKRVVWLDKSAENSRQKFVEQAINVAEQEIEDVICFAINKNTYQFINGFEVVGDNVIYLEGIKVYCSNFTESRCLAYIYRIKNFQEGIREKWELIPMEYEWKNEEQDLIASDLIFKRKLKLEESYRYAVKVFLIAANNKKTLIGQNPVSKLGTRFGYHFNLYETKLRTTANQNSRQGIIFSLLY 5250
            LR  Q+SCG +H+V+L  NGDVY+FG  +  QLG G ++++  P +V  +   S ++T GS  T +L  +G+VF FG+    ++  P I+D+         N +P       + Y ++  +     +  +++     +++H  +  +      A  + I L   ++ E    + LLIN   G+ K   D ++ +         DP Y VLW    S      +    + + +  + + Q +   L   + LP      + R   AL++L       + + L +   +  +    +  V S ++   V RF      W YS ++ ++I+FS    I + G+GL+ G GE T  IK++E  G D             ++T      L  ETD V   +   ++   +M   P++L +   YV  A ++G S+D G HG++ I TD GV F+FK SK S+NGT V  GQIP++ Y  R+P       K K+   +  + +  +      +  +S+    S +++L+W +T L     EL  L+      T     L  LE L+      T  L+++R +   +YP                 + + G +   E+ + +  IG  R ++R I  E    C +   L +    Y ++ L          E ++     TF   FH+FYP        LQ A L     C ++  +   +  +++  + S L   +          +    + RS   +++ EN+    HRFPLL  +M  + +     S   + S   ++  +L I+ L ++ + +   ++ SS    N          E+T     S           VD LN  HS K  A R ++ +   S   G+ +                                              D ICFA++K     + GF V G   I+   ++V   +   +    + +R  +         EL+   Y   +   D+  +++   + + L+E+ +YAV+   +     +T  G   ++ +    G  F      L +     +R G I  +LY
Sbjct:  940 LRAVQVSCGFHHSVVLMENGDVYTFGYGQHGQLGHGDVNSRGCPTLVQALPGPSTQVTAGSNHTAVLLMDGQVFTFGSFSKGQLGRP-ILDIPYW------NAKPAPMPNIGSKYGRKATWIGASGDQTFLRIDEALINSHVLATSE----IFASKHIIGLVPASISEPPPFKCLLINKVDGSCKTFNDSEQEDLQGF-GVCLDPVYDVLWRFRPSTRELWCYNAVVADARLPSATDMQSRCSILSPELALPTGSRALTTRSHAALHILGCLDTLAAMQDLKMGIASTEEETQAVMKVYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFSADTDILLGGLGLFGGRGEYTAKIKLFE-LGPDGG----------DHETDGD---LLAETD-VLAYDCAAREKYAMMFDEPVLLQAGWWYVAWARVSGPSSDCGSHGQASITTDDGVIFQFKSSKKSNNGTDVNAGQIPQLLY--RLPTSDGSTSKGKQQTSEPVHILKRS-----FARTVSVECFESLLSILHWSWTTLVLGVEELRGLKGFQFTAT-----LLDLERLRFVG---TCCLRLLRVYTCEIYP-----------------VSATGKAVVEETSKLAECIGKTRTLLRKILSEGVDHCMV--KLDNDPQGYLSQPL-------RLLEAVLQECHNTFTACFHSFYPTP-----ALQWACLCDLLNCLDQEANFKTSSSRLLAAVMSALCHTSVKLTSLFPIAYDGEVLLRSIVKQVSTENDSTLVHRFPLLVGHMEKLSQSEENISG--MTSFREVLEKMLVIVVLPVRNSLRRESELFSSHLVSNTCGLLASIVSELTASALGSE----------VDGLNSLHSVKASANRFTKTSQGRSWNTGNGS---------------------------------------------PDAICFAVDKPGIVVV-GFAVYGGGGIHEYELEVLVDDSEHAGDSTHSHRWTSL--------ELVKGTYTTDDSPSDI--AEIRLDKVVPLKENVKYAVR---LRNYGSRTANGDGGMTTVQCPDGVTFTFSTCSLSSNGTNQTR-GQIPQILY 1879          

HSP 3 Score: 169.859 bits (429), Expect = 6.949e-41
Identity = 168/629 (26.71%), Postives = 261/629 (41.49%), Query Frame = 1
Query: 5572 DYFTIIESNHPYEQAKLLHNTIKFPDSVDAISITFDGHCVTAQPEDFLVVKARTNTANGNQTENKWKIIFKNLSNII--------SDWPKKAVIIQGNEIAIEFHTASLY-EESLESTYGFKCSIVGH--CSKIDAFIELLENALTYLASRCATSL------LEFRKKSKVIKLLHETNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSC--SSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQVTSQMSNIEV-LFNYNHKGNNPFININEKL-----------------FGGHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIRAAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNKDKND-KP-KYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLK--EHLNKIFLTP 7335
            +++ +IES HPY+ A ++H  + FP+ V  ++I FD  C TAQ ED + +     T   +    K   + +NL++ +        S WP   +++ GNE      TAS Y ++   S YGFKC  +G+      D  +  LE  L  L   CA +L      L    + +    + E   LQ C+ +  IL +GL+LS  PT+ + L  +    I S + +F+  F+         +C   S   +L++WLQ                   P  Y D  K    T+++ N+          + ++  DQY + V      +EV     + K  +   +  +K                  FGG   P   V +E  I+ +  Y +ITMMK YE +SFEE+R A        S+ +  R +  + ++  +W P A G Y + +TID I             +ID      VK+ P   I   T+  K K D +P K   F  K S+GLR+RS PS  S  +GI+  N  + + +E+  ++ VW+RL                              N+ETI                   KK V  N+  +TE WCL   +HL K  L P
Sbjct: 2015 NHYAVIESEHPYKPACVMHYKVTFPECVRWMTIEFDPQCGTAQSEDVIRLLIPVRTIQNSGYGAKLTSVHENLNSWVELKKYSGSSGWPTMVLVLPGNEALFSLETASDYVKDDKASFYGFKCFAIGYEFSPGPDEGVIQLEKELANLGGVCAAALMKKDLALPVGNELEEDLEILEEAALQVCKTHSGILGKGLALSHSPTILEALEGNLPLQIQSNEQSFLDDFI---------ACVPGSSGGRLARWLQ-------------------PDSYADPQK----TSLILNKDDIRCGWPTTITVQTKDQYGDVVHVPNMKVEVKAVPVSQKKTSLQQDQGKKCQRIPGSPSAAASSADMTFGGLASPKLDVSYEPMIVKEARYIAITMMKVYENYSFEELRFASPTPKR-PSENMLIRVN-NDGTYCANWTPGAIGLYTVHVTIDGI-------------EIDAGLEVKVKDPPKGMIPPGTQLVKPKADPQPNKIRKFVAKDSAGLRIRSHPSLQSEQIGIVRVNGTITFIDEIHNDDGVWLRL------------------------------NEETI-------------------KKYVP-NMNGYTEAWCLSFNQHLGKSLLVP 2546          

HSP 4 Score: 108.997 bits (271), Expect = 1.893e-22
Identity = 135/591 (22.84%), Postives = 253/591 (42.81%), Query Frame = 1
Query:  247 KTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKK-----------CSDW-SNRNQEIPVSEQFCLINQLPDNVTSESLISNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELA--KYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKITNFHGFPSTPGWKYYLFANYTKLGCCLINEDETYSEQLFMKLFKLNSEKFLVEECEKSID---MTQHLILKFEIEQ-----SKIFSNPSTLIETCPSLSLACEVLNLEEFCVVRNQSGEIFY----KDIDNVERNNNVENWTRLLYTDYVAAKFHKLIGGIDNKFICAISDDG--LWRININRHSQPRTLCLDRLMPNSRFISKTWASG------SCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            K PKI+ + L  +++ I++T  S+P +C + LQ++L  L+  QP    SE  ++++ LF+LLL I             RS  M                           N S  ++L  ++ ACLFS+  + G     L A++ +L  NG       IQ P ++  L++             DW SN  ++  +  ++ L     D      L ++G +L+ L   GL KIG+G++G+++G +Y +   +   K    W+G  +   LL+  L   S      +T  +I+ + L+ DG V L   +  G       +  LF +   +     + D+ +     +++F  ++E  L +E +  +    +    I  F++E+     S  F   S ++                EF +++  +G+I+Y    + +   +   +   W  L  T   + K      G D      +++DG   +  + ++     +    R     +        G      +C+  + +++SK+G++    KD+I+S S+   + L  + VTQ+++GK+H   L +NG + TFGVNN  QCG
Sbjct:  195 KLPKIIEVGLCEVFELIKETRFSHPSLCLRSLQALLNVLQGQQPEGLQSEPPEVLESLFQLLLEITV-----------RSTGM---------------------------NDSTGQSLTALSCACLFSLVASWGETGRTLQAISAILTNNGS-HACQTIQVPTILNSLQRSVQAVLVGKIQVQDWFSNGIKKAALMHKWPLKEVSVDEDDQCLLQNDGFFLYLLCKDGLYKIGSGYSGTVRGHIYNSTSRIRNRKEKKSWLGY-AQGYLLYRDLNNHS------MTAIRISPETLEQDGTVLLPDCHTEG-------QNILFTDGEYINQIAASRDDGF----VVRIFATSTEPVLQQELQLKLARKCLHACGISLFDLEKDLHIISTGFDEESAILGAG------------REFALMKTANGKIYYTGKYQSLGIKQGGPSAGKWVELPITK--SPKIVHFSVGHDGSHALLVAEDGSVFFTGSASKGEDGESTKSRRQSKPYKPKKIIKMEGKIVVYTACNNGSSSVISKDGELYMFGKDAIYSDSSSLVSDLKGHFVTQVAMGKAHTCVLMKNGEVWTFGVNNKGQCG 714          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Mouse
Match: Mycbp2 (MYC binding protein 2, E3 ubiquitin protein ligase [Source:MGI Symbol;Acc:MGI:2179432])

HSP 1 Score: 108.997 bits (271), Expect = 7.676e-23
Identity = 136/591 (23.01%), Postives = 253/591 (42.81%), Query Frame = 1
Query:  247 KTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKK-----------CSDW-SNRNQEIPVSEQFCLINQLPDNVTSESLISNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELA--KYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKITNFHGFPSTPGWKYYLFANYTKLGCCLINEDETYSEQLFMKLFKLNSEKFLVEECE-KSIDMTQHL--ILKFEIEQ-----SKIFSNPSTLIETCPSLSLACEVLNLEEFCVVRNQSGEIFY----KDIDNVERNNNVENWTRLLYTDYVAAKFHKLIGGIDNKFICAISDDG--LWRININRHSQPRTLCLDRLMPNSRFISKTWASG------SCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            K PKI+ + L  +++ I++T  S+P +C + LQ++L  L+  QP    SE  ++++ LF+LLL            +  RS  M                           N S  ++L  ++ ACLFS+  + G     L A++ +L  NG       IQ P ++  L++             DW SN  ++  +  ++ L     D      L ++G +L+ L   GL KIG+G++G+++G +Y +   +   K    W+G  +   LL+  L   S      +T  +I+ + L+ DG V L   +  G       +  LF +   +     + D+ +     +++F  ++E  L +E + K      H   I  F++E+     S  F   S ++                EF +++  +G+I+Y    + +   +   +   W  L  T   + K      G D      +++DG   +  + ++     +    R     +        G      +C+  + +++SK+G++    KD+I+S S+   + L  + VTQ+++GK+H   L +NG + TFGVNN  QCG
Sbjct:  195 KLPKIIEVGLCEVFELIKETRFSHPSLCLRSLQALLNVLQGQQPEGLQSEPPEVLESLFQLLL-----------EITVRSTGM---------------------------NDSTGQSLTALSCACLFSLVASWGETGRTLQAISAILTNNGS-HACQTIQVPTILNSLQRSVQAVLVGKIQVQDWFSNGIKKAALMHKWPLKEVSVDEDDQCLLQNDGFFLYLLCKDGLYKIGSGYSGTVRGHIYNSTSRIRNRKEKKSWLG-YAQGYLLYRDLNNHS------MTAIRISPETLEQDGTVLLPDCHTEG-------QNILFTDGEYINQIAASRDDGF----VVRIFATSTEPVLQQELQLKLARKCLHACGISLFDLEKDLHIISTGFDEESAILGAG------------REFALMKTANGKIYYTGKYQSLGIKQGGPSAGKWVELPITK--SPKIVHFSVGHDGSHALLVAEDGSVFFTGSASKGEDGESTKSRRQSKPYKPKKIIKMEGKIVVYTACNNGSSSVISKDGELYMFGKDAIYSDSSSLVSDLKGHFVTQVAMGKAHTCVLMKNGEVWTFGVNNKGQCG 714          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Mouse
Match: Rcbtb2 (regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2 [Source:MGI Symbol;Acc:MGI:1917200])

HSP 1 Score: 69.3218 bits (168), Expect = 8.162e-11
Identity = 64/260 (24.62%), Postives = 117/260 (45.00%), Query Frame = 1
Query: 1633 QPRTLCLDRLMPNSRFISKTWASGSCSKDNLALVSKEGQVLFLEKDSI---------HSLSTCYGAL-LSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCGCVSVDNDGKYNEIMQEIDNNNVD--SCSQIRSKHQVPTIKPQKLLIYS-DTNASSGIKNRSN-----------FLRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVVPIQCKSVRITT-----GSFSTGILSQNGKVFIFG 2325
            +PR L  D L    +  S ++ SG     ++ L + +G+V     ++          H L  C+ +  LS   V +++ G  H   L+ +G +  +G NN  Q G  S  N      +   + N  V   +C Q+ S   V T    ++ ++  + N   G+ +  N            +R+Q+++CG+ HT++LT  G +Y++G N + QLG G  SN+  P   P+  +  RI        + ++   +Q G V+++G
Sbjct:   88 EPRRL--DSLT-GKKIASLSYGSGP----HIVLATTDGEVFTWGHNAYSQLGNGTTNHGLVPCHISTNLSNKQVIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTANQPIPRRVTGCLQNKVVMNIACGQMCSMAVVDT---GEVYVWGYNGNGQLGLGSSGNQPTPCRVAALQGIRVQRVACGYAHTLVLTDEGQIYAWGANSYGQLGTGNKSNQSYP--TPVVVEKDRIIEIAACHSAHTSAAKTQGGHVYMWG 335          
BLAST of E3 ubiquitin protein ligase-1 vs. UniProt/SwissProt
Match: sp|F1RD40|MYCB2_DANRE (E3 ubiquitin-protein ligase MYCBP2 OS=Danio rerio OX=7955 GN=mycbp2 PE=2 SV=1)

HSP 1 Score: 427.943 bits (1099), Expect = 3.969e-118
Identity = 378/1269 (29.79%), Postives = 580/1269 (45.71%), Query Frame = 1
Query: 9331 MRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIW--------CMFNLLEKHKSIDKSNKPQISLIEEKNLKVYSQQLWAV---GSAVF---YRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINF-EKSQVFSCLSELLNHLDDS---KVFNGRIISTHENSIK----INSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAI-----YQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYN--CFTTSYQNRIEKKELQDNHDIESKS-----LHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDIL-FGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAG---KSLSIQMKSKSCS--QQSGLKPFQDFLQKINNLPNFIQTSH-------------CDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECF--MAINQNSDFINWENPNLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKP-SDQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + F + +  +  L +A++ +LR      ++ + + WLL NV   +SL  ++W          F   E+    +K NK   +L +EK+L V    L  +   G A     +     +   S+L     S   L +M ++  SL          F QS   F  +S VF  ++ +L+  DD    + FN  + S +E   +    +    D+T +     +S      SL D +T+ FWES   + +    I +     C + I  +   VSV++D +RDI N  VT+ + +   A+      +Q+ ++  H+GW++  L   +          HV+  E        G  N  +RVR VKVL   E  S     +      +    + ETL+ F  +T+ +F    C         E+K L  + + E K+     L + +V I+F     T  + +V +            HI+  I +E T++  + +       N N    +      D +  + CF+LL+ VLALSG+  G +YL  Q  L++DL  LL+  S ++++QV   + R+   V+P  L  ++    + P +  +  +   K +  +  L +L +F G   K+L++Q+K+K  +    +G+   +        LP    +S+                  A  I +L+  ++  +   AW    +  + +       M     S         L+  +  L + +     +  + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + T+ H R     +  + K         V+ HE C R K    +   D+ T+K ++   ++                         KP S  ++ CRFC        +     C  Q+CQ  + +ACS K  PCGH C GV    KNE     +C P C+   C   +T     LKQD DD+CMICFT+ LS  P I L+ C H+ H  C RR ++  W G R++F F  CP CK KI H  L+DLL+P   L ++V+RKAL+RLE+EGL  S  +  S       P  FA+++Y YY+C+KCK +Y+GGEARC+ +                  DP  EL C ACSDV++A++C KH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct: 3443 LAFVIQHHDLEGLEVAMKHALRKSACRVFAMEAFNWLLCNVTQTTSLHDILWHFVASLTPSPFETEEEEDEENKGNKE--NLEQEKDLGVCEHPLSDIIIAGEAAHPLPHTFHCLLQTISDLMMSLPSGSSLQQMALRCWSL---------KFKQSDHQFLHQSNVFHHINNILSKSDDGDSEESFNISVQSGYEAISQELCVVTCLKDLTSVVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKSITIS----CVKGI--NASYVSVHVDNSRDIGN-KVTSMIFLCGKAVEDLCRIKQIDLDSRHMGWVTSELPGGDH---------HVIKIE------LKGPEN-TLRVRQVKVLGWKEGESIKIAGQISASVAQQKNCEAETLRVFRLITSQVFGKLICGDAEPTPEQEEKNLLSSPEGEDKAPSDADLKEHMVGIIFSRSKLTNLQKQVCA------------HIVQAIRMEATRVREEWEHAISSKENANSQPSDD-----DASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPMRLASVIGVKALPPADISDIIHSTEKGD--WTKLGILDMFLGCIAKALTVQLKAKGTTIVGTAGMAAGKGV--TTVTLPMIFNSSYIRRGESHWWMKGSTPPQIAEIIIKLVKDMAAGHLSDAWSRVTKNAIAETIIALTKMEEEHRSPVRCIATTRLWLALASLCVLDQ----DHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNACG------------------NLCTDCDRFLHLHRRTRTHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFREHT-----------------------GKPASSSSDACRFCGTRHGTELSAVGSVCSDQDCQEYAKLACS-KTHPCGHPCGGV----KNED----LCLP-CL-HGCDKTATC----LKQDADDMCMICFTEALSAAPAIQLD-CSHVFHLQCTRRVLENRWLGPRITFGFMSCPICKNKINHLVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITMSGARFFNNPAGFAMNRYAYYVCFKCKKAYFGGEARCDAE-----------AGQGDDYDP-RELICGACSDVSRAQMCSKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSVPKEELPHCPAGPKGKQLEGSECPLHVVHPPTGEEFALGCGVCRNAHTF 4574          

HSP 2 Score: 191.045 bits (484), Expect = 2.183e-46
Identity = 173/636 (27.20%), Postives = 275/636 (43.24%), Query Frame = 1
Query: 5572 DYFTIIESNHPYEQAKLLHNTIKFPDSVDAISITFDGHCVTAQPEDF--LVVKAR-------TNTANGNQTENKWKIIFKNLSNIISDWPKKAVIIQGNEIAIEFHTASLY-EESLESTYGFKCSIVGH--CSKIDAFIELLENALTYLASRCATSLLEFRKKSKVIKLLHETNI---------LQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSC--SSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQV------------------TSQMSNIEVLFNYNHKGNNPFININEKLFGGHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIRAAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNKDKND-KP-KYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLK--EHLNKIFLTPAKI 7344
            +++ ++ES+HPY+QA +    + FPD V  +++ FD  C TAQPED   L++ +R       ++ A  ++T N W  + K   +  S WP   +++ GNE      TAS Y ++   S YGFKC  VG+     +D  I  LE  L YL S CA +L+   KK   + + +E            LQ C+ +  +L +GL+LS  PT+ + L  +   ++ + + +F++ F+         +C  SS   +L++WLQ                   P  Y D  K    T+++ N+          + ++  DQY + V                  + Q  N++ L       +N      +  FGGHP P     +E  II +  Y +ITMMK YE +SFEE+R A        S+ +  R +  + ++  +W P A G Y + +TID I             +ID      VK+ P   I   T+  K K + +P K   F  K S+GLR+RS PS  S  +GI+  N  + + +E+  ++ VW+RL                              N ET+                   KK V  N+  +TE WCL   +HL +  L P  +
Sbjct: 2005 NHYAVLESDHPYKQAGVTQYKVSFPDCVRWMTVEFDPQCGTAQPEDVLRLLIPSRSLHFSGLSSKALAHETINSWTELKKFSGS--SGWPTAVLVLPGNEALFSLETASDYVKDEKASFYGFKCVAVGYEFNPGLDEGIIQLEKELAYLGSVCAAALM---KKDLALPIGNELEEDLEILEEASLQVCKSHSGLLGKGLALSHSPTILEALEGNLPLHLQTNEHSFLEDFI---------TCVQSSSGGRLARWLQ-------------------PDSYADPQK----TSLILNKDDIRCGWPTTVVVQTKDQYGDVVHVPNMKVEVKAVPVSQKKSIQQENMKKLQRLPGTSSNSATG-TDLTFGGHPAPKLEATYEPMIIKEARYIAITMMKAYENYSFEELRFASPTPKR-PSENMLIR-ANTDGTYSANWTPGAVGLYTIHVTIDGI-------------EIDAGLEVEVKDPPKGMIPPGTQMVKPKAEPQPSKVRKFVAKDSAGLRVRSHPSLQSEQIGIVQVNGTITFIDEIHNDDGVWLRL------------------------------NDETV-------------------KKYVP-NMNGYTEAWCLSFNQHLGRSLLVPVDV 2537          

HSP 3 Score: 159.458 bits (402), Expect = 6.592e-37
Identity = 188/774 (24.29%), Postives = 331/774 (42.76%), Query Frame = 1
Query: 2098 LRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVV-PIQCKSVRITTGSFSTGILSQNGKVFIFG----NKITSPQIIDLISNPNDLTDNLQPIFFNFSTNNYKKQIIFCILKQNIFYMKRKPLTLSTHRKSYHQDQFKFLAKDNTILL---TLDEQ---RGLLINISSGTIKIMPDYDEGNFSSLMNSYFDPRYSVLWS-IDSGHGSKKFTVKYSKSNIFQSDNFQDKFDQL---IDLPDDISFSSQRYRIALNVL------VSAEKLLLKKYADPQNNNQIKTVDSNKEIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMP-DIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYPFNGKFNELCHLEETLVKIPSLGYSKDTESQETSVVIGDFRIIVRNIFLEC--KICHYLQSIKSTYGAESLIYAECWKLFTEDLIPVYKETFEHSFHAFYPEIEDQRFTLQEAL----LKVYEFCFNKSTDTLCNYGKIMFLTSLLTAINSANEGFLIFTHKDNSVTRSGENKINGENN--FAHRFPLLREYMRTI 4329
            LR  Q+SCG +H+V+L  NGDVY+FG  +  QLG G ++++  P +V  +   S ++T GS  T +L  +G+VF FG     ++  P I+D+         N +P         Y ++  +     +  +++     +++H  +  +      A  + I L   ++ E    + LLIN   G+ +   D ++ +         DP Y V+W  +        +    + + +  + + Q     L   + LP     S+ R   AL++L       + ++L +   +  +    +  V S ++   V RF      W YS ++ ++I+F     I + G+GL+ G GE T  IK++E  G D             ++T      L  ETD V   +   ++   +M   P++L     YV  A ++G S+D G HG++ I TD GV F+FK SK S+NGT V  GQIP++ Y  R+P +     K  +++   ++    T   +  +S++   S +++L+W +T L     EL  L+      T     L  LE L+      T  L+++R +I  ++P +     +                   ES + +  +G  R +++ I  E        L +    Y ++ L          E ++     TF   FH+FYP    Q   L + L      + E  F  S+  L     +  + S L   +      L   +    + RS   +++ EN+   AHRFPLL  +M  +
Sbjct:  925 LRAVQVSCGFHHSVVLMENGDVYTFGYGQHGQLGHGDVNSRGSPTLVQALPGPSTQVTAGSNHTAVLLMDGQVFTFGSFSKGQLGRP-ILDMPYW------NAKPSPMPNIGAKYGRKATWIGASGDQTFLRIDEALINSHVLATSE----IFANKHIIGLVPTSISEPPPFKCLLINKLDGSCRTFNDSEQEDLQGF-GLCLDPVYDVIWRFLPVTREMCCYNAVIADARVPTASDIQALCSILSPELALPSGSHASTTRSHGALHILGCLDTLAAMQELKMGVASAEEETQAVMKVYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFCADADILLGGLGLFGGRGEYTAKIKLFE-LGPDGG----------DHETDGD---LLAETD-VLAYDCAAREKYAMMFDEPVLLQLGWWYVAWARVSGPSSDCGSHGQATITTDDGVVFQFKSSKKSNNGTDVNAGQIPQLLY--RLPSNDGNASKGKQQTSEPVHILKRT--FARTVSVDCFESLLSILHWSWTTLVLGVEELRGLKGFQFTAT-----LLDLERLRFVG---TCCLRLLRVYICDIFPISASTKAIVE-----------------ESSKLAECVGKTRSLLKKILSEGMDNCLTKLDNDPQGYLSQPLT-------LLEAVLQECHNTFTACFHSFYPTPALQWACLCDLLNCLDQDIQEANFRTSSSRL-----LAAVMSALCNTSVKLTSILPIAYDGEVLLRSLVKQVSTENDSALAHRFPLLVAHMEKL 1630          

HSP 4 Score: 65.0846 bits (157), Expect = 2.428e-8
Identity = 29/71 (40.85%), Postives = 50/71 (70.42%), Query Frame = 1
Query: 1705 SCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            +C+  + ++V+K+G++    KD+I+S STC  + L  + VTQ+++GK+H   L+++G + TFGVNN  QCG
Sbjct:  635 ACNNGSSSIVTKDGELYMFGKDAIYSDSTCQVSDLKGHFVTQVAMGKAHTCVLTKSGEVWTFGVNNKGQCG 705          
BLAST of E3 ubiquitin protein ligase-1 vs. UniProt/SwissProt
Match: sp|O75592|MYCB2_HUMAN (E3 ubiquitin-protein ligase MYCBP2 OS=Homo sapiens OX=9606 GN=MYCBP2 PE=1 SV=4)

HSP 1 Score: 422.55 bits (1085), Expect = 2.034e-116
Identity = 376/1279 (29.40%), Postives = 579/1279 (45.27%), Query Frame = 1
Query: 9331 MRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLL--------EKHKSIDKSNKPQISLIEEKNLKVYSQQLWAV---GSAV------FYRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINF-EKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPM-------DITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAI-----YQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKE--LQDNHDIESK--------SLHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGV--IHPNEFENPQNVKIKLEKPFIPLNLLIIFAG---KSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSH-------------CDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENP-------NLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPS-DQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + F + +  +  L +A++ +LR      ++ + + WLL NV   +SL  ++W     L        E+    +K++K      +EK+ +V    L  +   G A       F+R+L  I               L +M ++  SL          F QS   F  +S VF  ++ +L+  DD        IS       ++  +       D+T +     +S      SL D +T+ FWES   + +    I +     C + I  +   VSV++D +RD+ N  VT+   +   A+      +QV ++  HIGW++  L   +          H++  E        G  N  +RVR VKVL   +  ST    +      +    + ETL+ F  +T+ +F    +   +   E++E  L  + + E K         L + +V I+F     T  + +V +            HI+  I +E T++  + +       N N   ++      D +  + CF+LL+ VLALSG+  G +YL  Q  L++DL  LL+  S ++++QV   + R+   V+P  L  I+ GV  + P +  +  +   K +  +  L +L +F G   K+L++Q+K+K  +                 LP    +S+               +  +  I +LI  ++  +   AW    +     I E  +A+ +  +   + +P        L+  +  L + +     +  + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + TK H R     +  + K         V+ HE C R K    +   D+ T+K ++   ++                         KP+   +E CRFC   S    +     C   +CQ  + +ACS K  PCGH C GV    KNE      C P      C +    S   LKQD DD+CMICFT+ LS  P I L +C H+ H  C RR ++  W G R++F F  CP CK KI H  L+DLL+P   L ++V+RKAL+RLE+EGL  S  +          P  +A+++Y YY+CYKC+ +Y+GGEARC+ +                  DP  EL C ACSDV++A++CPKH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct: 3544 LAFVIQHHDLEGLEIAMKQALRKSACRVFAMEAFNWLLCNVIQTTSLHDILWHFVASLTPAPVEPEEEEDEENKTSKENSE--QEKDTRVCEHPLSDIVIAGEAAHPLPHTFHRLLQTISDLMMSLPSGS---SLQQMALRCWSL---------KFKQSDHQFLHQSNVFHHINNILSKSDDGDSEESFSISIQSGFEAMSQELCIVMCLKDLTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKNITIN----CVKGI--NARYVSVHVDNSRDLGN-KVTSMTFLTGKAVEDLCRIKQVDLDSRHIGWVTSELPGGDN---------HIIKIE------LKGPEN-TLRVRQVKVLGWKDGESTKIAGQISASVAQQRNCEAETLRVFRLITSQVFGKLISGDAEPTPEQEEKALLSSPEGEEKVYNATSDADLKEHMVGIIFSRSKLTNLQKQVCA------------HIVQAIRMEATRVREEWEHAISSKENANSQPND-----EDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPSRLASII-GVKSLPPADISDIIHSTEKGD--WNKLGILDMFLGCIAKALTVQLKAKGTTITGTAGTTVGKGVTTVTLPMIFNSSYLRRGESHWWMKGSTPTQISEIIIKLIKDMAAGHLSEAWSRVTKN---AIAETIIALTKMEE--EFRSPVRCIATTRLWLALASLCVLDQ----DHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNVCG------------------NLCTDCDRFLHLHRRTKTHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFREHT-----------------------GKPTTSSSEACRFCGSRSGTELSAVGSVCSDADCQEYAKIACS-KTHPCGHPCGGV----KNEEH----CLP------CLHGCDKSATSLKQDADDMCMICFTEALSAAPAIQL-DCSHIFHLQCCRRVLENRWLGPRITFGFISCPICKNKINHIVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITTPGVRFYNDPAGYAMNRYAYYVCYKCRKAYFGGEARCDAE-----------AGRGDDYDP-RELICGACSDVSRAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSIPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF 4678          

HSP 2 Score: 171.785 bits (434), Expect = 1.368e-40
Identity = 243/1090 (22.29%), Postives = 438/1090 (40.18%), Query Frame = 1
Query: 2098 LRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVV-PIQCKSVRITTGSFSTGILSQNGKVFIFGN----KITSPQIIDLISNPNDLTDNLQPIFFNFSTNNYKKQIIFCILKQNIFYMKRKPLTLSTHRKSYHQDQFKFLAKDNTILL---TLDEQ---RGLLINISSGTIKIMPDYDEGNFSSLMNSYFDPRYSVLWSIDSGHGSKK---FTVKYSKSNIFQSDNFQDKFDQL---IDLPDDISFSSQRYRIALNVL------VSAEKLLLKKYADPQNNNQIKTVDSNKEIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMP----DIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYPFNGKFNELCHLEETLVKIPSLGYSKDTESQETSVVIGDFRIIVRNIFLE----CKICHYLQSIKSTYGAESLIYAECWKLFTEDLIPVYKETFEHSFHAFYPEIEDQRFTLQEAL----LKVYEFCFNKSTDTLCNYGKIMFLTSLLTAINSANEGFLIFTHKDNSVTRSGENKINGENN--FAHRFPLLREYMRTIWKPSTPCSSDILASTSTMIHCLLAIITLDIKTAYKTCKQINSSSTTENDVSEKKLFQQEMTNLINASHQILTNITRLLVDQLN--HSAKTPAFRMSQVNSTNSKQNGHNNNQTYLEDIILTTQSRFKRVVWLDKSAENSRQKFVEQAINVAEQEIEDVICFAINKNTYQFINGFEVVGDNVIYLEGIKVYCSNFTESRCLAYIYRIKNFQEGIREKWELIPMEYEWKNEEQDLIASDLIFKRKLKLEESYRYAVKVFLIAANNKKTLIGQNPVSKLGTRFGYHFNLYETKLRTTANQNSRQGIIFSLLY 5250
            LR  Q+SCG +H+V+L  NGDVY+FG  +  QLG G ++++  P +V  +   S ++T GS  T +L  +G+VF FG+    ++  P I+D+         N +P       + Y ++  +     +  +++     +++H  +  +      A  + I L   ++ E    + LLIN   G+ K   D ++ +         DP Y V+W       +++   +    + + +  + + Q +   L   + LP      + R   AL++L       + + L +   +  +    +  V S ++   V RF      W YS ++ ++I+FS    I + G+GL+ G GE T  IK++E  G D             ++T      L  ETD V   +   ++   +M   P++L +   YV  A ++G S+D G HG++ I TD GV F+FK SK S+NGT V  GQIP++ Y  R+P       K K+   +  + +  +      +  +S+    S +++L+W +T L     EL  L+      T     L  LE L+      T  L+++R +   +YP                 + + G +   E+ + +  IG  R ++R I  E    C +   L +    Y ++ L          E ++     TF   FH+FYP    Q   L + L      + E  F  S+  L     +  + S L   +          +    + RS   +++ EN+    HRFPLL  +M  + +     S   + S   ++  +L I+ L ++ + +   ++ SS    N          E+T     S           VD LN  HS K  A R ++ +   S   G+ +                                              D ICF+++K     + GF V G   I+   ++V   +   +    + +R  +         EL+   Y   +   D+  +++   + + L+E+ +YAV+   +     +T  G   ++ +    G  F      L +     +R G I  +LY
Sbjct:  940 LRAVQVSCGFHHSVVLMENGDVYTFGYGQHGQLGHGDVNSRGCPTLVQALPGPSTQVTAGSNHTAVLLMDGQVFTFGSFSKGQLGRP-ILDVPYW------NAKPAPMPNIGSKYGRKATWIGASGDQTFLRIDEALINSHVLATSE----IFASKHIIGLVPASISEPPPFKCLLINKVDGSCKTFNDSEQEDLQGF-GVCLDPVYDVIWRFRPN--TRELWCYNAVVADARLPSAADMQSRCSILSPELALPTGSRALTTRSHAALHILGCLDTLAAMQDLKMGVASTEEETQAVMKVYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFSADTDILLGGLGLFGGRGEYTAKIKLFE-LGPDGG----------DHETDGD---LLAETD-VLAYDCAAREKYAMMFDEPVLLQAGWWYVAWARVSGPSSDCGSHGQASITTDDGVVFQFKSSKKSNNGTDVNAGQIPQLLY--RLPTSDGSASKGKQQTSEPVHILKRS-----FARTVSVECFESLLSILHWSWTTLVLGVEELRGLKGFQFTAT-----LLDLERLRFVG---TCCLRLLRVYTCEIYP-----------------VSATGKAVVEETSKLAECIGKTRTLLRKILSEGVDHCMV--KLDNDPQGYLSQPLS-------LLEAVLQECHNTFTACFHSFYPTPALQWACLCDLLNCLDQDIQEANFKTSSSRL-----LAAVMSALCHTSVKLTSIFPIAYDGEVLLRSIVKQVSTENDSTLVHRFPLLVAHMEKLSQSEENISG--MTSFREVLEKMLVIVVLPVRNSLRRENELFSSHLVSNTCGLLASIVSELTASALGSE----------VDGLNSLHSVKASANRFTKTSQGRSWNTGNGS---------------------------------------------PDAICFSVDKPGIVVV-GFSVYGGGGIHEYELEVLVDDSEHAGDSTHSHRWTSL--------ELVKGTYTTDDSPSDI--AEIRLDKVVPLKENVKYAVR---LRNYGSRTANGDGGMTTVQCPDGVTFTFSTCSLSSNGTNQTR-GQIPQILY 1882          

HSP 3 Score: 170.629 bits (431), Expect = 3.242e-40
Identity = 169/630 (26.83%), Postives = 260/630 (41.27%), Query Frame = 1
Query: 5575 YFTIIESNHPYEQAKLLHNTIKFPDSVDAISITFDGHCVTAQPEDFLVVKARTNTANGNQTENKWKIIFKNLSNII--------SDWPKKAVIIQGNEIAIEFHTASLY-EESLESTYGFKCSIVGH--CSKIDAFIELLENALTYLASRCATSL------LEFRKKSKVIKLLHETNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSC--SSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQVTSQMSNIEV-LFNYNHK---------------GNNPFINI----NEKLFGGHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIRAAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNKDKND-KP-KYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLK--EHLNKIFLTP 7335
            ++ +IES HPY+ A ++H  + FP+ V  ++I FD  C TAQ ED L +     T   +    K   + +NL++ I        S WP   +++ GNE      TAS Y ++   S YGFKC  +G+      D  +  LE  L  L   CA +L      L    + +    + E   LQ C+ +  IL +GL+LS  PT+ + L  +    I S + +F+  F+         +C   S   +L++WLQ                   P  Y D  K    T+++ N+          + ++  DQY + V      +EV     + K                 +P +       +  +GG   P   V +E  I+ +  Y +ITMMK YE +SFEE+R A        S+ +  R +  + ++  +W P A G Y L +TID I             +ID      VK+ P   I   T+  K K++ +P K   F  K S+GLR+RS PS  S  +GI+  N  + + +E+  ++ VW+RL                              N ETI                   KK V  N+  +TE WCL   +HL K  L P
Sbjct: 2019 HYAVIESEHPYKPACVMHYKVTFPECVRWMTIEFDPQCGTAQSEDVLRLLIPVRTVQNSGYGPKLTSVHENLNSWIELKKFSGSSGWPTMVLVLPGNEALFSLETASDYVKDDKASFYGFKCFAIGYEFSPGPDEGVIQLEKELANLGGVCAAALMKKDLALPIGNELEEDLEILEEAALQVCKTHSGILGKGLALSHSPTILEALEGNLPLQIQSNEQSFLDDFI---------ACVPGSSGGRLARWLQ-------------------PDSYADPQK----TSLILNKDDIRCGWPTTITVQTKDQYGDVVHVPNMKVEVKAVPVSQKKMSLQQDQAKKPQRIPGSPAVTAASSNTDMTYGGLASPKLDVSYEPMIVKEARYIAITMMKVYENYSFEELRFASPTPKR-PSENMLIRVN-NDGTYCANWTPGAIGLYTLHVTIDGI-------------EIDAGLEVKVKDPPKGMIPPGTQLVKPKSEPQPNKVRKFVAKDSAGLRIRSHPSLQSEQIGIVKVNGTITFIDEIHNDDGVWLRL------------------------------NDETI-------------------KKYVP-NMNGYTEAWCLSFNQHLGKSLLVP 2551          

HSP 4 Score: 111.694 bits (278), Expect = 1.657e-22
Identity = 134/591 (22.67%), Postives = 252/591 (42.64%), Query Frame = 1
Query:  247 KTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKKC-----------SDW-SNRNQEIPVSEQFCLINQLPDNVTSESLISNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELA--KYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKITNFHGFPSTPGWKYYLFANYTKLGCCLINEDETYSEQLFMKLFKLNSEKFLVEECEKSID---MTQHLILKFEIEQ-----SKIFSNPSTLIETCPSLSLACEVLNLEEFCVVRNQSGEIFY----KDIDNVERNNNVENWTRLLYTDYVAAKFHKLIGGIDNKFICAISDDG--LWRININRHSQPRTLCLDRLMPNSRFISKTWASG------SCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            K PKI+ + L  +++ I++T  S+P +C + LQ++L  L+  QP    SE  ++++ LF+LLL I             RS  M                           N S  ++L  ++ ACLFS+  + G     L A++ +L  NG       IQ P ++  L++             DW SN  ++  +  ++ L     D      L ++G +L+ L   GL KIG+G++G+++G +Y +   +   K    W+G  +   LL+  +   S      +T  +I+ + L+ DG V L   +  G       +  LF +   +     + D+ +     +++F  ++E  L +E +  +    +    I  F++E+     S  F   S ++                EF +++  +G+I+Y    + +   +   +   W  L  T   + K      G D      +++DG   +  + ++     +    R     +        G      +C+  + +++SK+G++    KD+I+S S+     L  + VTQ+++GK+H   L +NG + TFGVNN  QCG
Sbjct:  195 KLPKIIEVGLCEVFELIKETRFSHPSLCLRSLQALLNVLQGQQPEGLQSEPPEVLESLFQLLLEITV-----------RSTGM---------------------------NDSTGQSLTALSCACLFSLVASWGETGRTLQAISAILTNNGS-HACQTIQVPTILNSLQRSVQAVLVGKIQIQDWFSNGIKKAALMHKWPLKEISVDEDDQCLLQNDGFFLYLLCKDGLYKIGSGYSGTVRGHIYNSTSRIRNRKEKKSWLGY-AQGYLLYRDVNNHS------MTAIRISPETLEQDGTVMLPDCHTEG-------QNILFTDGEYINQIAASRDDGF----VVRIFATSTEPVLQQELQLKLARKCLHACGISLFDLEKDLHIISTGFDEESAILGAG------------REFALMKTANGKIYYTGKYQSLGIKQGGPSAGKWVELPITK--SPKIVHFSVGHDGSHALLVAEDGSIFFTGSASKGEDGESTKSRRQSKPYKPKKIIKMEGKIVVYTACNNGSSSVISKDGELYMFGKDAIYSDSSSLVTDLKGHFVTQVAMGKAHTCVLMKNGEVWTFGVNNKGQCG 714          
BLAST of E3 ubiquitin protein ligase-1 vs. UniProt/SwissProt
Match: sp|Q7TPH6|MYCB2_MOUSE (E3 ubiquitin-protein ligase MYCBP2 OS=Mus musculus OX=10090 GN=Mycbp2 PE=1 SV=3)

HSP 1 Score: 421.009 bits (1081), Expect = 6.226e-116
Identity = 378/1280 (29.53%), Postives = 575/1280 (44.92%), Query Frame = 1
Query: 9331 MRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLLEKHK--------SIDKSNKPQISLIEEKNLKVYSQQLWAV---GSAV------FYRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINF-EKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPM-------DITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAIYQ-----QVVIEPDHIGWISFHLENA-NQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKE--LQDNHDIESK--------SLHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGV--IHPNEFENPQNVKIKLEKPFIPLNLLIIFAG---KSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSH-------------CDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENP-------NLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPS-DQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + F + +  +  L +A++ +LR      ++ + + WLL NV   +SL  ++W     L              +KSNK      +EK+ +V    L  +   G A       F+R+L  I               L +M ++  SL          F QS   F  +S VF  ++ +L+  DD        IS       ++  +       D+T +     +S      SL D +T+ FWES   + +    I +     C + I  +   VSV++D +RD+ N  VT+   +   A+ +     QV ++  HIGW++  L    NQI   I I                G  N  +RVR VKVL   +  ST    +      +    + ETL+ F  +T+ +F    +   +   E++E  L  + + E K         L + +V I+F     T  + +V +            HI+  I +E T++  + +       N N    +      D +  + CF+LL+ VLALSG+  G +YL  Q  L++DL  LL+  S ++++QV   + R+   V+P  L  I+ GV  + P +  +  +   K +  +  L +L +F G   K+L++Q+K+K  +                 LP    +S+               +  +  I +LI  ++  +   AW    +     I E  +A+ +  +   + +P        L+  +  L + +     +  + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + TK H R     +  + K         V+ HE C R K    +   D+ T+K ++   ++                         KP+   +E CRFC   S    +     C   +CQ  + +ACS K  PCGH C GV    +NE      C P      C +    S   LKQD DD+CMICFT+ LS  P I L+ C H+ H  C RR ++  W G R++F F  CP CK KI H  L+DLL+P   L ++V+RKAL+RLE+EGL  S  +             +A+++Y YY+CYKC+ +Y+GGEARC+ +                  DP  EL C ACSDV++A++CPKH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct: 3615 LAFVIQHHDLEGLEIAMKQALRKSACRVFAMEAFNWLLCNVIQTTSLHDILWHFVAALTPSPVEAEEDEDEDNKSNKENAE--QEKDTRVCEHPLSDIVIAGEAAHPLPHTFHRLLQTISDLMMSLPSGS---SLQQMALRCWSL---------KFKQSDHQFLHQSNVFHHINNILSKSDDGDSEESFSISVQSGFEAMSQELCIVMCLKDLTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKNITIN----CVKGI--NARYVSVHVDNSRDLGN-KVTSMTFLTGKAVEELCRIKQVDLDSRHIGWVTSELPGGDNQI---IKIEL-------------KGPEN-TLRVRQVKVLGWKDGESTKIAGQISASVAQQRSCEAETLRVFRLITSQVFGKLISGDAEPTPEQEEKALLSSPEGEEKVYNATSDADLKEHMVGIIFSRSKLTNLQKQVCA------------HIVQAIRMEATRVREEWEHAISSKENANSQPSD-----EDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPNRLASII-GVKSLPPADISDIIHSTEKGD--WNKLGILDMFLGCIAKALTVQLKAKGTTITGTAGTTVGKGVTTVTLPMIFNSSYLRRGESHWWMKGSTPTQISEIIIRLIKDMAAGHLSEAWSRVTKN---AIAETIIALTKMEE--EFRSPVRCIATTRLWLALASLCVLDQ----DHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNICG------------------NLCTDCDRFLHLHRRTKTHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFREHT-----------------------GKPTTSSSEACRFCGSRSGTELSAVGSVCSDADCQEYAKIACS-KTHPCGHPCGGV----RNEEH----CLP------CLHGCDKSATTLKQDADDMCMICFTEALSAAPAIQLD-CSHVFHLQCCRRVLENRWLGPRITFGFISCPICKNKINHIVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITTPGVRFYNDAAGYAMNRYAYYVCYKCRKAYFGGEARCDAE-----------AGQGDDYDP-RELICGACSDVSRAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSIPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF 4749          

HSP 2 Score: 175.637 bits (444), Expect = 9.023e-42
Identity = 244/1085 (22.49%), Postives = 437/1085 (40.28%), Query Frame = 1
Query: 2098 LRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVV-PIQCKSVRITTGSFSTGILSQNGKVFIFGN----KITSPQIIDLISNPNDLTDNLQPIFFNFSTNNYKKQIIFCILKQNIFYMKRKPLTLSTHRKSYHQDQFKFLAKDNTILL---TLDEQ---RGLLINISSGTIKIMPDYDEGNFSSLMNSYFDPRYSVLWSI-DSGHGSKKFTVKYSKSNIFQSDNFQDKFDQL---IDLPDDISFSSQRYRIALNVL------VSAEKLLLKKYADPQNNNQIKTVDSNKEIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMP----DIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYPFNGKFNELCHLEETLVKIPSLGYSKDTESQETSVVIGDFRIIVRNIFLE----CKICHYLQSIKSTYGAESLIYAECWKLFTEDLIPVYKETFEHSFHAFYPEIEDQRFTLQEALLKVYEFCFNKSTDTLCNYGKIM-FLTSLLTAINSANEGFLIFTHKDNSVTRSGENKINGENN--FAHRFPLLREYMRTIWKPSTPCSSDILASTSTMIHCLLAIITLDIKTAYKTCKQINSSSTTENDVSEKKLFQQEMTNLINASHQILTNITRLLVDQLN--HSAKTPAFRMSQVNSTNSKQNGHNNNQTYLEDIILTTQSRFKRVVWLDKSAENSRQKFVEQAINVAEQEIEDVICFAINKNTYQFINGFEVVGDNVIYLEGIKVYCSNFTESRCLAYIYRIKNFQEGIREKWELIPMEYEWKNEEQDLIASDLIFKRKLKLEESYRYAVKVFLIAANNKKTLIGQNPVSKLGTRFGYHFNLYETKLRTTANQNSRQGIIFSLLY 5250
            LR  Q+SCG +H+V+L  NGDVY+FG  +  QLG G ++++  P +V  +   S ++T GS  T +L  +G+VF FG+    ++  P I+D+         N +P       + Y ++  +     +  +++     +++H  +  +      A  + I L   ++ E    + LLIN   G+ K   D ++ +         DP Y VLW    S      +    + + +  + + Q +   L   + LP      + R   AL++L       + + L +   +  +    +  V S ++   V RF      W YS ++ ++I+FS    I + G+GL+ G GE T  IK++E  G D             ++T      L  ETD V   +   ++   +M   P++L +   YV  A ++G S+D G HG++ I TD GV F+FK SK S+NGT V  GQIP++ Y  R+P       K K+   +  + +  +      +  +S+    S +++L+W +T L     EL  L+      T     L  LE L+      T  L+++R +   +YP                 + + G +   E+ + +  IG  R ++R I  E    C +   L +    Y ++ L          E ++     TF   FH+FYP        LQ A L     C ++  +   +  +++  + S L   +          +    + RS   +++ EN+    HRFPLL  +M  + +     S   + S   ++  +L I+ L ++ + +   ++ SS    N          E+T     S           VD LN  HS K  A R ++ +   S   G+ +                                              D ICFA++K     + GF V G   I+   ++V   +   +    + +R  +         EL+   Y   +   D+  +++   + + L+E+ +YAV+   +     +T  G   ++ +    G  F      L +     +R G I  +LY
Sbjct:  940 LRAVQVSCGFHHSVVLMENGDVYTFGYGQHGQLGHGDVNSRGCPTLVQALPGPSTQVTAGSNHTAVLLMDGQVFTFGSFSKGQLGRP-ILDIPYW------NAKPAPMPNIGSKYGRKATWIGASGDQTFLRIDEALINSHVLATSE----IFASKHIIGLVPASISEPPPFKCLLINKVDGSCKTFNDSEQEDLQGF-GVCLDPVYDVLWRFRPSTRELWCYNAVVADARLPSATDMQSRCSILSPELALPTGSRALTTRSHAALHILGCLDTLAAMQDLKMGIASTEEETQAVMKVYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFSADTDILLGGLGLFGGRGEYTAKIKLFE-LGPDGG----------DHETDGD---LLAETD-VLAYDCAAREKYAMMFDEPVLLQAGWWYVAWARVSGPSSDCGSHGQASITTDDGVIFQFKSSKKSNNGTDVNAGQIPQLLY--RLPTSDGSTSKGKQQTSEPVHILKRS-----FARTVSVECFESLLSILHWSWTTLVLGVEELRGLKGFQFTAT-----LLDLERLRFVG---TCCLRLLRVYTCEIYP-----------------VSATGKAVVEETSKLAECIGKTRTLLRKILSEGVDHCMV--KLDNDPQGYLSQPL-------RLLEAVLQECHNTFTACFHSFYPTP-----ALQWACLCDLLNCLDQEANFKTSSSRLLAAVMSALCHTSVKLTSLFPIAYDGEVLLRSIVKQVSTENDSTLVHRFPLLVGHMEKLSQSEENISG--MTSFREVLEKMLVIVVLPVRNSLRRESELFSSHLVSNTCGLLASIVSELTASALGSE----------VDGLNSLHSVKASANRFTKTSQGRSWNTGNGS---------------------------------------------PDAICFAVDKPGIVVV-GFAVYGGGGIHEYELEVLVDDSEHAGDSTHSHRWTSL--------ELVKGTYTTDDSPSDI--AEIRLDKVVPLKENVKYAVR---LRNYGSRTANGDGGMTTVQCPDGVTFTFSTCSLSSNGTNQTR-GQIPQILY 1879          

HSP 3 Score: 169.859 bits (429), Expect = 4.701e-40
Identity = 168/629 (26.71%), Postives = 261/629 (41.49%), Query Frame = 1
Query: 5572 DYFTIIESNHPYEQAKLLHNTIKFPDSVDAISITFDGHCVTAQPEDFLVVKARTNTANGNQTENKWKIIFKNLSNII--------SDWPKKAVIIQGNEIAIEFHTASLY-EESLESTYGFKCSIVGH--CSKIDAFIELLENALTYLASRCATSL------LEFRKKSKVIKLLHETNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSC--SSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQVTSQMSNIEV-LFNYNHKGNNPFININEKL-----------------FGGHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIRAAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNKDKND-KP-KYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLK--EHLNKIFLTP 7335
            +++ +IES HPY+ A ++H  + FP+ V  ++I FD  C TAQ ED + +     T   +    K   + +NL++ +        S WP   +++ GNE      TAS Y ++   S YGFKC  +G+      D  +  LE  L  L   CA +L      L    + +    + E   LQ C+ +  IL +GL+LS  PT+ + L  +    I S + +F+  F+         +C   S   +L++WLQ                   P  Y D  K    T+++ N+          + ++  DQY + V      +EV     + K  +   +  +K                  FGG   P   V +E  I+ +  Y +ITMMK YE +SFEE+R A        S+ +  R +  + ++  +W P A G Y + +TID I             +ID      VK+ P   I   T+  K K D +P K   F  K S+GLR+RS PS  S  +GI+  N  + + +E+  ++ VW+RL                              N+ETI                   KK V  N+  +TE WCL   +HL K  L P
Sbjct: 2015 NHYAVIESEHPYKPACVMHYKVTFPECVRWMTIEFDPQCGTAQSEDVIRLLIPVRTIQNSGYGAKLTSVHENLNSWVELKKYSGSSGWPTMVLVLPGNEALFSLETASDYVKDDKASFYGFKCFAIGYEFSPGPDEGVIQLEKELANLGGVCAAALMKKDLALPVGNELEEDLEILEEAALQVCKTHSGILGKGLALSHSPTILEALEGNLPLQIQSNEQSFLDDFI---------ACVPGSSGGRLARWLQ-------------------PDSYADPQK----TSLILNKDDIRCGWPTTITVQTKDQYGDVVHVPNMKVEVKAVPVSQKKTSLQQDQGKKCQRIPGSPSAAASSADMTFGGLASPKLDVSYEPMIVKEARYIAITMMKVYENYSFEELRFASPTPKR-PSENMLIRVN-NDGTYCANWTPGAIGLYTVHVTIDGI-------------EIDAGLEVKVKDPPKGMIPPGTQLVKPKADPQPNKIRKFVAKDSAGLRIRSHPSLQSEQIGIVRVNGTITFIDEIHNDDGVWLRL------------------------------NEETI-------------------KKYVP-NMNGYTEAWCLSFNQHLGKSLLVP 2546          

HSP 4 Score: 108.997 bits (271), Expect = 1.228e-21
Identity = 135/591 (22.84%), Postives = 253/591 (42.81%), Query Frame = 1
Query:  247 KTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKK-----------CSDW-SNRNQEIPVSEQFCLINQLPDNVTSESLISNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELA--KYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKITNFHGFPSTPGWKYYLFANYTKLGCCLINEDETYSEQLFMKLFKLNSEKFLVEECEKSID---MTQHLILKFEIEQ-----SKIFSNPSTLIETCPSLSLACEVLNLEEFCVVRNQSGEIFY----KDIDNVERNNNVENWTRLLYTDYVAAKFHKLIGGIDNKFICAISDDG--LWRININRHSQPRTLCLDRLMPNSRFISKTWASG------SCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            K PKI+ + L  +++ I++T  S+P +C + LQ++L  L+  QP    SE  ++++ LF+LLL I             RS  M                           N S  ++L  ++ ACLFS+  + G     L A++ +L  NG       IQ P ++  L++             DW SN  ++  +  ++ L     D      L ++G +L+ L   GL KIG+G++G+++G +Y +   +   K    W+G  +   LL+  L   S      +T  +I+ + L+ DG V L   +  G       +  LF +   +     + D+ +     +++F  ++E  L +E +  +    +    I  F++E+     S  F   S ++                EF +++  +G+I+Y    + +   +   +   W  L  T   + K      G D      +++DG   +  + ++     +    R     +        G      +C+  + +++SK+G++    KD+I+S S+   + L  + VTQ+++GK+H   L +NG + TFGVNN  QCG
Sbjct:  195 KLPKIIEVGLCEVFELIKETRFSHPSLCLRSLQALLNVLQGQQPEGLQSEPPEVLESLFQLLLEITV-----------RSTGM---------------------------NDSTGQSLTALSCACLFSLVASWGETGRTLQAISAILTNNGS-HACQTIQVPTILNSLQRSVQAVLVGKIQVQDWFSNGIKKAALMHKWPLKEVSVDEDDQCLLQNDGFFLYLLCKDGLYKIGSGYSGTVRGHIYNSTSRIRNRKEKKSWLGY-AQGYLLYRDLNNHS------MTAIRISPETLEQDGTVLLPDCHTEG-------QNILFTDGEYINQIAASRDDGF----VVRIFATSTEPVLQQELQLKLARKCLHACGISLFDLEKDLHIISTGFDEESAILGAG------------REFALMKTANGKIYYTGKYQSLGIKQGGPSAGKWVELPITK--SPKIVHFSVGHDGSHALLVAEDGSVFFTGSASKGEDGESTKSRRQSKPYKPKKIIKMEGKIVVYTACNNGSSSVISKDGELYMFGKDAIYSDSSSLVSDLKGHFVTQVAMGKAHTCVLMKNGEVWTFGVNNKGQCG 714          
BLAST of E3 ubiquitin protein ligase-1 vs. UniProt/SwissProt
Match: sp|Q9NB71|HIW_DROME (E3 ubiquitin-protein ligase highwire OS=Drosophila melanogaster OX=7227 GN=hiw PE=1 SV=2)

HSP 1 Score: 328.946 bits (842), Expect = 4.381e-88
Identity = 200/503 (39.76%), Postives = 271/503 (53.88%), Query Frame = 1
Query: 11455 KKMCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPSDQNERCRFCNETSTN--VDNKFACLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQST-----LSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + +C+NHDD  T A + C TC                    LC +CDR+LHL++ T+ H R     +  + +         V  HESC R K    +   D+ TLK ++     +                      IS P +   RCRFC  T  +  ++    C   +CQ  ++ +C  K +PCGH C GV          ++ C P C+   C  +       L    L QD DD+CMICF + LS  P I LE C H+ HYHC +  ++  W G R++F F  CP CK  I+HP L D+LEP + L+++VKRKAL+R+++EG++     KD+D     +  + A+ +Y YY+C+KC+ +YYGGEARC+ ++                 DP  EL C  CSDVA+A++CPKH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LPQCPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct: 4808 RPLCSNHDDGETAAIIQCETCGS------------------LCGDCDRFLHLNRKTRSHKRTVCKEEEEAIR---------VELHESCGRTKLFWLLALADSKTLKAMVEFRDGSHTI-------------------ISGPQEAVGRCRFCGLTGNSGLLEIGNVCADAQCQEYAANSCL-KTKPCGHACGGVT--------GERKCLP-CLQHVCHTRENELAEELRDPKLTQDADDMCMICFVEALSCAPSIHLE-CGHVFHYHCCKAVLEKRWSGPRITFGFSLCPICKADIQHPLLSDILEPINGLKQDVKRKALMRIKYEGVV-----KDTDSKNVNM-TQLAMDRYAYYVCFKCQKAYYGGEARCDAEI-------------GEKFDP-EELVCGGCSDVARAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCDTCHDDFQRLTNIPKVKLPQCPAGPKAKQLLGDECPLHVMHPPTGEEFALGCGVCRNAQTF 5233          

HSP 2 Score: 114.775 bits (286), Expect = 2.307e-23
Identity = 121/479 (25.26%), Postives = 216/479 (45.09%), Query Frame = 1
Query: 5758 ENKWKIIFKNLSNIISDWPKKAVIIQGNEIAIEFHTASLY-EESLESTYGFKCSIVGH-----CSKIDAFIELLENALTYLASRCATSLLEFRKKSKVIKLLHE-TNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYI----NSIQTTFVKKFVEGSNYYPETSCSSPAVQLSKWLQSCSVVIVSNCRLKLAPTSM----PAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQVTSQMSNIEVLFNYNHKGNNPFIN-INEKLFG-GHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIR-AAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNKDKNDKPKYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQW--YGYYPSD 7134
            + +W ++ K   N  S W    +I+ GN +     TASLY ++   + YGFKC +VG+      +  ++ +  LE  L YL   C+ +L++        K + + + I +    + ++L +G +LS+ P LT  + ++   Y+     S +  F+K F+ G+         S   +L+ WLQ  S +  + C L      +    P++    ++      ++  ++  E+ K I              TS  S  EV    +  G N ++   +   +G G   P   + +E T+  K ++++IT MK Y  +SFEE+R A+  Q  V +    K     E+ +F + W P + G Y L +TID I L+     D             VK G +    +R    +      K   F+ + SSGLR+RS P+  S  +G++    V+ + +E+  ++ VW+RL  +S  Q    G+YP++
Sbjct: 2644 DREWIVVKK--FNTASTWLHNVLILPGNCVEFSLETASLYAQDPHNNRYGFKCLVVGYDNPTSINASNSCLIRLEQELAYLGGMCSANLMKKELNLPDDKDVEDMSGIEETINTHHTLLSKGFALSE-PQLT--VHQALESYLPIGSQSNERQFLKDFISGAP-------GSSGARLAAWLQPESRLDPNKCELNTITEPLRYGWPSQVTVTIRDQYGDAVLVPELKVEI-KAIPTGSGPNGSATGTGTSCTSVAEV----SAPGPNLWMRRASRDTWGWGGMAPPPRINYEPTVKDKMVFKAITFMKPYANYSFEELRYASPVQTRVTELLNAK---DMEDGTFSVQWTPSSVGAYCLAVTIDGIPLEEVYRVD-------------VKEGILPPPTQRNSAQRRPQAPSKLRRFQARHSSGLRIRSHPTLQSEQVGVVRVGGVISFIDEIENDDGVWLRLSTESIRQHCTMGWYPTE 3089          

HSP 3 Score: 110.153 bits (274), Expect = 5.745e-22
Identity = 127/598 (21.24%), Postives = 241/598 (40.30%), Query Frame = 1
Query:  253 PKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPP-FDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKKCSDWSNRNQEIPVSEQF--------CLINQLPDN---------VTSESLISNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELAKYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKITNFHGFPSTPGWKYYLFANYTKLGCCLINEDETYSEQ---LFMKLFKLNSEKF-----LVEECEKSID---MTQHLILKFEIEQSKIFSNPSTLIETCPSLSLACEVLNL---EEFCVVRNQSGEIFYKDIDNVERNNNVENWTRLLYTDYVAAKFHKLIG---GIDNKFICAISDDG-LWRININRHSQPRTLCLDRLMPN-------SRFISKTWASGSCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            P I+   L ++++ I D    +P++C K L+++L  ++  QP  +  E +++I+ L+ LLL      D+ T                               +P   +     + N   +A A L  + IA+G+   +L A+  +L+    L     +Q P ++  L+     +  N+  P    F         LI++ P           +TS ++  +G +++ L    LLKIGTGF GS +G +Y  NE+ +   + W+G     +        R+ +         + +D L I     L + +        G  Y LF +   L     N D+T   +   L+   + ++   F     L  +  +++        L+ +++I++ +   N        P      +V+ +   +EF +VR  +G ++Y           V     L  T+ V +K   ++    G D      ++DDG ++     R  +      +R  P        ++         +C+    A V+K G+++   KD+ H  +  + + L   HVT+++LGK+H   L+  G L +FG+NN  QCG
Sbjct:  236 PLIVGAGLRSLFELIADARHVHPLLCTKALKALLDVIQGQQPESFKLEPEELINPLYDLLL------DLAT-------------------------------MPAALNSATGAEANWSAMACAALLGLCIARGDTGKMLKAIAAMLMTPRQLSAQ-IVQLPVVLATLQHTVISAALNK--PTRPDFHSHGVPHNSLIDEFPVKLPPLSTGAPITSPAMACDGVFVYLLYGGTLLKIGTGFGGSYKGHIYAQNEDFSHERSAWLGYSGGQLYFR-----RTCRRSAGDQLQMVGLDTLAIKAMSPLSMLHMR-----EGLNYVLFTDDDSLHAICSNRDDTLVVKKLNLYHNSYNIDPPPFELPLQLARKKFRTLGYAAFEDELLNQYQIQRIQSAHNSFEPKLPAPCRDADVDVMGMACGKEFGLVRASNGRVYYYGKSAALGLKCVGRTPTLKLTELVISKAANIVHVAVGHDGIHALLVNDDGTVFFAGTARRGEDGDSSKNRRQPKAVKPKKMTKIDGHVVVHAACNNGTSAFVTKTGKLIMYGKDTAHCDAMGFVSELLEQHVTKVALGKAHCVALNAKGQLFSFGLNNKGQCG 783          

HSP 4 Score: 102.834 bits (255), Expect = 9.328e-20
Identity = 96/376 (25.53%), Postives = 160/376 (42.55%), Query Frame = 1
Query: 2674 DPRYSVLWSIDSGHGSKKFTVKYSKSNIFQSDNFQDKFDQLID----LPDDISFSSQRYRIALN------VLVSAEKLLLKKYADPQNNNQIKTVDSNK-EIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMPDIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYP 3768
            DP Y+VLW  D G   K        S+I  SD     +  L+     LPD +     R + +LN      +L SA+  +   +  P      +T ++   E   V RF      W YS ++ ++I+FS    I I G G++ G GE +  +K+++           L  +   Y+ +    +L +ET +V  +     K   ++LP P+   + + Y++ A I G S+D G  G++ + T+  V F FK SK ++NGT V  GQIP I Y     D  +     +           +   ++ +S     S V LL+W +    C   +L + +  S        L      +K       S L+++RK+   +YP
Sbjct: 1332 DPTYNVLWVFD-GAARKLRCHNVVASDINDSDANAATYRSLLSPELSLPDRVDSRVARSQASLNLLACLDILTSAQDNIPGCFEQPLLKQTQQTAETQAGEFQVVNRFDNFGGGWGYSGHSVEAIRFSADTDIVICGFGMFGGRGEYSCKLKLFD-----------LGGDGGGYEKEG---ILISETKEVPYECGARSKH-HILLPKPVSAVAGRWYLVWARIAGPSSDCGSCGQASVTTEDQVVFSFKSSKKANNGTDVNSGQIPAILYRLVTQDCKQTPAQMDADP----VQRISRAFANSVSRECFESLVVLLSWSW---DCFKLQLREERDRSRPLQLQQSLQYLGYVIK-------SCLRLLRKYTIEIYP 1677          

HSP 5 Score: 65.4698 bits (158), Expect = 1.919e-8
Identity = 30/75 (40.00%), Postives = 47/75 (62.67%), Query Frame = 1
Query: 2104 IQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVVPIQCKSVRITTGSFSTGILSQNGKVFIFGN 2328
            + Q++CG +HTV+LT+ G+VY+FG+N++ QLG G L     P  V +     ++  GS  T +L+  G V+ FGN
Sbjct:  968 VVQVACGLHHTVVLTLAGEVYTFGSNQYGQLGSGDLQPVSGPVRVQVPGAISQVAAGSNHTVLLTSKGMVYTFGN 1042          
BLAST of E3 ubiquitin protein ligase-1 vs. UniProt/SwissProt
Match: sp|Q17551|RPM1_CAEEL (E3 ubiquitin-protein ligase rpm-1 OS=Caenorhabditis elegans OX=6239 GN=rpm-1 PE=1 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 6.212e-77
Identity = 184/526 (34.98%), Postives = 265/526 (50.38%), Query Frame = 1
Query: 11410 WNNLSSTARVLKSGEKK----MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPSDQNER---------CRFCNETSTNVDNKF--ACLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            W  LS   + ++  E +    +C NHDD  T+A V C  C                  + LC EC   +HL K  + H   NL +Q  +  D        +N H+ C R+K   F++      L  ++ ++ + +   +T++                +P+ Q+           CRFC       D      C  ++C   +  AC   +  C H+C G+    +NE +    C P C+  TC  +         QDGDDVC+ICFT+ L   P I L  C HM H+HC R  ++  W G R+ F F +CP C Q IEH  LQDL+EP   + +EV  KA +RLE++GL+ +P + D        PEE+AL +Y Y LC+KCK +Y+GGE+RC+  +            +S   +P  EL C  CSD +  ++CP+H  ++LEYKCR+CCSIAV+FCFGTTHFC  CHD+   ++  P   LP CP GP    +    CPL + HPPTG+EFA+GC +CR + TF
Sbjct: 3314 WLELSERWKTVQDEEDQEPVLLCENHDDGHTVAQVFCVDCD-----------------VALCKECFTVMHLHKKNRNHGVKNL-VQSSTQHD--------INIHQGCARMKFLNFLILFHGEALNGMVEVAADTLFPTSTSSI---------------QPAMQSSSAFLGIHPMTCRFCGNNVPVEDQSLDGTCTHEDCVNYAKTAC-QVMHTCNHFCGGI----RNEEE----CLP-CM--TCKREDA------AQDGDDVCVICFTERLGAAPCIRL-GCGHMFHFHCVRMILERRWNGPRIVFRFMQCPLCIQPIEHSGLQDLIEPLKTIRQEVVDKAKMRLEYDGLLTTPALTDPRSEFYNQPEEYALDRYMYVLCHKCKKAYFGGESRCQAAL------------DSSQFNPE-ELLCGGCSDTSGVQVCPRHGVEYLEYKCRFCCSIAVYFCFGTTHFCAPCHDDFQRLMSLPKHLLPTCPVGPRSTPMEEQTCPLKMKHPPTGDEFAMGCGICRNISTF 3766          

HSP 2 Score: 132.109 bits (331), Expect = 1.295e-28
Identity = 183/776 (23.58%), Postives = 321/776 (41.37%), Query Frame = 1
Query: 5041 FKRKLKLEESYRYAVKVFLIAANNKKTLIGQNPVSKL----GTRFGYHFNLYETKLRTTANQNSRQGIIFSLL---YSFSTKPQSVTDNQRLERKCVKMCLIELLAQVKYGLVTMIRETNPEELLSIGQKLFIDTYLPFFCHQLQLVSNVSKKIT---------CLSITFVRETLIVIQENWKTTDKLINS-EKD-----------YFTIIESNHPYEQAKLLHNTIKFPDSVDAISITFDGHCVTAQPEDFLVVKARTNTANGNQTENKWKIIFKNLSNIISDWPKKAVIIQGNEIAIEFHTASLYEESL-ESTYGFKCSIVGHCSKIDAFIELLENALTYLASRCATSLLEFRKKSKVIKLLH--ETNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSCSSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQVTSQMSNIEVLFNYNHKGNNPFININEKLFGGHPVPNTTV----PFERTIIGKDIYQSITMMKNYEAHSFEEIRAAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSD-----NITLKIDVTKSSLVKNGPVEKIRKRTENNKDKNDKPKYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDS-----FNQWYG------YYPSDPLDQRPILSIEPVMSNQETIPFRRKAV 7215
            F   + L     YAVKV ++   N KT  G+  V+++    G R  +      ++  TT  +     +I+S+L    S   K +++ D   L        L+ L+A                    IG  +     LP  C  L  +S+++  +           L +    E LI +  N    +++ +S + D             T++ES HPY+        + F +  D I + F   C TAQ +D L +  + +       E+ +  I +      S+WP   +I+ GN +      +S  E +  E  +G+  ++ G+    +     LE  L +L++     + +       I+ L   E +     E + S+L +GLSLS  PTL++  +K Q     S    F+++F+ G         S+ A  L+KWL + SVV  S C+L L+         D+L       IVG        K + L+L   DQY+ +V      +EV  +  H+  NP   I++ L  G+ +P++ +    PF+  I+    Y +I  M  Y  +S EEIR     E + K  R+  + S + + F   W P   GKY +   +D   + ++ T +     +   K  +TK S  + G  +    RT +    +D            SG+R+R   +  S  +G+IP   ++ + EE+  ++  W+RL  ++      NQ  G      Y+   PL QR ++ ++     ++ +  RRK +
Sbjct: 1588 FPEYVLLSPGVTYAVKVNMM--KNTKTFCGEGGVTQVHLLNGARL-FFSGCSMSQNGTTVQRGQLPYLIYSILDQSNSLQIKQETIYDTFTL--------LLRLMAN------------------KIGAAITEGGALPACCQHL--MSHINPHVMVYMERFPDKALEMMSTMEQLIPMVSNLNGVERVFHSYDSDDSGCDTPYSGIVTTVVESQHPYKPNTSSSMVLLF-EEADYICVRFSPDCQTAQFDDQLTIYLKID-------EHSYMPIERCYG---SEWPSYPMILPGNCLMFVLDASSAVEGATSEQMFGYHVTVTGYLVGYNDSTMRLEQDLVWLSANACRIMTQLPINPSNIEHLSTAEDDTRHLFEKHGSLLKKGLSLSHSPTLSELCTKGQPPPAQSADLQFLREFLSGHT-------STSAGFLAKWLPTGSVVDASKCQLSLSH--------DDL-------IVG--------KAVTLKLLCKDQYDREVDCPKLQVEVFASLGHR--NPSSTIHQNLHIGN-LPSSLLIHQNPFQPIIVNHTRYMNIAAMPAYANYSVEEIRLGFMIEELVK-DRVPLK-SSDSSLFSGTWTPTTAGKYRIECKVDGSDISHTYTVEVTERPHRAGKGTITKPSGSRRG-AQMTVARTVSIPFSSD-----------FSGIRMRLGTTLASTSVGVIPRGALVEFIEEMDNDDGKWIRLTDETALLYGCNQGVGQVWCLAYH--RPL-QRELIPLKADTDREKAVKLRRKEI 2271          

HSP 3 Score: 104.375 bits (259), Expect = 3.315e-20
Identity = 84/275 (30.55%), Postives = 129/275 (46.91%), Query Frame = 1
Query: 2674 DPRYSVLWSIDSGHGSKKFTVKYSKSNIFQSDNFQDKFDQLIDLPDDISFSSQRYRIA------------LNVLVSAEKLLLKKYADPQNNNQIKTVDSNKEIF----TVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYY 3450
            DP+Y +LW  +S     K    + KS      +  D FD L  L     F+ Q Y               L+   SA  + L ++   ++  + +  D  K I        RF      W YS N+ ++I+F VS+ I + G+GLY G GE    +K+Y + G ++D           Y  Q       TETD+  V +    +   L+   PI++  N  +V+ A I+G S+D G +G+  ++ D GVTF+F++S  S+NGT V  GQIPE+YY
Sbjct:  953 DPKYDMLWYYNSAEMEIKGYDIFKKSE----KSVGDAFDSLTFLAG-AEFAVQVYDSPAYATSMSLGMQLLSATFSANVINLSEFWKEKHGEREQ--DHEKTIMDGYSVANRFDGTGGGWGYSANSVEAIQFKVSKEIRLVGVGLYGGRGEYISKLKLYRQIGTEADEL---------YVEQ------ITETDET-VYDCGAHETATLLFSQPIVIQPNHWHVVSAKISGPSSDCGANGKRHVECD-GVTFQFRKSAVSNNGTDVDVGQIPELYY 1203          

HSP 4 Score: 56.9954 bits (136), Expect = 6.024e-6
Identity = 46/178 (25.84%), Postives = 78/178 (43.82%), Query Frame = 1
Query: 1810 SPYHVTQISLGKSHGACLSR----NGYLITFGVNNYYQCGCVSVDNDGKYNEIMQEIDNNNVDSCSQIRSKHQVPTIKPQKLLIYSDTNASSGIKNRSNFLRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPK--VVPIQCKSVRITTGSFSTGILSQNGKVFIFG 2325
            +P    Q  L  + G    R     G +   GV       C      G+  E  Q     +V   S   +  Q  T+ P ++++      S G  +    +++  +SCG++HTV+L  +  V++FG+N   QLG G   +K  P+  ++P     V++  GS  T + + +G VF FG
Sbjct:  679 TPSVCAQCGLCSARGVACGRVPRPKGTMCHCGVGESTCLRCGLCRPCGEVTEPAQPGRAQHVQFSST--AAPQRSTLHPSRVIL------SQGPHD----VKVSSVSCGNFHTVLLASDRRVFTFGSNCHGQLGVGDTLSKNTPQQVILPSDTVIVQVAAGSNHTILRANDGSVFTFG 844          
BLAST of E3 ubiquitin protein ligase-1 vs. TrEMBL
Match: A0A172RVP4 (Protein associated with Myc (Fragment) OS=Schmidtea mediterranea OX=79327 GN=PAM PE=2 SV=1)

HSP 1 Score: 2220.28 bits (5752), Expect = 0.000e+0
Identity = 1145/1149 (99.65%), Postives = 1147/1149 (99.83%), Query Frame = 1
Query: 9490 MFNLLEKHKSIDKSNKPQISLIEEKNLKVYSQQLWAVGSAVFYRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINFEKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAIYQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKELQDNHDIESKSLHDFLVNILFDTGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAGKSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSHCDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENPNLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKKMCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPSDQNERCRFCNETSTNVDNKFACLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAPWLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            MFNLLEKHKSIDKSNKPQISLIEEKNLKVYSQQLWAVGSAVFYRILDNIIHNSNLNNLSVSEIKLLEMTVKISSLLLFADGTDESFSQSFINFEKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAIYQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKELQDNHDIESKSLHDFLVNILFDTGFKSEVISSRLSSLQRRVLSHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAGKSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSHCDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENPNLYFLICLLPLFENVKLANFWNNLSSTARVL+SGEKKMCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAM NNNTT NNNNDITPNNTDIEISKPSDQNERCRFCNETSTNVDNKFACLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTL+KFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHKYCYYLCYKCKNSYYGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAPWLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF
Sbjct:    1 MFNLLEKHKSIDKSNKPQISLIEEKNLKVYSQQLWAVGSAVFYRILDNIIHNSNLNNLSVSEIKLLEMTVKISSLLLFADGTDESFSQSFINFEKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAIYQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKELQDNHDIESKSLHDFLVNILFDTGFKSEVISSRLSSLQRRVLSHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAGKSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSHCDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENPNLYFLICLLPLFENVKLANFWNNLSSTARVLRSGEKKMCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMKNNNTTNNNNNDITPNNTDIEISKPSDQNERCRFCNETSTNVDNKFACLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLTKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHKYCYYLCYKCKNSYYGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAPWLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 1149          
BLAST of E3 ubiquitin protein ligase-1 vs. TrEMBL
Match: I1ZI76 (E3 ubiquitin protein ligase-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1030.39 bits (2663), Expect = 0.000e+0
Identity = 543/544 (99.82%), Postives = 543/544 (99.82%), Query Frame = 1
Query: 11305 MAINQNSDFINWENPNLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKKMCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPSDQNERCRFCNETSTNVDNKFACLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAPWLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            MAINQNSDFINWEN NLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKKMCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMNNNNTTTNNNNDITPNNTDIEISKPSDQNERCRFCNETSTNVDNKFACLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHKYCYYLCYKCKNSYYGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAPWLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF
Sbjct:    1 MAINQNSDFINWENQNLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKKMCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMNNNNTTTNNNNDITPNNTDIEISKPSDQNERCRFCNETSTNVDNKFACLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHKYCYYLCYKCKNSYYGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAPWLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 544          
BLAST of E3 ubiquitin protein ligase-1 vs. TrEMBL
Match: A0A087US30 (Putative E3 ubiquitin-protein ligase MYCBP2 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_01088 PE=4 SV=1)

HSP 1 Score: 424.861 bits (1091), Expect = 6.944e-122
Identity = 349/1111 (31.41%), Postives = 505/1111 (45.45%), Query Frame = 1
Query: 9766 FEKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKT----AIYQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKELQDNHD------------IESKSLHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDIL---------FGVIHPNEFENPQN-VKIKLEKPFIPLNLLIIFAGKSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSHCDSNFASKIYQLICQLSDENNHA----AW--------------FVYIQEWLRDIFECFMAINQNSDFINWENPNLYFLICLLPLF--ENVKLANFWNNLSSTARVLKSGEKKMCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPSDQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
              +S VFS +S++L+  ++     G   +  + S  I +  D+T L     +S      SL DN T+ FWES   + +     +  +N  C   I     +V +++D  RD+ N     T +   +       +QV +E  +IGW+S  + +          G H     +L         ++ +R+R VKVL + E  S     +   ++++    + ETLK F  +T+ +F    T   +   +KK +  NHD            +E+  L + +V ILF     T  + +V S            HI+  I  E  ++   R +    + + ++   E L K  D      CF++L+ VLALSG+  G  YL  QA L+RDL  LL+ GS ++++QV   + R+   VSP +L  IL         F +I     EN Q  +   +    I L++ +    K+L++Q K K  S  +           I+   +           A K+ ++I QL  +        AW                 ++E  R   EC               P L+  +  L +   E+V+  +    + +     +S  +  C NHDD  T A ++C TC                    LCAECDRYLHL++ T+ H R     +  + K         V+ HE C R K    +   D+ TLK ++   +                          KPS     CRFC  +S+         C   ECQ   +  CS K+ PCGH C G+     NES      P L  +  C  + +     LKQD DD+CMICF + L+  P I L  C H+ H HC R  +   W G R++F F  CP C+  +EH  L+DLL+P   L ++VKRKAL+RLE+EGL  +  +          P  FA+ +Y YY+CYKCK +YYGGEARC+ +        +D        DP TEL C ACSDV++A++CPKH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   V   P   LP CPAGP  + L   ECPLHV HPPTGEEFALGC +CR   TF
Sbjct:   30 LHRSHVFSNISKILSRTEEEDD-AGASDAYAQVSADIEALKDVTPLIDIKASSRQAMVNSLTDNTTETFWESGDEDRNK----VKMLNLSCGSKI--QPKMVYIHIDNCRDLGNKVSGVTFKASPSFDEMVKLKQVEVENRYIGWVSCDIPD----------GKHTCIRIELKG------PDNTLRLRQVKVLGSQEGESIRIGKKVSAMQIQQKNCEAETLKVFRLLTSQVFGKLITGEQECSEDKKNII-NHDGDRMQLSQSQSTLETNDLKEHMVGILFSRSKLTHLQKQVCS------------HIVAAIRKEAARV---RDEWEALLCSKSQSVEE-LPKSSDAY----CFEMLSMVLALSGSSVGRSYLAQQAGLLRDLFSLLHTGSARVQRQVTSLLRRVLPDVSPPTLASILGVTSLPPTDFSIISEANKENKQEEISFDIHNTGI-LDVFLACIAKALTVQTKVKGSSTNAKGINTVTLATSIHPRDHVGSRWWLRGCMARKLAEVIIQLLKDMAAGKLTEAWANVTKGAIAENILNLTKLEEHHRSPSECL------------RTPTLWLALASLCVLDQEHVERLSSGQWVGNCGDGQQSQPRPFCDNHDDSETPAIILCSTCGN------------------LCAECDRYLHLNRKTRCHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWVMCLADSKTLKAMVEFREGTR----------------------GKPSSSG-ICRFCGSSSSTGLLSIGNVCNEPECQDHGNNVCS-KMLPCGHMCGGIY----NES------PCLPCLHRCGGEIS----SLKQDADDMCMICFIEALACAPAIQLA-CGHVFHLHCCRAVLSKKWSGPRITFRFSLCPICQAPMEHSVLKDLLDPAQSLYEDVKRKALMRLEYEGLHKAEAITTPGARFYNDPAGFAMDRYAYYVCYKCKKAYYGGEARCDAE----AGAGDD-------YDP-TELVCGACSDVSRAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRVTNIPKAELPHCPAGPKAKQLEGDECPLHVKHPPTGEEFALGCGVCRNAHTF 1005          
BLAST of E3 ubiquitin protein ligase-1 vs. TrEMBL
Match: H7C3U4 (E3 ubiquitin-protein ligase MYCBP2 (Fragment) OS=Homo sapiens OX=9606 GN=MYCBP2 PE=1 SV=1)

HSP 1 Score: 419.468 bits (1077), Expect = 1.414e-119
Identity = 343/1119 (30.65%), Postives = 517/1119 (46.20%), Query Frame = 1
Query: 9745 FSQSFINF-EKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPM-------DITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAI-----YQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKE--LQDNHDIESKS-----LHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAG---KSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSH-------------CDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENP-------NLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPS-DQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            F QS   F  +S VF  ++ +L+  DD        IS       ++  +       D+T +     +S      SL D +T+ FWES   + +    I +     C + I  +   VSV++D +RD+ N  VT+   +   A+      +QV ++  HIGW++  L   +          H++  E        G  N  +RVR VKVL   +  ST    +      +    + ETL+ F  +T+ +F    +   +   E++E  L  + + E K+     L + +V I+F     T  + +V +            HI+  I +E T++  + +       N N   ++      D +  + CF+LL+ VLALSG+  G +YL  Q  L++DL  LL+  S ++++QV   + R+   V+P  L  I+ GV      +    +    +  +  L +L +F G   K+L++Q+K+K  +                 LP    +S+               +  +  I +LI  ++  +   AW    +     I E  +A+ +  +   + +P        L+  +  L + +     +  + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + TK H R     +  + K         V+ HE C R K    +   D+ T+K ++   ++                         KP+   +E CRFC   S    +     C   +CQ  + +ACS K  PCGH C GV    KNE      C P      C +    S   LKQD DD+CMICFT+ LS  P I L +C H+ H  C RR ++  W G R++F F  CP CK KI H  L+DLL+P   L ++V+RKAL+RLE+EGL  S  +          P  +A+++Y YY+CYKC+ +Y+GGEARC+ +                  DP  EL C ACSDV++A++CPKH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct:   71 FKQSDHQFLHQSNVFHHINNILSKSDDGDSEESFSISIQSGFEAMSQELCIVMCLKDLTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKNITIN----CVKGI--NARYVSVHVDNSRDLGN-KVTSMTFLTGKAVEDLCRIKQVDLDSRHIGWVTSELPGGDN---------HIIKIE------LKGPEN-TLRVRQVKVLGWKDGESTKIAGQISASVAQQRNCEAETLRVFRLITSQVFGKLISGDAEPTPEQEEKALLSSPEGEEKATSDADLKEHMVGIIFSRSKLTNLQKQVCA------------HIVQAIRMEATRVREEWEHAISSKENANSQPND-----EDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPSRLASII-GVKSLPPADISDIIHSTEKGDWNKLGILDMFLGCIAKALTVQLKAKGTTITGTAGTTVGKGVTTVTLPMIFNSSYLRRGESHWWMKGSTPTQISEIIIKLIKDMAAGHLSEAWSRVTKN---AIAETIIALTKMEE--EFRSPVRCIATTRLWLALASLCVLDQ----DHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNVCGN------------------LCTDCDRFLHLHRRTKTHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFREHT-----------------------GKPTTSSSEACRFCGSRSGTELSAVGSVCSDADCQEYAKIACS-KTHPCGHPCGGV----KNEEH----CLP------CLHGCDKSATSLKQDADDMCMICFTEALSAAPAIQL-DCSHIFHLQCCRRVLENRWLGPRITFGFISCPICKNKINHIVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITTPGVRFYNDPAGYAMNRYAYYVCYKCRKAYFGGEARCDAE-----------AGRGDDYDP-RELICGACSDVSRAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSIPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF 1061          
BLAST of E3 ubiquitin protein ligase-1 vs. TrEMBL
Match: A0A2J8PBD3 (MYCBP2 isoform 15 (Fragment) OS=Pan troglodytes OX=9598 GN=CK820_G0004534 PE=4 SV=1)

HSP 1 Score: 419.468 bits (1077), Expect = 1.653e-119
Identity = 343/1119 (30.65%), Postives = 517/1119 (46.20%), Query Frame = 1
Query: 9745 FSQSFINF-EKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPM-------DITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAI-----YQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKE--LQDNHDIESKS-----LHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAG---KSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSH-------------CDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENP-------NLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPS-DQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            F QS   F  +S VF  ++ +L+  DD        IS       ++  +       D+T +     +S      SL D +T+ FWES   + +    I +     C + I  +   VSV++D +RD+ N  VT+   +   A+      +QV ++  HIGW++  L   +          H++  E        G  N  +RVR VKVL   +  ST    +      +    + ETL+ F  +T+ +F    +   +   E++E  L  + + E K+     L + +V I+F     T  + +V +            HI+  I +E T++  + +       N N   ++      D +  + CF+LL+ VLALSG+  G +YL  Q  L++DL  LL+  S ++++QV   + R+   V+P  L  I+ GV      +    +    +  +  L +L +F G   K+L++Q+K+K  +                 LP    +S+               +  +  I +LI  ++  +   AW    +     I E  +A+ +  +   + +P        L+  +  L + +     +  + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + TK H R     +  + K         V+ HE C R K    +   D+ T+K ++   ++                         KP+   +E CRFC   S    +     C   +CQ  + +ACS K  PCGH C GV    KNE      C P      C +    S   LKQD DD+CMICFT+ LS  P I L +C H+ H  C RR ++  W G R++F F  CP CK KI H  L+DLL+P   L ++V+RKAL+RLE+EGL  S  +          P  +A+++Y YY+CYKC+ +Y+GGEARC+ +                  DP  EL C ACSDV++A++CPKH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct:   70 FKQSDHQFLHQSNVFHHINNILSKSDDGDSEESFSISIQSGFEAMSQELCIVMCLKDLTSIVDIKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKNITIN----CVKGI--NARYVSVHVDNSRDLGN-KVTSMTFLTGKAVEDLCRIKQVDLDSRHIGWVTSELPGGDN---------HIIKIE------LKGPEN-TLRVRQVKVLGWKDGESTKIAGQISASVAQQRNCEAETLRVFRLITSQVFGKLISGDAEPTPEQEEKALLSSPEGEEKATSDADLKEHMVGIIFSRSKLTNLQKQVCA------------HIVQAIRMEATRVREEWEHAISSKENANSQPND-----EDASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPSRLASII-GVKSLPPADISDIIHSTEKGDWNKLGILDMFLGCIAKALTVQLKAKGTTITGTAGTTVGKGVTTVTLPMIFNSSYLRRGESHWWMKGSTPTQISEIIIKLIKDMAAGHLSEAWSRVTKN---AIAETIIALTKMEE--EFRSPVRCIATTRLWLALASLCVLDQ----DHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNVCGN------------------LCTDCDRFLHLHRRTKTHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFREHT-----------------------GKPTTSSSEACRFCGSRSGTELSAVGSVCSDADCQEYAKIACS-KTHPCGHPCGGV----KNEEH----CLP------CLHGCDKSATSLKQDADDMCMICFTEALSAAPAIQL-DCSHIFHLQCCRRVLENRWLGPRITFGFISCPICKNKINHIVLKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITTPGVRFYNDPAGYAMNRYAYYVCYKCRKAYFGGEARCDAE-----------AGRGDDYDP-RELICGACSDVSRAQMCPKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSIPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF 1060          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Cavefish
Match: mycbp2 (MYC binding protein 2 [Source:NCBI gene;Acc:368439])

HSP 1 Score: 421.394 bits (1082), Expect = 4.050e-117
Identity = 374/1274 (29.36%), Postives = 570/1274 (44.74%), Query Frame = 1
Query: 9331 MRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLLEKHKSIDKS-----NKPQISLIE-EKNLKVYSQQLWAV---GSAV------FYRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINF-EKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPM-------DITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAI-----YQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYN--CFTTSYQNRIEKKELQDNHDIESK---------SLHDFLVNILFD----TGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDIL-FGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAG---KSLSIQMKSKSCS--QQSGLKPFQDFLQKINNLPNFIQTSH-------------CDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECF--MAINQNSDFINWENPNLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKP-SDQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + F + +  +  L +A++ +LR      ++ + + WLL NV   +SL  ++W     L    +  +      NK    ++E EK+L V    L  +   G A       F+R+L  I               L +M ++  SL          F QS   F  +S VF  ++ +L+  DD        IS       IN  +       D+T +     +S      SL D +T+ FWES   + +    I +     C + I  +   VSV++D +RDI N  VT+   +   A+      +QV ++  H+GW++  L   +          HV+  E        G  N  +RVR VKVL   E  S     +      +    + ETL+ F  +T+ +F    C         E+K L  + + E K          L + +V I+F     T  + +V +            HI+  I +E T++  + +       N N    +      D +  + CF+LL+ VLALSG+  G +YL  Q  L++DL  LL+  S ++++QV   + R+   V+P  L  ++    + P +  +  +   K +  +  L +L +F G   K+L++Q+K+K  +    +G+   +        LP    +S+                  A  I +L+  ++  +   AW    +  + +       M     S         L+  +  L + +     +  + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + T+ H R     +  + K         V+ HE C R K    +   D+ T+K ++   ++                         KP S  ++ CRFC   +    +     C   +CQ  S +ACS K   CGH C GV    KNE         LC+   C +    S   LKQD DD+CMICFT+ LS  P + L+ C H+ H  C RR ++  W G R++F F  CP CK KI H  ++DLL+P   L ++V+RKAL+RLE+EGL  S  +  +       P  FA+++Y YY+CYKCK +Y+GGEARC+ +                  DP +EL C ACSDV++A++C KH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct: 3408 LAFVIQHHDLEGLEVAMKHALRKSACRVFAMEAFNWLLCNVIQTTSLHDILWHFVASLTPSPNEPEEEEEEDNKGNKEIVEQEKDLGVCEHPLSDIVIAGEAAHPLPHTFHRLLQTISDLMMSLPSGS---SLQQMALRCWSL---------KFKQSDHQFLHQSNVFHHINNILSKSDDGDSEESFNISVQSGYEAINQELCVVTCLKDLTSVVDLKTSSRPAMIGSLTDGSTETFWESGDEDKNKTKNITIS----CVKGI--NASYVSVHVDNSRDIGN-KVTSMTFLCGKAVEDLCRIKQVDLDSRHMGWVTSELPGGDH---------HVIKIE------MKGPEN-TLRVRQVKVLGWKEGESIKIAGQISASVAQQKNCEAETLRVFRLITSQVFGKLICGDAEPTPEQEEKNLLSSPEGEDKVSITAPSDADLKEHMVGIIFSRSKLTNLQKQVCA------------HIVQAIRMEATRVREEWEHAISSKENANSQPSDD-----DASSDAYCFELLSMVLALSGSNVGRQYLAQQLTLLQDLFSLLHTASPRVQRQVTSLLRRVLPEVTPVRLASVIGVKALPPADISDIIHSTEKGD--WNKLGILDMFLGCIAKALTVQLKAKGTTIVGTAGMAAGKGV--TTVTLPMIFNSSYIRRGESHWWMKGSTPPQIAEIIIKLVKDMAAGHLSDAWSRVTKNAIAETIIALTKMEEEHRSPVRCIATTRLWLALASLCVLDQ----DHVDRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNVCG------------------NLCTDCDRFLHLHRRTRSHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFREH-----------------------TGKPASSSSDACRFCGTRNGTELSAVGSVCSDPDCQEYSKLACS-KTHGCGHPCGGV----KNED--------LCL--PCLHGCDKSTGCLKQDADDMCMICFTEALSAAPAVQLD-CSHVFHLQCTRRVLENRWLGPRITFGFMSCPICKNKINHSVIKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITTAGARFYNDPAGFAMNRYAYYVCYKCKKAYFGGEARCDAE-----------AGQGDDYDP-SELICGACSDVSRAQMCSKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSVPKEELPHCPAGPKGKQLEGSECPLHVVHPPTGEEFALGCGVCRNAHTF 4543          

HSP 2 Score: 180.259 bits (456), Expect = 3.826e-44
Identity = 173/630 (27.46%), Postives = 270/630 (42.86%), Query Frame = 1
Query: 5575 YFTIIESNHPYEQAKLLHNTIKFPDSVDAISITFDGHCVTAQPEDF--LVVKAR-------TNTANGNQTENKWKIIFKNLSNIISDWPKKAVIIQGNEIAIEFHTASLYEESLEST-YGFKCSIVGH--CSKIDAFIELLENALTYLASRCATSLLEFRKKSKVIKLLHETNI---------LQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSCSSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQV------------------TSQMSNIEVLFNYNHKGNNPFININEKLFGGHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIRAAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNKDKND-KP-KYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLK--EHLNKIFLTP 7335
            ++++IES+HPY+QA +    + FPD V   +I FD  C TAQPED   L++ +R       ++    ++T N W  + K  S   + WP   +++ GNE      TAS Y +  ++  YGFKC  VG+      D  I  LE  L YL S CA +L+   KK   + + +E            LQ C+ +  IL +GL+LS  PT+ + L  +   ++ S + +F++ F+      P +S      +L++WLQ                   P  Y D  K    T+++ N+          + ++  DQY + V                  + Q  N++ L       +N   +  +  FGG P P     +E  II +  Y +ITMMK YE +SFEE+R A        S+ +  R +  + ++  +W P A G Y + +TID I             +ID      VK+ P   I   T+  K K + +P K   F  K S+GLR+RS PS  S  +GI+  N  + + +E+  ++ VW+RL                              N ET+                   KK V  N+  +TE WCL   +HL +  L P
Sbjct: 1895 HYSVIESDHPYKQAGVTQYKVSFPDCVRWTTIEFDPQCGTAQPEDVLRLLIPSRSLHFSSLSSRPLAHETINAWTEL-KKFSG-ATGWPTSVLVLPGNEALFSLETASDYVKDEKACFYGFKCVAVGYEFNPGPDEGIIQLEKELAYLGSVCAAALM---KKDLALPIGNELEEDLEILEEASLQVCKSHSGILGKGLALSHSPTILEALEGNLPLHLQSNEHSFLEDFI---TCVPNSS----GGRLARWLQ-------------------PDSYADPQK----TSLILNKDDIRCGWPTTVVVQTKDQYGDVVHVPNMKVEVKAVPVSQKKSIQQDNMKKLQRLPGSPSNS-ASGTDLTFGGLPAPKLEATYEPMIIKEARYIAITMMKAYENYSFEELRFASPTPKR-PSENMLIR-ANTDGTYSANWTPGAVGLYTIHVTIDGI-------------EIDAGLEVEVKDPPKGMIPPGTQMVKPKAEPQPSKVRKFVAKDSAGLRVRSHPSLQSEQIGIVQVNGTITFIDEIHNDDGVWLRL------------------------------NDETV-------------------KKYVP-NMNGYTEAWCLSFNQHLGRSLLVP 2423          

HSP 3 Score: 172.555 bits (436), Expect = 8.011e-42
Identity = 245/1086 (22.56%), Postives = 437/1086 (40.24%), Query Frame = 1
Query: 2098 LRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVV-PIQCKSVRITTGSFSTGILSQNGKVFIFGN----KITSPQIIDLISNPNDLTDNLQPIFFNFSTNNYKKQIIFCILKQNIFYMKRKPLTLSTHRKSYHQDQFKFLAKDNTILL---TLDEQ---RGLLINISSGTIKIMPDYDEGNFSSLMNSYFDPRYSVLWS-IDSGHGSKKFTVKYSKSNIFQSDNFQDKFDQL---IDLPDDISFSSQRYRIALNVL------VSAEKLLLKKYADPQNNNQIKTVDSNKEIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMP--DIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYPFNGKFNELCHLEETLVKIPSLGYSKDTESQETSVVIGDFRIIVRNIFLEC--KICHYLQSIKSTYGAESLIYAECWKLFTEDLIPVYKETFEHSFHAFYPEIEDQRFTLQEAL----LKVYEFCFNKSTDTLCNYGKIMFLTSLLTAINSANEGFLIFTHKDNSVTRSGENKINGENN--FAHRFPLLREYMRTIWKPSTPCSSDILASTS--TMIHCLLAIITLDIKTAYKTCKQINSSSTTENDVSEKKLFQQEMTNLINASHQILTNITRLLVDQLN--HSAKTPAFRMSQVNSTNSKQNGHNNNQTYLEDIILTTQSRFKRVVWLDKSAENSRQKFVEQAINVAEQEIEDVICFAINKNTYQFINGFEVVGDNVIYLEGIKVYCSNFTESRCLAYIYRIKNFQEGIREKWELIPMEYEWKNEEQDLIASDLIFKRKLKLEESYRYAVKVFLIAANNKKTLIGQNPVSKLGTRFGYHFNLYETKLRTTANQNSRQGIIFSLLY 5250
            LR  Q+SCG +H+V+L  NGDVY+FG  +  QLG G ++++  P +V  +   SV++T GS  T +L  +G+VF FG+    ++  P I+D+         N +P         Y ++  +     +  +++     +++H  +  +      A  + I L   ++ E    + LLIN   G+ +   D ++ +         DP Y V+W  + S      +    + + +  + + Q +   L   + LP     ++ R   AL++L       + ++L +   +  +    +  V S ++   V RF      W YS ++ ++I+F     I + G+GL+ G GE T  IK++E  G D             ++T      L  ETD V   +   ++   +M   P++L     YV  A ++G S+D G HG++ I TD GV F+FK SK S+NGT V  GQIP++ Y  R+P  D +  K   + S+            +  +S+    S +++L+W +T L     EL  L+       Y+  LL  LE L+      T  L+++R +I  +YP +     +                   ES + +  +G  R +++ I  E        L +    Y ++ L          E ++     TF   FH+FYP    Q   L + L      + E  F  S+  L     +  + S L   +      L   +    + RS   +++ EN+   AHRFPLL  +M  +    +    +++  TS   ++  +L I+ L ++ + +   ++ S     N          E+T     S           VD LN  HS K+   R ++ +   S   G+ +                                              D ICF ++K     + GF V G   I+   ++V   +       A+ +R  +         EL+   Y   +   D+  +++   + + L+ES +YAV+   +     +T  G   ++ +    G  F      L +     +R G I  +LY
Sbjct:  816 LRAVQVSCGFHHSVVLMENGDVYTFGYGQHGQLGHGDVNSRGSPTLVQALPGPSVQVTAGSNHTAVLLVDGQVFTFGSFSKGQLGRP-ILDMPYW------NAKPSPMPNIGAKYGRKATWIGASGDQTFLRIDEALINSHVLATSE----IFASKHIIGLVPTSVSEPPPFKCLLINKMDGSCRTFNDSEQEDLQGF-GLCLDPVYDVIWRFLPSTREMWCYNAVIADARMPSASDIQSRCSILSPELALPSGSHATTTRSHGALHILGCLDTLAAMQELKMGVASAEEETQAVMKVYSKEDYSVVNRFESHGGGWGYSAHSVEAIRFCADADILLGGLGLFGGRGEYTAKIKLFE-LGPDGG----------DHETDGD---LLAETD-VLAYDCAAREKYAMMFDEPVLLQLGWWYVAWARVSGPSSDCGSHGQATITTDDGVVFQFKSSKKSNNGTDVNAGQIPQLLY--RLPSNDGNAAKGKQQTSE---PVHILKRSFARTVSVECFESLLSILHWSWTTLVLGVEELRGLK----GFQYTATLL-DLERLRFVG---TCCLRLLRVYICEIYPISASTKAVVE-----------------ESSKLAECVGKTRSLLKKILSEGMDNCLTKLDNDPQGYLSQPLT-------LLEAVLQECHNTFTACFHSFYPTPALQWACLCDLLNCLDQDIQEANFRTSSSRL-----LAAVMSALCNTSVKLTSILPIAYDGEVLLRSLVKQVSTENDSALAHRFPLLVAHMEKL----SHTEENLMGMTSFREVLEKMLVIVVLPVRKSLRKEMELFSPHLVSNTCGLLASIVSELTASALGSE----------VDGLNSLHSVKSTPNRFTKTSQGRSWNTGNGS---------------------------------------------PDAICFTVDKPGVVLV-GFCVYGGGGIHEYELEVLADDVRHPGDSAHSHRWTSL--------ELVKGTYSTDDSPSDI--AEIRLDKAVPLKESVKYAVR---LRNYGSRTANGDGGMTTVQCSDGVTFTFSTCSLSSNGTNQTR-GQIPQILY 1758          

HSP 4 Score: 120.553 bits (301), Expect = 4.279e-26
Identity = 142/598 (23.75%), Postives = 252/598 (42.14%), Query Frame = 1
Query:  247 KTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKKC-----------SDW-SNRNQEIPVSEQFCLINQLPDNVTSESLISNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELA--KYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINID-----NLQIDGQVNLKITNFH-----GFPSTPGWKYYLFANYTKLGCCLINEDETYSEQLFMKLFK--LNSEKFLVEECEKSIDMTQHLILKFEIEQSKIFSNPSTLIETCPSLSLACEVLNLEEFCVVRNQSGEIFY----KDIDNVERNNNVENWTRLLYTDYVAAKFHKLIGGIDNKFICAISDDGLWRI-----------NINRHSQPRTLCLDRLMPNSRFISKTWASGSCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            K PKI+ + L  +++ I++T  S+  +C + LQ++L  L+  QP  + +E  D+++ LF LLL               RS  M                           N    + L  ++ ACLFS+ +A G+    L AV+ +L  NG       IQ P ++  L++             DW  N  +   +  ++ L     D+     L ++G++L+ L   GL KIG+G++G+++G VY +   +   K    W+G    S+L       R      M    KIN +      LQ DGQ N+  T+             G+   ++A  T         D    ++L +KL +  L++    + + EK +    H+I       S  F   + L+                EF +++  SG+I+Y    + +   +   +   W  L  T   + K  +   G D      +++DG               +     QP+     +++   +  +KT    +C+  + ++V+K+G++    KD+I+S STC  + L  + VTQ+++GK+H   L+++G + TFGVNN  QCG
Sbjct:   75 KLPKIIGIGLCGVFELIKETRFSHSSLCLRSLQALLDMLQGQQPESFQTEPPDVLESLFHLLL-----------ETTVRSTGM---------------------------NDPTGQALTALSCACLFSLVVAWGDTGKTLQAVSAILTNNGS-HACQTIQVPTILNALQRSVQAVLVGKIQIQDWFGNGIKRAALMNKWVLKEVSIDDDERCLLQTDGSFLYLLCKDGLYKIGSGYSGTVRGHVYNSTSRIRNRKEKRSWLGFAQGSLLY------RDMNSHSMAAI-KINPETLEQEGLQSDGQ-NIVFTDGEYINQIAACKDDGFVVRIYATST---------DPALQQELQLKLARKCLHACGISLFDLEKDL----HII-------STGFDEEAALLGAG------------REFALMKTASGKIYYTGKYQSLGIKQGGPSAGKWVELPVTK--SPKIVQFSVGHDGSHALLVAEDGSVFFTGSASKGEDGESTKSRRQPKPYKPKKMI---KLETKTAVYTACNNGSSSIVTKDGELYMFGKDAIYSDSTCQVSDLKGHFVTQVAMGKAHTCVLTKSGEVWTFGVNNKGQCG 588          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Cavefish
Match: ENSAMXT00000020460.2 (pep primary_assembly:Astyanax_mexicanus-2.0:25:7531313:7548716:1 gene:ENSAMXG00000019740.2 transcript:ENSAMXT00000020460.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 5.678e-10
Identity = 50/172 (29.07%), Postives = 73/172 (42.44%), Query Frame = 1
Query: 1822 VTQISLGKSHGACLSRNGYLITFGVNNYYQCGCVSVDNDGKYNEIMQEIDNNNVDSCSQIRSKHQVPTIKPQKLLIYSDTNASSGIKNRSNFLRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELP-KVVPIQCKSVRITTGSFSTGILSQNGKVFIFGNKI 2334
            V QIS G  H   LS +G +   G N+  Q G    D  G++              C+       VP +K                      L +  ISCG  HT +LT +G+VY+FG+    QLG    S + LP KV  I   + ++T GS  T +L  +G ++ FG+ +
Sbjct:   60 VIQISAGGEHTLALSCSGQVFCCGANSAGQLGLNRTDEKGRFG------------VCA-------VPALKR---------------------LPVAYISCGAAHTAVLTKDGEVYTFGDGAHGQLGHSSTSRELLPRKVEDIDGPAKQVTCGSHHTLVLMSSGVLYAFGHGV 191          

HSP 2 Score: 55.0694 bits (131), Expect = 2.114e-6
Identity = 29/77 (37.66%), Postives = 47/77 (61.04%), Query Frame = 1
Query: 2104 IQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGY-LSNKELPKVVP--IQCKSVRITTGSFSTGILSQNGKVFIFG 2325
            + QI+CG+ H++ LT  G+V+S+G N + QLG G  +  + +P V+P  I    ++I+ G   T  LS +G+VF  G
Sbjct:    7 VVQIACGNIHSLALTKGGEVFSWGQNSYGQLGLGKSVPLQPVPAVIPALIGVPVIQISAGGEHTLALSCSGQVFCCG 83          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Cavefish
Match: rcbtb2 (RCC1 and BTB domain-containing protein 2 [Source:NCBI gene;Acc:103036617])

HSP 1 Score: 63.1586 bits (152), Expect = 5.307e-9
Identity = 57/220 (25.91%), Postives = 97/220 (44.09%), Query Frame = 1
Query: 1822 VTQISLGKSHGACLSRNGYLITFGVNNYYQCGCVSVDNDGKYNEIMQEIDNNNVD--SCSQIRSKHQVPTIKPQKLLIYS-DTNASSGIKNRSN-----------FLRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVVPI---QCKSVRITTGSFSTGILSQNGKVFIF----GNKITSPQIIDLISNPNDLTDNLQPIFFNFST 2418
            VT+++ G  H   L+  G +  +G NN  Q G  S  N      +   + N  V   +C Q+ S   +  +   +   +  + N   G+ N  N            + I Q++CG+ HT+ LT  G VY++G N + QLG G  SN+ LP ++     +   V     S ++   +Q+G+V ++    G  ++ P I    S     TD+   +F  F+T
Sbjct:  130 VTEVACGSHHTIALTTEGEVFAWGYNNSGQVGSGSTANQPTPRRVSSCLQNKVVVNIACGQLCS---MAVLDNGETYGWGYNCNGQLGLGNNGNQQTPCRIAALQGVNIVQVACGYAHTLALTDEGFVYAWGANSYGQLGTGNKSNQALPTLINTDKERMVEVAACHTSHTSAAKTQSGQVLMWGQCRGQAVSCPHITHFSS-----TDD---VFACFAT 338          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Cavefish
Match: rcbtb2 (RCC1 and BTB domain-containing protein 2 [Source:NCBI gene;Acc:103036617])

HSP 1 Score: 63.1586 bits (152), Expect = 5.307e-9
Identity = 57/220 (25.91%), Postives = 97/220 (44.09%), Query Frame = 1
Query: 1822 VTQISLGKSHGACLSRNGYLITFGVNNYYQCGCVSVDNDGKYNEIMQEIDNNNVD--SCSQIRSKHQVPTIKPQKLLIYS-DTNASSGIKNRSN-----------FLRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVVPI---QCKSVRITTGSFSTGILSQNGKVFIF----GNKITSPQIIDLISNPNDLTDNLQPIFFNFST 2418
            VT+++ G  H   L+  G +  +G NN  Q G  S  N      +   + N  V   +C Q+ S   +  +   +   +  + N   G+ N  N            + I Q++CG+ HT+ LT  G VY++G N + QLG G  SN+ LP ++     +   V     S ++   +Q+G+V ++    G  ++ P I    S     TD+   +F  F+T
Sbjct:  130 VTEVACGSHHTIALTTEGEVFAWGYNNSGQVGSGSTANQPTPRRVSSCLQNKVVVNIACGQLCS---MAVLDNGETYGWGYNCNGQLGLGNNGNQQTPCRIAALQGVNIVQVACGYAHTLALTDEGFVYAWGANSYGQLGTGNKSNQALPTLINTDKERMVEVAACHTSHTSAAKTQSGQVLMWGQCRGQAVSCPHITHFSS-----TDD---VFACFAT 338          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Cavefish
Match: btbd2b (BTB domain containing 2 [Source:NCBI gene;Acc:103031444])

HSP 1 Score: 62.3882 bits (150), Expect = 9.689e-9
Identity = 48/175 (27.43%), Postives = 78/175 (44.57%), Query Frame = 1
Query: 2950 TVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYT---GPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKI-----DTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYY 3450
            ++ RF +  S W YS    D I+F+V+  I++ G GLY    GP +  ++I+I      DS+T    N   FS D   ++                     R+M   P+ +  N  Y   AT+ G  + +G  G  K+      +     F F  +  ++NGT V++GQIPE+ +
Sbjct:  444 SITRFGQVESRWGYS-GTSDRIRFTVNRRIFVVGFGLYGSIHGPTDYQVNIQIIHT---DSNTILGQNDTGFSCDGSANTF--------------------RVMFKEPVEILPNVNYTACATLKGPDSHYGTKGMRKVTHESSGSGTKTCFTFCYAAGNNNGTSVEDGQIPEVIF 594          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007501.1 (pep scaffold:Pmarinus_7.0:GL477462:62532:68424:1 gene:ENSPMAG00000006776.1 transcript:ENSPMAT00000007501.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 8.295e-11
Identity = 47/178 (26.40%), Postives = 84/178 (47.19%), Query Frame = 1
Query: 1420 EFCVVRNQSGEIFY----KDIDNVERNNNVENWTRLLYTDYVAAKFHKLIGGIDNKFICAISDDG-LWRININRHSQPRTLCLDRLMPNS-------RFISKTWASGSCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCG 1917
            EF ++R  +G+++Y    + +   +    V  W  L  T   + K  +   G D      +++DG ++     +  +       R  P +       R   K     +C+  + ALV++EG++    KD+++S +T     L    VTQ++LGK+H   L+++G + TFGVNN  QCG
Sbjct:    4 EFALMRTANGKVYYTGKYQSLGIKQGGPAVGKWVELPLTK--SPKIMQFAVGHDGGHALMVAEDGSVFFTGTAKKGEDGESAKSRRQPKACKPKKMIRMEGKAVVQVACNNGSSALVTREGELYTFGKDAVYSDATGLVKELRGQTVTQVALGKAHACVLTKSGTVWTFGVNNKGQCG 179          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Sea Lamprey
Match: btbd2a (BTB (POZ) domain containing 2a [Source:ZFIN;Acc:ZDB-GENE-030829-3])

HSP 1 Score: 61.6178 bits (148), Expect = 2.838e-9
Identity = 48/178 (26.97%), Postives = 75/178 (42.13%), Query Frame = 1
Query: 2950 TVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMEN------KKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKI-----DTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYY 3450
            ++ RF +  S W YS    D I+F+++  +++ G GLY           I+  T                 D Q +  +L TE++ V  QN             R+M   PI +  N  Y   AT+ G  + +G  G  K+      T     F F  +  ++NGT V++GQIPEI +
Sbjct:  314 SINRFQQVESRWGYS-GTSDRIRFTMNRRVFVVGFGLYG---------SIHGPT-----------------DYQVNIQMLHTESNTVLGQNDTGFSCDGSANTFRVMFKEPIEILPNVNYTACATLKGPDSHYGTKGLRKVIHESPTTGCKTCFTFCYAAGNNNGTSVEDGQIPEIIF 464          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Nematostella
Match: EDO45550 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSE5])

HSP 1 Score: 71.2478 bits (173), Expect = 3.815e-12
Identity = 50/173 (28.90%), Postives = 80/173 (46.24%), Query Frame = 1
Query: 2953 VKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYT---GPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLG----VTFKFKQSKNSSNGTHVKEGQIPEIYY 3450
            + RF K  S W YS    D I+FS S  I++ G+GLY    GP +  +++++ +                    T  + +L   ET      +  N  + R+M   P+    N  Y   AT+ G  + +G  G+ K+  DL     +TF F  +  ++NGT V++GQIPEI +
Sbjct:  286 INRFAKVESRWGYS-GTSDRIRFSCSRRIFVVGLGLYGSMYGPSDYQVTVQLIQ--------------------TDTNEILAHNET---AFNSDGNDSVFRVMFKEPVETKPNVSYTASATLRGPDSHYGTSGQKKVVYDLDGKEKLTFNFSYATGNNNGTSVEDGQIPEIIF 434          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Nematostella
Match: EDO35699 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKU3])

HSP 1 Score: 62.003 bits (149), Expect = 5.199e-9
Identity = 45/172 (26.16%), Postives = 77/172 (44.77%), Query Frame = 1
Query: 1822 VTQISLGKSHGACLSRNGYLITFGVNNYYQC-GCVSVDNDGKYNEIMQEIDNNNVDSCSQIRSKHQVPTIKPQKLLIYSDTNASSGIKNRSNFLRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVVPI--QCKSVRITTGSFSTGILSQNGKVFIFGN 2328
            + +++ G    AC++ +G L TFG ++Y+ C GC         NE+ +E+                   + P K+  ++D               ++ ISCG  H V++  N  +YS+G  +  +LG G   +   P+ +P+   CK  RI  G  ST +L+  G+V   GN
Sbjct:  389 IKKVACGDEFTACITDDGALYTFG-SDYFGCIGC--------SNELDEEV-------------------LLPHKVTFFNDK-------------PVEDISCGDCHVVVMCANKAIYSWGCGEHGRLGLGSEDDFAFPQKIPLPTSCKVKRIYCGPESTFLLTVTGRVLACGN 519          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Nematostella
Match: EDO47874 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL61])

HSP 1 Score: 56.9954 bits (136), Expect = 1.446e-7
Identity = 31/86 (36.05%), Postives = 47/86 (54.65%), Query Frame = 1
Query: 2083 NRSNFLRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVV----PIQCKSVRITTGSFSTGILSQNGKVFIFGN 2328
            +R     I Q SCG  HT+ILT  G V+ FG+NK  Q+G+G+     LP  +    P   K  ++  G+  + +L +NG +F FG+
Sbjct:  160 DRLKMHNIVQASCGRGHTLILTDAGLVFGFGDNKLGQIGQGHQKPTSLPCPLQIMHPTDKKVTKVCCGAEFSMLLDENGDIFSFGS 245          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Nematostella
Match: EDO44704 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV05])

HSP 1 Score: 54.6842 bits (130), Expect = 5.626e-7
Identity = 43/172 (25.00%), Postives = 75/172 (43.60%), Query Frame = 1
Query: 1822 VTQISLGKSHGACLSRNGYLITFGVNNYYQCGCVSVDNDGKYNEIMQEIDNNNVDSCSQIRSKHQVPTIKPQKLLIYSDTNASSGIKNRSNFLRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVVP---IQCKSVRITTGSFSTGILSQNGKVFIFGN 2328
            V  +S G  H A ++ NG L TFG N++ Q G                  + N  S ++      V  +KP+K+ +                     ++CG  HT+  T +G +YSFG     QLG G   +  +PK++    +Q K   +  GS  +  +++NG+++ +G+
Sbjct:   37 VVNLSCGDEHSAVVTANGKLYTFGCNDWGQLG------------------HGNTKSYTKPSV---VKKLKPEKVYM---------------------VACGRNHTIAATESGHLYSFGCGGDGQLGHGDAEDSHVPKIIEGLDVQ-KYKHLACGSDFSAAITENGELYTWGS 165          

HSP 2 Score: 52.373 bits (124), Expect = 3.205e-6
Identity = 42/186 (22.58%), Postives = 84/186 (45.16%), Query Frame = 1
Query: 1807 LSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCGCVSVDNDGKYNEIMQEIDNNNVDSCSQIRSKHQVPTIKPQKLLIYSDTNASSG---------IKNRSNFL-RIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGY--LSN-KELPKVVPIQCKSVRITTGSFSTGILSQNGKVFIFG 2325
            L P  V  ++ G++H    + +G+L +FG     Q G      D + + + + I+  +V     +           +   +Y+  +   G         I  R +   +++ +SCG+YH  ++T +G +Y  G  +  +LG  +  L N  +L K+  I+ + V    G+  T ++++NG V+ FG
Sbjct:   84 LKPEKVYMVACGRNHTIAATESGHLYSFGCGGDGQLG----HGDAEDSHVPKIIEGLDVQKYKHLACGSDFSAAITENGELYTWGSCGEGQNGLGEDTEIPTRLHLHGKVRMVSCGYYHMAVVTEDGSLYMCGEKEGGKLGLDHEQLDNTSQLQKIKSIEDQVVVAACGAEFTAVVTKNGSVYTFG 265          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Nematostella
Match: EDO45583 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSK9])

HSP 1 Score: 52.373 bits (124), Expect = 5.063e-6
Identity = 30/100 (30.00%), Postives = 57/100 (57.00%), Query Frame = 1
Query: 2113 ISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELP-KVVPIQCKSV-RITTGSFSTGILSQNG-KVFIFGN------------KITSPQIIDLISN 2367
            ++CG  H+ ++TV+G +++FGN  + +LG G  +NK+ P +V  ++  ++ ++  G   T +LS +G  V+ FG+              TSPQ ID+++ 
Sbjct:  630 MACGFKHSAVVTVDGKLFTFGNGDYGRLGHGNSANKKTPERVTALEKHAIGQVACGLNHTLVLSADGNTVWAFGDGDYGKLGLGSCTAKTSPQAIDVLAG 729          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Medaka
Match: ENSORLT00000044112.1 (pep primary_assembly:ASM223467v1:21:8480059:8486757:-1 gene:ENSORLG00000025225.1 transcript:ENSORLT00000044112.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 320.087 bits (819), Expect = 2.536e-95
Identity = 206/516 (39.92%), Postives = 271/516 (52.52%), Query Frame = 1
Query: 11413 NNLSSTARVLKSGEKK---MCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKP-SDQNERCRFCNETSTNVDNKFA--CLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAP--WLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            + LSS   + K G++K   MC NHDD  T A ++C  C                    LC +CDR+LHL + T+ H R     +  + K         V+ HE C R K    +   D+ T+K ++   ++                         KP S  +E CRFC   +    +     C   +CQ  + +AC  +  PCGH C GV    KNE    + C P      C +    +   LKQD DD+CMICFT+ LS  P I L +C H+ H  C RR ++  W G R++F F  CP CK KI H  ++DLL+P   L ++V+RKAL+RLE+EGL  S  +          P  FA+++Y YY+CYKCK +Y+GGEARC+ +                  DP  EL C ACSDV++A++C KH TDFLEYKCRYCCS+AVFFCFGTTHFC  CHD+   +   P   LP CPAGP  + L   ECPLHV+HPPTGEEFALGC +CR   TF
Sbjct:   60 DRLSSGRWMGKDGQQKQMPMCDNHDDGETAAIILCNMCGN------------------LCTDCDRFLHLHRRTRSHQRQVFKEEEEAIK---------VDLHEGCGRTKLFWLMALADSKTMKAMVEFREH-----------------------TGKPASSSSEACRFCGTRNGTELSAVGSVCSDPDCQEYAKLACC-RTHPCGHPCGGV----KNE----ESCLP------CLHGCDKNTGCLKQDADDMCMICFTEALSAAPAIQL-DCSHVFHLQCTRRVLENRWLGPRITFGFMLCPICKNKINHSVIKDLLDPIKELYEDVRRKALMRLEYEGLHKSEAITTPGARFHNDPAGFAMNRYAYYVCYKCKKAYFGGEARCDAE-----------AGQGDDYDP-RELICGACSDVSRAQMCSKHGTDFLEYKCRYCCSVAVFFCFGTTHFCNACHDDFQRMTSVPKEELPHCPAGPKGKQLEGTECPLHVVHPPTGEEFALGCGVCRNAHTF 497          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Medaka
Match: ENSORLT00000014399.2 (pep primary_assembly:ASM223467v1:21:8542129:8558842:-1 gene:ENSORLG00000011491.3 transcript:ENSORLT00000014399.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 6.208e-13
Identity = 65/275 (23.64%), Postives = 120/275 (43.64%), Query Frame = 1
Query:  247 KTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKKC-----------SDW-SNRNQEIPVSEQFCLINQLPDNVTSESLISNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELAKYC--TGWMGIVS----NSILLH 1017
            K PKI+ + L  +++ I++T  S+P++C + LQ++L  L+  QP  + +E  D+++ LF+LLL                                      E  +     N    + +  ++ ACLFS+ +A G+   +L AV+ +L  NG       IQ P ++  L++             DW  N  +   +  ++ L     D      L ++G++L+ L   GL K+G+G++G+++G VY +   +        W+G       +  LLH
Sbjct:  130 KLPKIIGIGLCGVFELIKETRFSHPLLCLRSLQALLDMLQGQQPEGFQTEPPDVLESLFQLLL--------------------------------------ETTVRSTGPNDPTGQAITALSCACLFSLVVAWGDTGKILQAVSAILTNNG-SHACQTIQVPTILNALQRSVQAVLVGKIQIQDWFGNGIKRAALMNKWVLKEVAIDEDERCLLQTDGSFLYLLCKDGLYKVGSGYSGTVRGHVYNSTSRIRNRTEKRSWLGFAQLLDCSPFLLH 365          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Medaka
Match: btbd2b (BTB domain containing 2 [Source:NCBI gene;Acc:101162869])

HSP 1 Score: 65.855 bits (159), Expect = 8.921e-10
Identity = 51/175 (29.14%), Postives = 78/175 (44.57%), Query Frame = 1
Query: 2950 TVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYT---GPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKI-----DTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYY 3450
            ++ RF +  S W YS    D I+FSV+  I+I G GLY    GP +  ++I+I      DS+T    N   FS D   ++                     R+M   P+ +  N  Y   AT+ G  + +G  G  K+      T     F F  +  ++NGT V++GQIPE+ +
Sbjct:  446 SITRFGQVESRWGYS-GTSDRIRFSVNRRIFIVGFGLYGSIHGPTDYQVNIQIIHT---DSNTVLGQNDTGFSCDGSANTF--------------------RVMFKEPVEILPNVNYTACATLKGPDSHYGTKGMRKVTHESSSTGTKTCFTFCYAAGNNNGTSVEDGQIPEVIF 596          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Medaka
Match: BTBD1 (BTB domain containing 1 [Source:NCBI gene;Acc:101157198])

HSP 1 Score: 65.0846 bits (157), Expect = 1.009e-9
Identity = 53/177 (29.94%), Postives = 77/177 (43.50%), Query Frame = 1
Query: 2941 EIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYT---GPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKID----TDLGVTFKFKQSKNSSNGTHVKEGQIPEIYY 3450
            E  ++ RF +  S W YS    D I+F+V+  I I G GLY    GP +  ++I+I E    D       N   FS D   ++                     R+M   P+ +  +  Y   AT+ G  + +G  G  K+     T    TF F  S  ++NGT V++GQIPEI Y
Sbjct:  311 EECSINRFQQVESRWGYS-GTSDRIRFNVNRRICIVGFGLYGSIHGPTDYQVNIQILES---DKRITLGQNDTGFSCDGTANTF--------------------RVMFKEPVEILPSVNYTACATLKGPDSHYGTKGLKKVTQESATGAKTTFFFFSSPGNNNGTSVEDGQIPEIIY 463          
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Medaka
Match: rcbtb2 (RCC1 and BTB domain containing protein 2 [Source:NCBI gene;Acc:101173400])

HSP 1 Score: 62.7734 bits (151), Expect = 7.000e-9
Identity = 55/220 (25.00%), Postives = 99/220 (45.00%), Query Frame = 1
Query: 1822 VTQISLGKSHGACLSRNGYLITFGVNNYYQCGCVSVDNDGKYNEIMQEIDNNNVD--SCSQIRSKHQVPTIKPQKLLIYS-DTNASSGIKNRSN-----------FLRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVVPI---QCKSVRITTGSFSTGILSQNGKVFIF----GNKITSPQIIDLISNPNDLTDNLQPIFFNFST 2418
            VT+++ G  H   L+ +G +  +G NN  Q G  S  N      +   + +  V    C Q+ S   +  +   ++  +  + N   G+ N  N            + + Q++CG+ HT+ LT  G VY++G N + QLG G  SN+ LP ++     +   V     S ++   +Q+G+V ++    G  ++SP +    S     TD+   +F  F+T
Sbjct:  130 VTEVACGSHHTIALTADGEVFAWGYNNSGQVGSGSTANQPTPRRVSSCLQSKVVVNVGCGQLCS---MAVLDNGEIYGWGYNCNGQLGLGNNGNQQTPCRIAALQGVNVVQVACGYAHTLALTDEGFVYAWGANSYGQLGTGNKSNQALPTLINTDKERMVEVAACHTSHTSAAKTQSGQVLMWGQCRGQAVSSPHLTHFSS-----TDD---VFACFAT 338          

HSP 2 Score: 52.7582 bits (125), Expect = 8.525e-6
Identity = 23/78 (29.49%), Postives = 46/78 (58.97%), Query Frame = 1
Query: 2101 RIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVVPIQCKS---VRITTGSFSTGILSQNGKVFIFG 2325
            R+ +++CG +HT+ LT +G+V+++G N   Q+G G  +N+  P+ V    +S   V +  G   +  +  NG+++ +G
Sbjct:  129 RVTEVACGSHHTIALTADGEVFAWGYNNSGQVGSGSTANQPTPRRVSSCLQSKVVVNVGCGQLCSMAVLDNGEIYGWG 206          
BLAST of E3 ubiquitin protein ligase-1 vs. Planmine SMEST
Match: SMESG000066158.1 (SMESG000066158.1)

HSP 1 Score: 4538.02 bits (11769), Expect = 0.000e+0
Identity = 2241/2272 (98.64%), Postives = 2246/2272 (98.86%), Query Frame = 1
Query:  103 MSFVHVNNSIPDFIAISKMKNAFSENDNEVDECFNNNYYNLSKYLHENKTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTXXXXXXXXXXXXXXXCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKKCSDWSNRNQEIPVSEQFCLINQLPDNVTSESLISNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELAKYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKITNFHGFPSTPGWKYYLFANYTKLGCCLINEDETYSEQLFMKLFKLNSEKFLVEECEKSIDMTQHLILKFEIEQSKIFSNPSTLIETCPSLSLACEVLNLEEFCVVRNQSGEIFYKDIDNVERNNNVENWTRLLYTDYVAAKFHKLIGGIDNKFICAISDDGLWRININRHSQPRTLCLDRLMPNSRFISKTWASGSCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCGCVSVDNDGKYNEIMQEIDNNNVDSCSQIRSKHQVPTIKPQKLLIYSDTNASSGIKNRSNFLRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVVPIQCKSVRITTGSFSTGILSQNGKVFIFGNKITSPQIIDLISNPNDLTDNLQPIFFNFSTNNYKKQIIFCILKQNIFYMKRKPLTLSTHRKSYHQDQFKFLAKDNTILLTLDEQRGLLINISSGTIKIMPDYDEGNFSSLMNSYFDPRYSVLWSIDSGHGSKKFTVKYSKSNIFQSDNFQDKFDQLIDLPDDISFSSQRYRIALNVLVSAEKLLLKKYADPQNNNQIKTVDSNKEIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSXXXXXXXXXXFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMPDIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYPFNGKFNELCHLEETLVKIPSLGYSKDTESQETSVVIGDFRIIVRNIFLECKICHYLQSIKSTYGAESLIYAECWKLFTEDLIPVYKETFEHSFHAFYPEIEDQRFTLQEALLKVYEFCFNKSTDTLCNYGKIMFLTSLLTAINSANEGFLIFTHKDNSVTRSGENKINGENNFAHRFPLLREYMRTIWKPSTPCSSDILASTSTMIHCLLAIITLDIKTAYKTCKQINSSSTTENDVSEKKLFQQEMTNLINASHQILTNITRLLVDQLNHSAKTPAFRMSQVNSTNSKQNGHNNNQTYLEDIILTTQSRFKRVVWLDKSAENSRQKFVEQAINVAEQEIEDVICFAINKNTYQFINGFEVVGDNVIYLEGIKVYCSNFTESRCLAYIYRIKNFQEGIREKWELIPMEYEWKNEEQDLIASDLIFKRKLKLEESYRYAVKVFLIAANNKKTLIGQNPVSKLGTRFGYHFNLYETKLRTTANQNSRQGIIFSLLYSFSTKPQSVTDNQRLERKCVKMCLIELLAQVKYGLVTMIRETNPEELLSIGQKLFIDTYLPFFCHQLQLVSNVSKKITCLSITFVRETLIVIQENWKTTDKLINSEKDYFTIIESNHPYEQAKLLHNTIKFPDSVDAISITFDGHCVTAQPEDFLVVKARTNTANGNQTENKWKIIFKNLSNIISDWPKKAVIIQGNEIAIEFHTASLYEESLESTYGFKCSIVGHCSKIDAFIELLENALTYLASRCATSLLEFRKKSKVIKLLHETNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSCSSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQVTSQMSNIEVLFNYNHKGNNPFININEKLFGGHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIRAAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNK 6918
            MSFVHVNNSIPDFIAISKMKNAFSENDNEVDECFNNNYYNLSKYLHENKTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTNSISNSAKNTNSSSNCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKKCSDWSNRNQEIPVSEQFCLINQLPDNVTSESLISNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELAKYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKITNFHGFPSTPGWKYYLFANYTKLGCCLINEDETYSEQLFMKLFKLNSEKFLVEECEKSIDMTQHLILKFEIEQSKIFSNPSTLIETCPSLSLACEVLNLEEFCVVRNQSGEIFYKDIDNVERNNNVENWTRLLYTDYVAAKFHKLIGGIDNKFICAISDDGLWRININRHSQPRTLCLDRLMPNSRFISKTWASGSCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCGCVSVDNDGKYNEIMQEIDNNNVDSCSQIRSKHQVPTIKPQ+LLIYSDTNASSGIKNRSNFLRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVVPIQCKSVRITTGSFSTGILSQNGKVFIFGNKITSPQIIDLISNPNDLTDNLQPIFFN STNNYKKQIIFCILKQNIFYMKRKPLTLSTHRKSYHQDQFKFLAKDNTILLTLDEQRGLLINISSGTIKIMPDYDEGNFSSLMNSYFDPRYSVLWSIDSGHGSKKFTVKYSKSNIFQSD+FQDKFDQLIDLPDDISFSSQRYRIALNVLVSAEKLLLKKYADPQNNNQIKTVDSNKEIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSDTDDLLNTNLFSYDTQFSSLLL TETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMPDIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYPFN                   GYSKDTESQETSVVIGDFRIIVRNIFLECKICHYLQSIKSTYGAESLIYAECWKLFTEDLIPVYKETFEHSFHAFYPEIEDQRFTLQEALLKVYEFCFNKSTDTLCNYGKIMFLTSLLTAINSANEGFLIFTHKDNSVTRSGENKIN ENNFA RFPLLREYMRTIWKPSTPCSSDIL+STSTMIHCLLAIITLDIKTAYKTCKQINSSSTTENDVSEKKLFQQEMTNLINASHQILTNITRLLVDQLNHSAKTPAFRMSQVNSTNSKQNGHNNNQTYLEDIILTTQSRFKRVVWLDKSAENSRQKFVEQAINVAEQEIEDVICFAINKNTYQFINGFEVVGDNVIYLEGIKVYCSNFTESRCLAYIYR KNFQEGI+EKWELIPMEYEWKNEEQDLIASDLIFKRKLKLEESYRYAVKVFLIAANNKKTLIGQNPVSKLGTRFGYHFNLYETKLRTTANQNSRQGIIFSLLYSFSTKPQS+TDNQRLERKCVKMCLIELLAQVKYGLVTMIRETNPEELLSIGQKLFIDTYLPFFCHQLQLVSNVSKKITCLSITFVRETLIVIQENWKTTDKLINSEKDYFTIIESNHPYEQAKLLHNTIKFPDSVDAISITFDGHCVTAQPEDFL VKARTN ANGNQTENKWKIIFKNLSNIISDWPKKAVIIQGNEIAIEFHTASLYEESLESTYGFKCSIVGHCSKIDAFIELLENALTYLASRCATSLLEFRKKSKVIKLLHETNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSCSSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQVTSQMSNIEVLFNYNHKGNNPFININEKLFGGHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIRAAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNK
Sbjct:    1 MSFVHVNNSIPDFIAISKMKNAFSENDNEVDECFNNNYYNLSKYLHENKTPKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECDDIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTNSISNSAKNTNSSSNCYEDGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGLLDDNDFIQTPNLVLKLKKCSDWSNRNQEIPVSEQFCLINQLPDNVTSESLISNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELAKYCTGWMGIVSNSILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKITNFHGFPSTPGWKYYLFANYTKLGCCLINEDETYSEQLFMKLFKLNSEKFLVEECEKSIDMTQHLILKFEIEQSKIFSNPSTLIETCPSLSLACEVLNLEEFCVVRNQSGEIFYKDIDNVERNNNVENWTRLLYTDYVAAKFHKLIGGIDNKFICAISDDGLWRININRHSQPRTLCLDRLMPNSRFISKTWASGSCSKDNLALVSKEGQVLFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNNYYQCGCVSVDNDGKYNEIMQEIDNNNVDSCSQIRSKHQVPTIKPQQLLIYSDTNASSGIKNRSNFLRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVVPIQCKSVRITTGSFSTGILSQNGKVFIFGNKITSPQIIDLISNPNDLTDNLQPIFFNLSTNNYKKQIIFCILKQNIFYMKRKPLTLSTHRKSYHQDQFKFLAKDNTILLTLDEQRGLLINISSGTIKIMPDYDEGNFSSLMNSYFDPRYSVLWSIDSGHGSKKFTVKYSKSNIFQSDHFQDKFDQLIDLPDDISFSSQRYRIALNVLVSAEKLLLKKYADPQNNNQIKTVDSNKEIFTVKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIYEETGHDSDTDDLLNTNLFSYDTQFSSLLLLTETDKVEVQNMENKKIIRLMLPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNSSNGTHVKEGQIPEIYYSPRMPDIHKLKKDNEKSDYFINAANFTEYLSSQISMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLKLYSKAFTSTLKIIRKHIQYLYPFN-------------------GYSKDTESQETSVVIGDFRIIVRNIFLECKICHYLQSIKSTYGAESLIYAECWKLFTEDLIPVYKETFEHSFHAFYPEIEDQRFTLQEALLKVYEFCFNKSTDTLCNYGKIMFLTSLLTAINSANEGFLIFTHKDNSVTRSGENKINEENNFADRFPLLREYMRTIWKPSTPCSSDILSSTSTMIHCLLAIITLDIKTAYKTCKQINSSSTTENDVSEKKLFQQEMTNLINASHQILTNITRLLVDQLNHSAKTPAFRMSQVNSTNSKQNGHNNNQTYLEDIILTTQSRFKRVVWLDKSAENSRQKFVEQAINVAEQEIEDVICFAINKNTYQFINGFEVVGDNVIYLEGIKVYCSNFTESRCLAYIYRTKNFQEGIQEKWELIPMEYEWKNEEQDLIASDLIFKRKLKLEESYRYAVKVFLIAANNKKTLIGQNPVSKLGTRFGYHFNLYETKLRTTANQNSRQGIIFSLLYSFSTKPQSITDNQRLERKCVKMCLIELLAQVKYGLVTMIRETNPEELLSIGQKLFIDTYLPFFCHQLQLVSNVSKKITCLSITFVRETLIVIQENWKTTDKLINSEKDYFTIIESNHPYEQAKLLHNTIKFPDSVDAISITFDGHCVTAQPEDFLAVKARTNKANGNQTENKWKIIFKNLSNIISDWPKKAVIIQGNEIAIEFHTASLYEESLESTYGFKCSIVGHCSKIDAFIELLENALTYLASRCATSLLEFRKKSKVIKLLHETNILQKCEPYRSILDQGLSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSCSSPAVQLSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEVNKEIILQLELLDQYENQVTSQMSNIEVLFNYNHKGNNPFININEKLFGGHPVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIRAAGFQETVCKSQRIKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSDNITLKIDVTKSSLVKNGPVEKIRKRTENNK 2253          
BLAST of E3 ubiquitin protein ligase-1 vs. Planmine SMEST
Match: SMESG000066165.1 (SMESG000066165.1)

HSP 1 Score: 3792.28 bits (9833), Expect = 0.000e+0
Identity = 1959/2006 (97.66%), Postives = 1965/2006 (97.96%), Query Frame = 1
Query: 6919 DKNDKPKYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLKEHLNKIFLTPAKINYAAEILQKENIFKILSDTQNQLNNAPYKVLSKTLPYKRRQSARSNQAEFSKYSSNTVAISLPNSPDMTLRRKTQNKLTIXXXXXXXQPNSPGIIRRRSTKGPALQNTQMTGKINALSPLQAETQRALFAAIIWQNGLVSDLIQIAESINLYSAYHQLEKQINNSTNTDDNRNIPPFDAAPLLSNGITRSNSQNTGDMSLLSDSGGLRNFSISAIPRVLPSLADLVANAVAATXXXXXXXXXXXXXXXXXXXXXXIKRSQSHMDGRSILSGQYGPMHYRDRFYSQVKEEETTKLGLHVSLDEELLNIGKPSSSNCRLSENLQSEILNKLNQLTKLWDTVSAILTLSEQQNQFTKEESFSETTQMSSGNSICEEMTNMKHISTNFYQKVYDNSVLLLEIEPANASAKSGFPIVSRDINPNSKNGDHQRILSPNHEDEAISQSRKTKRSLESCFVIPCSSKYFPESEIDLSRSIKLKSHSPTKIYANFWPLHNLQRPYTFGNNLNLDEMNDQINTAVSYDDSSIYLKCDCWSCXXXXXXXXXXTKANFSSGNLTANSVPNSSFGAGFSSTAMKQHMLKLSRTDNSSWEHNIITSSDSNSASIKPHTGSSSCHKSATVIXXXXXXXXXXXVNIVASSSSGMEIFERSMTGSNFLKKDCPTRGMLEMRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLLEKHKSIDKSNKPQISLIEEKNLKVYSQQLWAVGSAVFYRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINFEKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAIYQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKELQDNHDIESKSLHDFLVNILFDTGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAGKSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSHCDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENPNLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKKMCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPSDQNERCRFCNETSTNVDNKFACLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAPWLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            DKNDKPKYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLKEHLNKIFLTPAKINYAAEILQKENIFKILSDTQNQLNNAPYKVLSKTLPYKRRQSARSNQAEFSKYSSNTVAISLPNSPDMTLRRKTQNKLTISSSASSSQPNSPGIIRRRSTKGPALQNTQMTGKINALSPLQAETQRALFAAIIWQNGLVSDLIQIAESINLYSAYHQLEKQINNSTN DDNRNIPPFDAAPLLSNGITRSNSQNTGDMSLLSDSGGLRNFSISAIPRVLPSLADLVANAVAATSNSISNDLSPSSNKSPPRPSGSIKRSQSHMDGRSILSGQYGPMHYRDRFYSQVKEEETTKLGLHVSLDEELLNIGKPSSSNCRLSENLQSEILNKLNQLTKLWDTVSAILTLSEQQNQFTKEESFSETTQMSSGNSICEEMTNMKHISTNFYQKVYDNSVLLLEIEPANASAKSGFPIVSRDINPNSKNGDHQRILSPNHEDEAISQSRKTKRSLESCFVIPCSSKYFPESEIDLSRSIKLKSHSPTKIYANFWPLHNLQRPYTFGNNLNLDEMNDQINTAVSYDDSSIYLKCDCWSCLPLLKELEPKTKANFSSGNLTANSVPNSSFGAGFSSTAMKQHMLKLSRTDNSSWEHNIITSSDSNSASIKPHTGSSSCHKSATVISQLLQSMMSLLVNIVASSSSGMEIFERSMTGSNFLKKDCPTRGMLEMRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLLEKHKSIDKSNKPQISLIEEKNLKVYSQQLWAVGSAVFYRILDNIIHNSNLNNLSVSEIKLLEMTVKISSLLLFADGTDESFSQSFINFEKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAIYQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKELQDNHDIESKSLHDFLVNILFDTGFKSEVISSRLSSLQRRVLSHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAGKSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSHCDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENPNLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKKMCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMNNNNTT      +                +  +  N  +   D  F  + +  QI  SVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHKYCYYLCYKCKNSYYGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAPWLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF
Sbjct: 1133 DKNDKPKYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLKEHLNKIFLTPAKINYAAEILQKENIFKILSDTQNQLNNAPYKVLSKTLPYKRRQSARSNQAEFSKYSSNTVAISLPNSPDMTLRRKTQNKLTISSSASSSQPNSPGIIRRRSTKGPALQNTQMTGKINALSPLQAETQRALFAAIIWQNGLVSDLIQIAESINLYSAYHQLEKQINNSTNIDDNRNIPPFDAAPLLSNGITRSNSQNTGDMSLLSDSGGLRNFSISAIPRVLPSLADLVANAVAATSNSISNDLSPSSNKSPPRPSGSIKRSQSHMDGRSILSGQYGPMHYRDRFYSQVKEEETTKLGLHVSLDEELLNIGKPSSSNCRLSENLQSEILNKLNQLTKLWDTVSAILTLSEQQNQFTKEESFSETTQMSSGNSICEEMTNMKHISTNFYQKVYDNSVLLLEIEPANASAKSGFPIVSRDINPNSKNGDHQRILSPNHEDEAISQSRKTKRSLESCFVIPCSSKYFPESEIDLSRSIKLKSHSPTKIYANFWPLHNLQRPYTFGNNLNLDEMNDQINTAVSYDDSSIYLKCDCWSCLPLLKELEPKTKANFSSGNLTANSVPNSSFGAGFSSTAMKQHMLKLSRTDNSSWEHNIITSSDSNSASIKPHTGSSSCHKSATVISQLLQSMMSLLVNIVASSSSGMEIFERSMTGSNFLKKDCPTRGMLEMRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLLEKHKSIDKSNKPQISLIEEKNLKVYSQQLWAVGSAVFYRILDNIIHNSNLNNLSVSEIKLLEMTVKISSLLLFADGTDESFSQSFINFEKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAIYQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKELQDNHDIESKSLHDFLVNILFDTGFKSEVISSRLSSLQRRVLSHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAGKSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSHCDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENPNLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKKMCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMNNNNTTIIIIMTLLQTI------------QTLKSVNRQTKTNDVDF--VMKPLQI--SVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHKYCYYLCYKCKNSYYGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAPWLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 3122          
BLAST of E3 ubiquitin protein ligase-1 vs. Planmine SMEST
Match: SMESG000066165.1 (SMESG000066165.1)

HSP 1 Score: 3790.35 bits (9828), Expect = 0.000e+0
Identity = 1959/2006 (97.66%), Postives = 1965/2006 (97.96%), Query Frame = 1
Query: 6919 DKNDKPKYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLKEHLNKIFLTPAKINYAAEILQKENIFKILSDTQNQLNNAPYKVLSKTLPYKRRQSARSNQAEFSKYSSNTVAISLPNSPDMTLRRKTQNKLTIXXXXXXXQPNSPGIIRRRSTKGPALQNTQMTGKINALSPLQAETQRALFAAIIWQNGLVSDLIQIAESINLYSAYHQLEKQINNSTNTDDNRNIPPFDAAPLLSNGITRSNSQNTGDMSLLSDSGGLRNFSISAIPRVLPSLADLVANAVAATXXXXXXXXXXXXXXXXXXXXXXIKRSQSHMDGRSILSGQYGPMHYRDRFYSQVKEEETTKLGLHVSLDEELLNIGKPSSSNCRLSENLQSEILNKLNQLTKLWDTVSAILTLSEQQNQFTKEESFSETTQMSSGNSICEEMTNMKHISTNFYQKVYDNSVLLLEIEPANASAKSGFPIVSRDINPNSKNGDHQRILSPNHEDEAISQSRKTKRSLESCFVIPCSSKYFPESEIDLSRSIKLKSHSPTKIYANFWPLHNLQRPYTFGNNLNLDEMNDQINTAVSYDDSSIYLKCDCWSCXXXXXXXXXXTKANFSSGNLTANSVPNSSFGAGFSSTAMKQHMLKLSRTDNSSWEHNIITSSDSNSASIKPHTGSSSCHKSATVIXXXXXXXXXXXVNIVASSSSGMEIFERSMTGSNFLKKDCPTRGMLEMRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLLEKHKSIDKSNKPQISLIEEKNLKVYSQQLWAVGSAVFYRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINFEKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAIYQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKELQDNHDIESKSLHDFLVNILFDTGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAGKSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSHCDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENPNLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKKMCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPSDQNERCRFCNETSTNVDNKFACLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAPWLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            DKNDKPKYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLKEHLNKIFLTPAKINYAAEILQKENIFKILSDTQNQLNNAPYKVLSKTLPYKRRQSARSNQAEFSKYSSNTVAISLPNSPDMTLRRKTQNKLTISSSASSSQPNSPGIIRRRSTKGPALQNTQMTGKINALSPLQAETQRALFAAIIWQNGLVSDLIQIAESINLYSAYHQLEKQINNSTN DDNRNIPPFDAAPLLSNGITRSNSQNTGDMSLLSDSGGLRNFSISAIPRVLPSLADLVANAVAATSNSISNDLSPSSNKSPPRPSGSIKRSQSHMDGRSILSGQYGPMHYRDRFYSQVKEEETTKLGLHVSLDEELLNIGKPSSSNCRLSENLQSEILNKLNQLTKLWDTVSAILTLSEQQNQFTKEESFSETTQMSSGNSICEEMTNMKHISTNFYQKVYDNSVLLLEIEPANASAKSGFPIVSRDINPNSKNGDHQRILSPNHEDEAISQSRKTKRSLESCFVIPCSSKYFPESEIDLSRSIKLKSHSPTKIYANFWPLHNLQRPYTFGNNLNLDEMNDQINTAVSYDDSSIYLKCDCWSCLPLLKELEPKTKANFSSGNLTANSVPNSSFGAGFSSTAMKQHMLKLSRTDNSSWEHNIITSSDSNSASIKPHTGSSSCHKSATVISQLLQSMMSLLVNIVASSSSGMEIFERSMTGSNFLKKDCPTRGMLEMRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLLEKHKSIDKSNKPQISLIEEKNLKVYSQQLWAVGSAVFYRILDNIIHNSNLNNLSVSEIKLLEMTVKISSLLLFADGTDESFSQSFINFEKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAIYQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKELQDNHDIESKSLHDFLVNILFDTGFKSEVISSRLSSLQRRVLSHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAGKSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSHCDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENPNLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKKMCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMNNNNTT      +                +  +  N  +   D  F  + +  QI  SVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHKYCYYLCYKCKNSYYGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAPWLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF
Sbjct: 1157 DKNDKPKYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLKEHLNKIFLTPAKINYAAEILQKENIFKILSDTQNQLNNAPYKVLSKTLPYKRRQSARSNQAEFSKYSSNTVAISLPNSPDMTLRRKTQNKLTISSSASSSQPNSPGIIRRRSTKGPALQNTQMTGKINALSPLQAETQRALFAAIIWQNGLVSDLIQIAESINLYSAYHQLEKQINNSTNIDDNRNIPPFDAAPLLSNGITRSNSQNTGDMSLLSDSGGLRNFSISAIPRVLPSLADLVANAVAATSNSISNDLSPSSNKSPPRPSGSIKRSQSHMDGRSILSGQYGPMHYRDRFYSQVKEEETTKLGLHVSLDEELLNIGKPSSSNCRLSENLQSEILNKLNQLTKLWDTVSAILTLSEQQNQFTKEESFSETTQMSSGNSICEEMTNMKHISTNFYQKVYDNSVLLLEIEPANASAKSGFPIVSRDINPNSKNGDHQRILSPNHEDEAISQSRKTKRSLESCFVIPCSSKYFPESEIDLSRSIKLKSHSPTKIYANFWPLHNLQRPYTFGNNLNLDEMNDQINTAVSYDDSSIYLKCDCWSCLPLLKELEPKTKANFSSGNLTANSVPNSSFGAGFSSTAMKQHMLKLSRTDNSSWEHNIITSSDSNSASIKPHTGSSSCHKSATVISQLLQSMMSLLVNIVASSSSGMEIFERSMTGSNFLKKDCPTRGMLEMRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLLEKHKSIDKSNKPQISLIEEKNLKVYSQQLWAVGSAVFYRILDNIIHNSNLNNLSVSEIKLLEMTVKISSLLLFADGTDESFSQSFINFEKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAIYQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKELQDNHDIESKSLHDFLVNILFDTGFKSEVISSRLSSLQRRVLSHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAGKSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSHCDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENPNLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKKMCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMNNNNTTIIIIMTLLQTI------------QTLKSVNRQTKTNDVDF--VMKPLQI--SVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHKYCYYLCYKCKNSYYGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAPWLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 3146          
BLAST of E3 ubiquitin protein ligase-1 vs. Planmine SMEST
Match: SMESG000066165.1 (SMESG000066165.1)

HSP 1 Score: 3786.88 bits (9819), Expect = 0.000e+0
Identity = 1959/2006 (97.66%), Postives = 1965/2006 (97.96%), Query Frame = 1
Query: 6919 DKNDKPKYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLKEHLNKIFLTPAKINYAAEILQKENIFKILSDTQNQLNNAPYKVLSKTLPYKRRQSARSNQAEFSKYSSNTVAISLPNSPDMTLRRKTQNKLTIXXXXXXXQPNSPGIIRRRSTKGPALQNTQMTGKINALSPLQAETQRALFAAIIWQNGLVSDLIQIAESINLYSAYHQLEKQINNSTNTDDNRNIPPFDAAPLLSNGITRSNSQNTGDMSLLSDSGGLRNFSISAIPRVLPSLADLVANAVAATXXXXXXXXXXXXXXXXXXXXXXIKRSQSHMDGRSILSGQYGPMHYRDRFYSQVKEEETTKLGLHVSLDEELLNIGKPSSSNCRLSENLQSEILNKLNQLTKLWDTVSAILTLSEQQNQFTKEESFSETTQMSSGNSICEEMTNMKHISTNFYQKVYDNSVLLLEIEPANASAKSGFPIVSRDINPNSKNGDHQRILSPNHEDEAISQSRKTKRSLESCFVIPCSSKYFPESEIDLSRSIKLKSHSPTKIYANFWPLHNLQRPYTFGNNLNLDEMNDQINTAVSYDDSSIYLKCDCWSCXXXXXXXXXXTKANFSSGNLTANSVPNSSFGAGFSSTAMKQHMLKLSRTDNSSWEHNIITSSDSNSASIKPHTGSSSCHKSATVIXXXXXXXXXXXVNIVASSSSGMEIFERSMTGSNFLKKDCPTRGMLEMRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLLEKHKSIDKSNKPQISLIEEKNLKVYSQQLWAVGSAVFYRXXXXXXXXXXXXXXXXXEIKLLEMTVKISSLLLFADGTDESFSQSFINFEKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAIYQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKELQDNHDIESKSLHDFLVNILFDTGFKSEVIXXXXXXXXXXXXXHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAGKSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSHCDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENPNLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKKMCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMXXXXXXXXXXXXXXXXXXXXEISKPSDQNERCRFCNETSTNVDNKFACLAQECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHXXXXXXXXXXXXXXXGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAPWLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 12936
            DKNDKPKYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLKEHLNKIFLTPAKINYAAEILQKENIFKILSDTQNQLNNAPYKVLSKTLPYKRRQSARSNQAEFSKYSSNTVAISLPNSPDMTLRRKTQNKLTISSSASSSQPNSPGIIRRRSTKGPALQNTQMTGKINALSPLQAETQRALFAAIIWQNGLVSDLIQIAESINLYSAYHQLEKQINNSTN DDNRNIPPFDAAPLLSNGITRSNSQNTGDMSLLSDSGGLRNFSISAIPRVLPSLADLVANAVAATSNSISNDLSPSSNKSPPRPSGSIKRSQSHMDGRSILSGQYGPMHYRDRFYSQVKEEETTKLGLHVSLDEELLNIGKPSSSNCRLSENLQSEILNKLNQLTKLWDTVSAILTLSEQQNQFTKEESFSETTQMSSGNSICEEMTNMKHISTNFYQKVYDNSVLLLEIEPANASAKSGFPIVSRDINPNSKNGDHQRILSPNHEDEAISQSRKTKRSLESCFVIPCSSKYFPESEIDLSRSIKLKSHSPTKIYANFWPLHNLQRPYTFGNNLNLDEMNDQINTAVSYDDSSIYLKCDCWSCLPLLKELEPKTKANFSSGNLTANSVPNSSFGAGFSSTAMKQHMLKLSRTDNSSWEHNIITSSDSNSASIKPHTGSSSCHKSATVISQLLQSMMSLLVNIVASSSSGMEIFERSMTGSNFLKKDCPTRGMLEMRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLLEKHKSIDKSNKPQISLIEEKNLKVYSQQLWAVGSAVFYRILDNIIHNSNLNNLSVSEIKLLEMTVKISSLLLFADGTDESFSQSFINFEKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAIYQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKELQDNHDIESKSLHDFLVNILFDTGFKSEVISSRLSSLQRRVLSHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAGKSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSHCDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENPNLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKKMCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMNNNNTT      +                +  +  N  +   D  F  + +  QI  SVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHKYCYYLCYKCKNSYYGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAPWLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF
Sbjct: 1195 DKNDKPKYLWFEGKQSSGLRLRSQPSFNSPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRPILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCLKEHLNKIFLTPAKINYAAEILQKENIFKILSDTQNQLNNAPYKVLSKTLPYKRRQSARSNQAEFSKYSSNTVAISLPNSPDMTLRRKTQNKLTISSSASSSQPNSPGIIRRRSTKGPALQNTQMTGKINALSPLQAETQRALFAAIIWQNGLVSDLIQIAESINLYSAYHQLEKQINNSTNIDDNRNIPPFDAAPLLSNGITRSNSQNTGDMSLLSDSGGLRNFSISAIPRVLPSLADLVANAVAATSNSISNDLSPSSNKSPPRPSGSIKRSQSHMDGRSILSGQYGPMHYRDRFYSQVKEEETTKLGLHVSLDEELLNIGKPSSSNCRLSENLQSEILNKLNQLTKLWDTVSAILTLSEQQNQFTKEESFSETTQMSSGNSICEEMTNMKHISTNFYQKVYDNSVLLLEIEPANASAKSGFPIVSRDINPNSKNGDHQRILSPNHEDEAISQSRKTKRSLESCFVIPCSSKYFPESEIDLSRSIKLKSHSPTKIYANFWPLHNLQRPYTFGNNLNLDEMNDQINTAVSYDDSSIYLKCDCWSCLPLLKELEPKTKANFSSGNLTANSVPNSSFGAGFSSTAMKQHMLKLSRTDNSSWEHNIITSSDSNSASIKPHTGSSSCHKSATVISQLLQSMMSLLVNIVASSSSGMEIFERSMTGSNFLKKDCPTRGMLEMRFCLCYSFISELRLALEVSLRTLTIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLLEKHKSIDKSNKPQISLIEEKNLKVYSQQLWAVGSAVFYRILDNIIHNSNLNNLSVSEIKLLEMTVKISSLLLFADGTDESFSQSFINFEKSQVFSCLSELLNHLDDSKVFNGRIISTHENSIKINSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDLFPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAIYQQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMANDKIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIFYNCFTTSYQNRIEKKELQDNHDIESKSLHDFLVNILFDTGFKSEVISSRLSSLQRRVLSHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDPTRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQVMFAITRIFSAVSPRSLEDILFGVIHPNEFENPQNVKIKLEKPFIPLNLLIIFAGKSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSHCDSNFASKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENPNLYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKKMCTNHDDESTIATVICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNIQPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAMNNNNTTIIIIMTLLQTI------------QTLKSVNRQTKTNDVDF--VMKPLQI--SVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSNQSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQAGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLEHEGLIDSPEMKDSDGAIKELPEEFALHKYCYYLCYKCKNSYYGGEARCEPDMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYKCRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAPWLPQCPAGPALQHLSTPECPLHVIHPPTGEEFALGCALCRKLDTF 3184          
BLAST of E3 ubiquitin protein ligase-1 vs. Planmine SMEST
Match: SMESG000057228.1 (SMESG000057228.1)

HSP 1 Score: 72.4034 bits (176), Expect = 9.604e-12
Identity = 57/184 (30.98%), Postives = 84/184 (45.65%), Query Frame = 1
Query: 1831 ISLGKSHGACLSRNGYLITFGVNNYYQCGCVSVDNDGKYNEIMQEIDNNNVDSCSQIRSKHQVPTIKPQKLLIYSDTNASSGIKNRSNF------------LRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGRGYLSNKELPKVVPIQCKSVR------ITTGSFSTGILSQNGKVFIFGN 2328
            ++ G      LS NG + T+G NN  Q G    D  GK  EI+Q + N ++   +         +I         + +   G  N S F            L I+QI+CG  H+ ILT +G VY++G+N   QLG G   ++E     PI  KS++      I  GSF   +L+ +G VF FG+
Sbjct:  101 VACGSHFSVALSTNGIIYTWGSNNANQLGRAMRDEFGKI-EIVQCLSNYSIIQVACGLGHCLALSIDSILFSWGENKHGQIGNGNTSPFVSVPEIVLSLECLPIKQIACGDLHSSILTTSGSVYTWGDNSHGQLGTGKNGSEEALSSNPIFLKSIKGIQIAYICVGSFHNALLTHDGGVFTFGD 283          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYCBP29.935e-12330.65MYC binding protein 2 [Source:HGNC Symbol;Acc:HGNC... [more]
MYCBP24.235e-11729.40MYC binding protein 2 [Source:HGNC Symbol;Acc:HGNC... [more]
MYCBP25.790e-11729.40MYC binding protein 2 [Source:HGNC Symbol;Acc:HGNC... [more]
MYCBP27.156e-7250.94MYC binding protein 2 [Source:HGNC Symbol;Acc:HGNC... [more]
RCBTB23.665e-1125.43RCC1 and BTB domain containing protein 2 [Source:H... [more]
back to top
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rpm-14.884e-7834.98E3 ubiquitin-protein ligase rpm-1 [Source:UniProt... [more]
F07B7.123.545e-2130.55pep chromosome:WBcel235:V:8854993:8862049:-1 gene:... [more]
tag-304.729e-1028.49pep chromosome:WBcel235:IV:11850950:11854946:-1 ge... [more]
tag-304.729e-1028.49pep chromosome:WBcel235:IV:11850950:11855159:-1 ge... [more]
back to top
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hiw4.371e-8939.76gene:FBgn0030600 transcript:FBtr0073970[more]
hiw4.371e-8939.76gene:FBgn0030600 transcript:FBtr0346087[more]
CG66782.328e-733.77gene:FBgn0038917 transcript:FBtr0084148[more]
back to top
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mycbp23.495e-11929.79MYC binding protein 2 [Source:NCBI gene;Acc:368439... [more]
mycbp24.583e-11929.79MYC binding protein 2 [Source:NCBI gene;Acc:368439... [more]
mycbp25.257e-11929.79MYC binding protein 2 [Source:NCBI gene;Acc:368439... [more]
CR759903.11.965e-1224.44pep chromosome:GRCz11:CHR_ALT_CTG9_2_1:17220635:17... [more]
si:ch211-281g13.59.570e-1126.19si:ch211-281g13.5 [Source:ZFIN;Acc:ZDB-GENE-090311... [more]
back to top
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vim9.543e-11829.39vimentin [Source:Xenbase;Acc:XB-GENE-493024][more]
vim1.064e-11729.47vimentin [Source:Xenbase;Acc:XB-GENE-493024][more]
vim1.098e-11729.47vimentin [Source:Xenbase;Acc:XB-GENE-493024][more]
vim1.100e-11729.47vimentin [Source:Xenbase;Acc:XB-GENE-493024][more]
vim1.490e-11729.39vimentin [Source:Xenbase;Acc:XB-GENE-493024][more]
back to top
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mycbp24.072e-12029.50MYC binding protein 2, E3 ubiquitin protein ligase... [more]
Mycbp21.565e-11729.68MYC binding protein 2, E3 ubiquitin protein ligase... [more]
Mycbp22.101e-11729.60MYC binding protein 2, E3 ubiquitin protein ligase... [more]
Mycbp27.676e-2323.01MYC binding protein 2, E3 ubiquitin protein ligase... [more]
Rcbtb28.162e-1124.62regulator of chromosome condensation (RCC1) and BT... [more]
back to top
BLAST of E3 ubiquitin protein ligase-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|F1RD40|MYCB2_DANRE3.969e-11829.79E3 ubiquitin-protein ligase MYCBP2 OS=Danio rerio ... [more]
sp|O75592|MYCB2_HUMAN2.034e-11629.40E3 ubiquitin-protein ligase MYCBP2 OS=Homo sapiens... [more]
sp|Q7TPH6|MYCB2_MOUSE6.226e-11629.53E3 ubiquitin-protein ligase MYCBP2 OS=Mus musculus... [more]
sp|Q9NB71|HIW_DROME4.381e-8839.76E3 ubiquitin-protein ligase highwire OS=Drosophila... [more]
sp|Q17551|RPM1_CAEEL6.212e-7734.98E3 ubiquitin-protein ligase rpm-1 OS=Caenorhabditi... [more]
back to top
BLAST of E3 ubiquitin protein ligase-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A172RVP40.000e+099.65Protein associated with Myc (Fragment) OS=Schmidte... [more]
I1ZI760.000e+099.82E3 ubiquitin protein ligase-1 OS=Schmidtea mediter... [more]
A0A087US306.944e-12231.41Putative E3 ubiquitin-protein ligase MYCBP2 (Fragm... [more]
H7C3U41.414e-11930.65E3 ubiquitin-protein ligase MYCBP2 (Fragment) OS=H... [more]
A0A2J8PBD31.653e-11930.65MYCBP2 isoform 15 (Fragment) OS=Pan troglodytes OX... [more]
back to top
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mycbp24.050e-11729.36MYC binding protein 2 [Source:NCBI gene;Acc:368439... [more]
ENSAMXT00000020460.25.678e-1029.07pep primary_assembly:Astyanax_mexicanus-2.0:25:753... [more]
rcbtb25.307e-925.91RCC1 and BTB domain-containing protein 2 [Source:N... [more]
rcbtb25.307e-925.91RCC1 and BTB domain-containing protein 2 [Source:N... [more]
btbd2b9.689e-927.43BTB domain containing 2 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000007501.18.295e-1126.40pep scaffold:Pmarinus_7.0:GL477462:62532:68424:1 g... [more]
btbd2a2.838e-926.97BTB (POZ) domain containing 2a [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO455503.815e-1228.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356995.199e-926.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478741.446e-736.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447045.626e-725.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455835.063e-630.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin protein ligase-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000044112.12.536e-9539.92pep primary_assembly:ASM223467v1:21:8480059:848675... [more]
ENSORLT00000014399.26.208e-1323.64pep primary_assembly:ASM223467v1:21:8542129:855884... [more]
btbd2b8.921e-1029.14BTB domain containing 2 [Source:NCBI gene;Acc:1011... [more]
BTBD11.009e-929.94BTB domain containing 1 [Source:NCBI gene;Acc:1011... [more]
rcbtb27.000e-925.00RCC1 and BTB domain containing protein 2 [Source:N... [more]
back to top
BLAST of E3 ubiquitin protein ligase-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066158.10.000e+098.64SMESG000066158.1[more]
SMESG000066165.10.000e+097.66SMESG000066165.1[more]
SMESG000066165.10.000e+097.66SMESG000066165.1[more]
SMESG000066165.10.000e+097.66SMESG000066165.1[more]
SMESG000057228.19.604e-1230.98SMESG000057228.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30021490
GenBankAFJ24730.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021490 ID=SMED30021490|Name=E3 ubiquitin protein ligase-1|organism=Schmidtea mediterranea sexual|type=transcript|length=12996bp
ATGTAATTCATCCAAATTTCTTTCTAACTAATCTATTTATTAGTCAATAA
ATTAAAAGCACCTACAAATTAATTTCAAGCTTTTGCTGACAAAACAAAAA
CAATGTCTTTTGTTCACGTTAACAATTCTATTCCAGATTTCATTGCCATT
TCTAAAATGAAAAATGCATTTTCTGAAAATGATAATGAAGTTGATGAATG
CTTTAATAACAATTATTACAACCTGAGTAAATATCTTCATGAAAACAAAA
CTCCAAAAATACTTATTATGTCACTTGAAGCCATGTATAAAACTATTCAA
GACACTTACGAATCTAATCCAATAGTTTGCTGTAAATTTCTTCAATCCAT
TTTAACATATCTAGAGTCTCTTCAACCTGGAGATTGGGTTTCTGAATGTG
ATGACATTATTGATTATTTATTCAAATTGCTGCTGGGAATAGTCCAAACA
ATAGACATTCAAACATCGCGAGTCATCAACCGCAGTCGATCAATGACCAA
TTCGATCAGTAATTCGGCGAAAAATACCAATTCATCTAGCAATTGCTATG
AAGACGGCTTACCGCCGTTCGACTGCAATGTTTCGATTCAGAAAAACCTA
TGCAATATCGCTACCGCATGTTTATTCAGTATCGGGATTGCAAAAGGAAA
CATCAGCATGCTATTGGTGGCTGTTAACACCGTTCTCATAAGAAACGGAT
TGCTCGATGACAATGATTTCATACAGACTCCTAATTTGGTATTAAAATTA
AAGAAGTGTTCTGATTGGTCGAATAGAAATCAGGAAATCCCAGTTAGTGA
GCAATTTTGTTTGATCAATCAACTTCCGGATAATGTCACAAGTGAATCAT
TGATATCGAATGGAACTTATTTGTTTTGGTTGACATCGATTGGCTTATTA
AAAATCGGTACTGGGTTTAACGGATCAATTCAAGGCTTTGTGTATCTGAC
AAATGAGGAGCTGGCTAAATATTGCACTGGATGGATGGGAATCGTTTCAA
ATTCTATTCTACTTCATGTTCCTTTACCGACTCGATCATGGAAAATGGGA
GAAATGTTGACATTCTATAAAATCAACATAGATAACCTTCAAATTGATGG
TCAGGTTAATCTCAAAATCACGAATTTTCATGGTTTTCCTAGTACTCCAG
GATGGAAATATTATTTATTTGCAAATTATACTAAATTAGGGTGCTGTTTA
ATCAATGAAGATGAAACATATTCCGAGCAGCTTTTTATGAAATTGTTTAA
ATTGAATTCCGAAAAGTTTCTTGTTGAGGAATGTGAAAAATCTATTGACA
TGACCCAGCACCTTATTTTGAAATTCGAAATAGAACAATCGAAAATATTT
TCTAATCCTTCCACTTTAATCGAAACATGTCCCAGTCTATCTTTGGCCTG
TGAAGTTCTCAATTTAGAAGAATTTTGCGTTGTTCGGAATCAATCAGGAG
AAATATTTTACAAAGATATAGATAATGTGGAGCGAAACAATAACGTAGAA
AACTGGACACGCTTATTGTATACTGACTATGTAGCGGCAAAATTCCACAA
ATTAATCGGTGGAATAGACAACAAATTTATTTGTGCTATTTCCGATGACG
GATTATGGCGGATAAACATAAACCGACATAGCCAACCCAGAACCCTTTGC
TTAGATAGACTAATGCCAAATTCAAGATTTATTTCAAAAACTTGGGCATC
TGGCAGCTGTTCCAAAGATAATCTTGCTCTGGTGTCAAAAGAAGGGCAAG
TATTATTTTTAGAGAAAGACTCTATACATTCTTTATCTACTTGCTATGGA
GCCTTATTGAGTCCATATCATGTCACACAAATATCTCTAGGAAAATCACA
TGGAGCCTGTTTGTCAAGAAATGGATATTTAATAACATTCGGTGTTAATA
ACTATTATCAATGTGGATGCGTCAGCGTGGACAATGATGGGAAATATAAC
GAAATAATGCAAGAAATTGATAATAACAATGTCGACAGCTGTTCACAAAT
AAGATCAAAACATCAAGTTCCGACAATAAAGCCACAGAAGTTACTTATAT
ATTCTGATACAAATGCCAGTTCCGGAATAAAAAATCGGTCTAATTTCCTG
CGAATTCAGCAAATATCATGTGGGCATTATCATACTGTTATTTTGACAGT
AAATGGAGATGTCTATTCATTTGGAAACAATAAATTCAATCAGTTGGGAC
GCGGATATTTATCAAACAAAGAACTGCCAAAGGTTGTCCCAATCCAATGC
AAATCTGTGAGAATCACTACTGGTTCTTTTAGTACTGGAATTTTAAGCCA
AAACGGAAAAGTGTTTATATTCGGCAATAAAATAACAAGTCCACAAATAA
TAGACTTAATCTCAAATCCGAATGATTTAACCGATAACCTTCAACCGATC
TTTTTCAATTTTAGCACAAATAACTATAAAAAACAAATAATATTTTGTAT
TCTCAAGCAAAACATTTTCTATATGAAACGAAAACCTTTAACGTTGTCAA
CACACCGAAAGTCCTACCATCAAGATCAGTTCAAATTTCTAGCAAAAGAC
AACACAATTTTATTGACATTGGATGAACAGAGAGGCTTGCTAATAAACAT
ATCATCTGGAACCATAAAAATAATGCCGGACTATGATGAAGGGAATTTCA
GTTCATTGATGAACTCATATTTTGATCCGAGATATTCGGTATTGTGGAGC
ATTGACAGTGGACATGGATCGAAGAAATTTACAGTTAAATACTCAAAGAG
CAACATTTTCCAAAGCGATAATTTTCAAGATAAATTTGATCAACTGATTG
ATTTGCCAGATGATATAAGTTTTTCTAGTCAGCGCTACAGAATTGCTTTA
AACGTTTTAGTCAGTGCTGAAAAGCTTTTGCTGAAAAAATATGCAGATCC
TCAGAATAATAATCAAATCAAAACTGTAGATTCAAATAAAGAAATATTTA
CTGTCAAAAGATTTACAAAAGAAAATAGCAACTGGTTGTATTCTCCAAAT
GCTCATGATTCAATAAAGTTTTCGGTTTCTGAAACTATATACATCCATGG
CATCGGGCTGTATACGGGCCCCGGTGAAAATACAATGAGCATCAAGATTT
ATGAAGAAACTGGTCATGATTCTGACACCGATGACTTGTTGAACACGAAT
CTCTTCAGTTATGATACACAATTTTCCTCGCTTTTGCTTTTCACTGAAAC
TGACAAAGTTGAAGTTCAAAATATGGAAAACAAGAAAATCATTCGTCTGA
TGCTTCCTTCTCCAATAATTCTTTTCTCCAATAAACTTTATGTAATTGTT
GCCACTATAACTGGAGACAGTACGGATTTTGGTTTTCATGGTCGATCAAA
AATTGACACAGATCTCGGAGTAACGTTTAAGTTTAAACAATCGAAAAATT
CCTCAAATGGCACTCATGTGAAGGAAGGTCAGATACCTGAGATCTATTAT
TCACCTAGAATGCCAGATATTCATAAATTGAAAAAGGATAATGAAAAATC
GGACTATTTTATAAATGCGGCAAATTTTACAGAATATCTCTCGAGTCAAA
TTTCAATGAATTCTTTAACCTCGGCAGTTGCCCTATTAAATTGGATTTAC
ACTGGATTGACTTGTATGTTCAGTGAACTGCCTGACTTACAATCGGATTC
CAGTGCGCAAACCTATTCATACAAACTGCTTAAATCTCTTGAAACATTGA
AACTTTATTCCAAAGCTTTTACGTCAACATTGAAAATTATAAGAAAACAT
ATTCAATATCTTTATCCTTTTAACGGTAAATTTAATGAATTATGTCACTT
AGAAGAAACCTTGGTAAAAATACCTTCATTAGGGTATTCGAAAGACACAG
AAAGTCAAGAAACGTCTGTCGTTATTGGGGATTTTAGAATAATTGTTCGG
AATATTTTCTTAGAGTGTAAAATCTGCCACTATTTACAGTCAATAAAATC
TACTTATGGTGCAGAATCCCTAATATATGCAGAGTGCTGGAAATTATTCA
CTGAGGATTTAATACCTGTATATAAAGAAACATTTGAACATTCTTTTCAT
GCTTTTTATCCTGAAATCGAAGATCAAAGATTTACTCTTCAAGAAGCACT
GCTTAAAGTTTATGAATTCTGCTTCAATAAATCAACTGACACTCTGTGTA
ATTATGGAAAAATTATGTTTCTTACTTCGCTATTGACGGCGATAAATTCG
GCAAATGAGGGCTTTTTAATATTCACTCACAAGGACAATTCAGTCACTCG
ATCTGGAGAAAATAAAATTAATGGAGAAAATAATTTTGCCCACAGATTTC
CACTTCTTCGGGAATATATGCGAACTATATGGAAGCCTAGTACTCCATGT
TCGTCTGATATTTTAGCAAGCACTTCTACGATGATTCACTGTTTACTAGC
AATTATAACGTTGGATATTAAAACGGCATATAAAACATGTAAACAAATAA
ATTCCTCCTCTACTACAGAAAATGATGTCTCTGAAAAAAAGCTTTTCCAG
CAGGAAATGACAAATTTAATTAACGCTTCGCATCAAATTTTAACGAATAT
CACACGTCTACTGGTTGATCAACTAAATCATTCAGCAAAAACTCCGGCTT
TTCGTATGTCCCAAGTCAATTCAACTAACTCTAAACAAAATGGTCACAAT
AACAACCAGACATATTTAGAGGACATCATTCTGACCACGCAATCACGATT
TAAAAGAGTTGTTTGGCTAGACAAATCTGCAGAAAATTCTAGGCAGAAAT
TCGTTGAACAAGCCATAAATGTGGCGGAACAGGAAATAGAAGACGTCATA
TGTTTTGCAATAAATAAAAATACATATCAATTTATCAACGGCTTTGAAGT
AGTTGGGGATAATGTCATTTATCTCGAAGGAATAAAAGTATACTGCTCAA
ATTTCACAGAATCCCGATGCTTGGCGTACATTTATCGAATAAAAAATTTC
CAAGAGGGAATTCGAGAAAAATGGGAATTAATTCCCATGGAATATGAATG
GAAAAATGAGGAGCAGGATTTAATAGCTTCTGACCTCATTTTTAAAAGGA
AGCTTAAATTGGAAGAATCATATCGATATGCGGTGAAAGTATTTTTAATA
GCGGCCAACAATAAAAAAACACTGATTGGTCAAAACCCCGTTTCGAAATT
GGGAACTCGATTTGGATACCATTTCAATCTTTATGAAACGAAATTACGGA
CGACAGCAAATCAAAATTCTCGACAAGGAATCATATTTTCGCTTTTATAT
TCTTTCAGCACAAAGCCACAATCAGTCACAGATAACCAACGACTGGAGCG
AAAATGTGTAAAAATGTGTTTAATTGAATTGCTAGCACAAGTCAAATACG
GATTGGTCACAATGATTAGAGAAACGAATCCAGAAGAATTATTAAGCATT
GGACAGAAATTATTCATAGACACTTACTTGCCATTTTTCTGCCACCAATT
ACAGTTGGTGTCAAATGTTTCAAAGAAAATAACTTGCTTGTCCATAACCT
TCGTAAGGGAAACTTTAATCGTCATTCAAGAAAATTGGAAAACTACTGAC
AAATTAATAAACTCAGAAAAGGACTATTTCACTATTATCGAAAGCAATCA
TCCATATGAGCAGGCTAAACTCTTGCATAACACGATAAAATTCCCGGATT
CTGTTGATGCTATCAGTATCACTTTCGATGGCCATTGCGTGACAGCTCAA
CCGGAAGACTTTCTAGTGGTTAAAGCTCGAACAAATACAGCTAATGGAAA
TCAAACTGAAAATAAATGGAAAATCATATTCAAAAATTTGAGTAATATAA
TTTCTGATTGGCCAAAAAAAGCCGTCATAATTCAAGGAAATGAAATTGCT
ATCGAGTTCCACACCGCATCTTTATATGAGGAATCTTTAGAGTCGACGTA
CGGATTCAAGTGTTCCATTGTTGGACATTGCAGTAAAATTGATGCATTCA
TTGAGCTGTTAGAAAATGCCTTAACATATTTGGCATCAAGGTGCGCCACT
AGTTTGTTGGAATTCCGAAAGAAATCAAAAGTAATCAAATTATTACACGA
AACAAATATTCTTCAAAAATGTGAACCCTATAGAAGCATATTAGATCAAG
GCCTTTCGCTATCAAAATTACCCACATTAACTGATTGCTTAAGTAAATCT
CAATTGGAGTACATAAATTCCATACAAACGACATTTGTCAAAAAATTTGT
GGAAGGATCAAATTATTATCCAGAAACTTCGTGCTCTTCTCCGGCAGTTC
AATTGTCTAAGTGGCTTCAATCGTGTTCCGTAGTCATTGTCAGTAATTGC
CGGCTTAAATTGGCCCCCACTTCGATGCCTGCTAAATACTTGGATGAATT
GAAAAGTTCATCAGAAACAAATATCGTCGGAAATCAAATTTCAACGGAAG
TGAATAAAGAAATAATTCTTCAACTTGAACTGCTTGACCAGTATGAAAAT
CAAGTGACATCCCAAATGAGCAATATAGAAGTTTTATTTAATTATAATCA
CAAAGGAAATAATCCTTTTATTAATATAAACGAAAAATTATTTGGAGGAC
ACCCAGTGCCAAATACCACTGTACCTTTTGAGAGAACGATAATCGGAAAA
GATATTTATCAGAGTATAACAATGATGAAAAATTATGAAGCACACAGTTT
TGAAGAGATTCGAGCCGCCGGATTTCAAGAAACGGTATGCAAATCTCAAA
GAATTAAATACCGGTGGAGTGAAGAGGAAAATTCTTTTTTCATTGACTGG
ATACCAAAAGCATGTGGAAAATATAATTTAGTGATAACCATTGATAAAAT
AATACTAAAAAATAGTAAAACCAGTGACAATATTACATTAAAAATAGATG
TAACTAAATCCTCACTAGTTAAAAATGGACCTGTTGAGAAAATACGAAAA
AGAACTGAAAATAATAAAGATAAAAATGACAAGCCAAAATATCTTTGGTT
TGAAGGAAAACAAAGTTCTGGACTTCGTCTTCGATCTCAACCCTCCTTTA
ACAGCCCGGTTTTAGGAATAATTCCATGTAATACTGTATTACGATATGAA
GAAGAACTTTTCACTGAAAACAGTGTTTGGGTTCGACTTCATTTTGACTC
CTTTAATCAGTGGTATGGATATTATCCTTCCGATCCACTAGATCAAAGAC
CAATACTATCTATTGAACCAGTAATGTCAAATCAAGAAACTATTCCATTT
CGTAGAAAAGCTGTCACAATCAAGCCGCAAGTCAAATCATCTGGATTTTG
CAAGAAAACTGTCAAATCCAATTTGAAACCATTCACAGAAGGATGGTGCT
TAAAAGAGCATTTAAATAAGATTTTTTTAACTCCTGCCAAAATAAATTAT
GCTGCTGAAATTCTGCAGAAAGAAAATATTTTCAAAATTTTGTCTGACAC
CCAAAACCAGCTAAATAATGCCCCCTATAAAGTTTTATCGAAAACATTGC
CTTACAAAAGGCGACAAAGTGCTCGTTCGAACCAAGCCGAATTTTCTAAA
TATTCCTCAAATACAGTTGCAATCTCGTTGCCAAATTCACCAGATATGAC
ACTAAGGCGAAAAACTCAAAACAAACTAACAATTTCTAGTTCCGCATCAT
CTAGCCAACCAAATAGTCCCGGCATTATCAGAAGGAGATCTACCAAAGGT
CCAGCTTTGCAGAACACTCAAATGACAGGAAAAATAAATGCGCTGTCTCC
TCTTCAAGCTGAAACCCAGCGAGCATTATTTGCGGCAATAATATGGCAAA
ACGGACTTGTTTCTGATTTAATACAAATCGCTGAATCCATCAATTTATAT
TCAGCCTACCATCAATTGGAAAAACAAATTAACAATTCCACCAATACCGA
TGATAATAGAAATATTCCTCCATTCGACGCTGCCCCTCTACTTTCCAATG
GCATAACTCGCAGCAACTCACAAAACACTGGAGACATGAGCTTACTTTCT
GACAGCGGGGGGTTGAGAAATTTCTCGATTTCAGCCATACCGAGAGTTTT
GCCTTCACTGGCCGATTTGGTAGCGAACGCAGTAGCTGCTACATCAAACT
CAATTTCAAATGACCTCTCGCCAAGTAGTAATAAGAGTCCGCCAAGACCA
AGTGGTAGTATAAAACGAAGTCAGTCTCATATGGATGGTAGATCTATTTT
AAGCGGCCAATATGGCCCAATGCATTACCGTGATCGGTTCTATAGTCAAG
TTAAGGAAGAGGAAACCACAAAATTAGGTCTGCATGTTTCTTTGGATGAA
GAATTGCTGAACATTGGTAAACCTTCTTCCTCAAATTGCCGATTAAGTGA
AAATTTACAAAGTGAAATTCTAAACAAACTTAATCAACTTACTAAATTGT
GGGACACAGTCTCAGCAATATTGACTCTTTCTGAACAGCAGAATCAATTC
ACCAAGGAAGAATCATTCAGCGAAACAACACAAATGTCGAGCGGAAACAG
TATTTGTGAAGAAATGACAAACATGAAACACATCTCAACGAATTTCTATC
AAAAGGTTTATGATAATAGCGTTCTTCTTTTGGAGATTGAACCGGCAAAT
GCATCAGCAAAATCAGGTTTTCCAATAGTTTCAAGAGACATCAATCCAAA
CTCAAAAAATGGAGATCATCAAAGGATTTTATCACCCAATCATGAAGATG
AGGCTATTTCTCAAAGTCGAAAGACTAAACGAAGTCTAGAATCATGTTTT
GTCATTCCATGTTCCAGCAAATACTTTCCAGAATCCGAAATAGACTTGTC
AAGATCCATTAAGTTAAAATCTCATAGTCCTACAAAGATTTATGCAAACT
TTTGGCCTCTTCATAATCTCCAGAGACCTTACACATTTGGAAATAATCTT
AATCTTGATGAAATGAATGATCAAATTAATACTGCTGTTAGCTATGATGA
TAGTTCAATTTACTTGAAATGCGACTGTTGGAGTTGCTTGCCACTATTGA
AGGAATTGGAACCAAAAACTAAGGCCAATTTCAGTTCAGGAAATTTAACA
GCAAATAGCGTCCCAAATTCATCTTTCGGTGCTGGTTTTTCATCAACTGC
AATGAAACAACATATGCTTAAATTAAGTAGAACTGACAATTCTTCATGGG
AGCATAACATAATTACTAGTTCCGACTCCAACTCTGCTAGTATTAAACCT
CACACTGGATCTAGCTCTTGTCATAAGTCAGCTACTGTTATAAGTCAGCT
TTTACAATCTATGATGTCATTGTTAGTCAACATTGTGGCTTCGTCTTCTT
CTGGAATGGAAATTTTCGAACGCAGTATGACTGGATCCAATTTTTTGAAA
AAGGACTGCCCAACTCGTGGAATGCTAGAAATGCGATTTTGTTTGTGTTA
TTCATTCATATCTGAGTTGCGATTGGCTTTAGAAGTCAGCCTGAGGACTT
TGACAATTGAACAATACAGTTATCAGACTTATTTTTGGTTGTTGGAGAAT
GTGAGAAATAACTCCAGTTTGCAAATCGTAATATGGTGCATGTTTAACCT
TTTGGAAAAACACAAGTCAATAGATAAATCCAACAAACCCCAAATAAGTC
TAATTGAAGAAAAGAATTTGAAAGTTTATTCACAGCAGCTTTGGGCAGTC
GGTAGTGCTGTGTTTTATCGCATTCTAGACAATATCATACACAATTCGAA
TTTGAATAATTTATCAGTCTCGGAAATCAAGTTGTTGGAAATGACAGTGA
AAATCTCGAGTCTTCTCCTGTTCGCTGATGGAACAGATGAGTCTTTTTCC
CAATCTTTTATCAATTTTGAAAAATCACAAGTTTTTTCCTGTTTGAGTGA
ACTTCTCAATCATTTGGATGATTCGAAAGTGTTCAACGGCCGTATCATAT
CAACTCACGAAAACTCAATCAAGATAAACTCTCCAATGGATATCACAGGT
CTATTCAGTTGCACTGTGACAAGCAACAGTGATAGTGCTCAAAGTCTTTT
TGACAACAACACTGATATTTTTTGGGAAAGTTCAGGAACGAATTTAGATT
TATTTCCATGTATATTGTTAAAAGTGAATCAAAAATGTTCCAGAACCATT
ATTAGTGATCAGATAATTGTGTCGGTATATCTTGATAGAACAAGAGACAT
AATCAACGGCCACGTAACAGCAACCGTCAGAATTTTGAAGACGGCCATTT
ACCAACAGGTAGTCATTGAACCAGATCACATCGGGTGGATTTCTTTTCAT
TTAGAAAATGCAAATCAAATTGAAAATGGTATTAATATTGGTTTTCATGT
CGTTCCAGATGAAGATTTGCATGCAAGTGCTGCAAATGGAATGGCAAATG
ATAAAATTAGAGTAAGAGCAGTAAAGGTTCTGGATGCTTCGGAATCAGTT
TCTACTACTTACTATACAGAGGATGATCAATTGAAGTTGAGATATGATCT
GTTAAAAGAAGAAACTTTGAAATCTTTCATTGAAATGACAAATCATATCT
TTTACAATTGTTTTACAACCTCATATCAGAACAGAATAGAAAAGAAAGAG
CTTCAAGACAATCATGACATCGAAAGTAAAAGTCTTCATGATTTTCTTGT
TAACATTTTGTTTGACACTGGATTCAAATCGGAAGTCATTTCGTCAAGAT
TGAGTAGCTTGCAACGAAGGGTTTTATCTCATATCATTACTCAAATTAAT
GTCGAAGTTACGAAAATGCTAATAGATAGGCAAGACGGATCGGTTCATAT
AAATAATGATAATGAATGTAAACACGAGGGACTGATGAAGAAATATGATC
CTACTCGATGCTCTTGTTGCTTTCAGTTGTTGAATCAGGTCTTAGCATTG
TCGGGGGCTCAAGCCGGTCTACGATATCTTATTCACCAGGCCCAACTTAT
CAGAGATCTGATCATTTTGTTATACATTGGTTCAGATAAAATCAGACAAC
AAGTAATGTTTGCGATTACTCGAATCTTCTCTGCAGTTTCTCCGAGATCT
CTAGAGGACATCTTGTTTGGAGTAATTCATCCGAATGAATTTGAAAATCC
GCAGAATGTGAAAATTAAATTAGAAAAACCGTTCATACCCTTAAATCTAC
TGATTATATTTGCTGGGAAATCTTTAAGCATTCAAATGAAATCCAAATCA
TGTTCGCAGCAAAGTGGTCTTAAACCTTTTCAAGATTTCCTTCAAAAAAT
AAATAACTTACCGAATTTCATCCAGACGTCGCACTGTGATTCCAATTTTG
CTTCTAAAATTTACCAATTGATATGCCAATTATCTGATGAAAATAACCAC
GCAGCTTGGTTTGTCTACATCCAAGAGTGGCTTCGTGACATTTTTGAATG
TTTCATGGCAATTAATCAAAACAGTGACTTCATAAATTGGGAAAATCCGA
ATTTATACTTTTTGATTTGTCTTTTGCCATTATTCGAAAATGTGAAACTA
GCAAACTTCTGGAATAATTTATCATCAACAGCCAGAGTTCTCAAGTCTGG
AGAAAAGAAAATGTGTACGAATCATGACGACGAATCAACAATAGCAACTG
TAATCTGCTACACCTGTCAACCGATATCCAATGCAACTGATCCAACTGAT
CTATCTTTAAGTGCTCGGCTAATATTTTTATGTGCTGAGTGCGATAGATA
TTTGCACTTGTCCAAAATGACAAAGTATCATATTAGAGACAACCTAAACA
TACAACCGATTTCTCCAAAAGACAACCTGTCACTTTGTGATTGCATTGTC
AATAGTCACGAATCATGTGTAAGACTGAAATCTAGCAAGTTCATTGTCAC
AGTTGACACTTCGACATTGAAAATTTTGATAAATCTTTCACAAAATGCAA
TGAATAATAATAATACTACTACTAATAATAATAATGACATTACTCCAAAC
AATACAGACATTGAAATCAGTAAACCGTCAGACCAAAACGAACGATGTAG
ATTTTGTAATGAAACCTCTACAAATGTTGACAATAAGTTTGCTTGCTTAG
CTCAGGAATGCCAAATAAAAAGCTCTGTTGCTTGTTCCGATAAAATCCAA
CCATGTGGACATTGGTGTTTGGGAGTTGTACTTATTGGTAAGAACGAATC
CAAAATGAAAAAAGTTTGCCCCCCATTGTGCATTGTACCAACTTGTTCAA
ATCAATCGACATTGTCAAAGTTTGGACTGAAACAGGATGGAGACGACGTT
TGTATGATTTGTTTCACAGATACTTTGTCTGAAGGTCCCATAATAATTCT
TGAAAACTGTCGACATATGCTACATTATCATTGTGCTAGAAGGCAAATTC
AAGCTGGATGGCCTGGTTATCGAGTTTCCTTTAACTTTAGAAAATGTCCG
TTTTGTAAACAAAAAATAGAACATCCGGCTTTACAAGATCTGTTAGAACC
TTATGATATCCTAGAGAAAGAAGTTAAACGTAAGGCACTTTTGCGATTGG
AACACGAAGGTTTGATAGATTCTCCTGAAATGAAAGACTCCGACGGGGCT
ATTAAAGAATTACCTGAAGAATTTGCTCTTCACAAATATTGTTATTATTT
GTGTTACAAGTGCAAAAATTCATATTATGGCGGTGAAGCACGCTGTGAAC
CAGATATGTTATTGAATACTCAAACAAATAATGACAGAGTTAACAATTCA
CCAGTCATGGATCCAGCTACAGAATTATGTTGTGCTGCCTGTTCAGATGT
GGCTCAAGCAAAAATATGCCCAAAACATTCAACCGATTTCCTAGAATACA
AATGCCGATATTGTTGTTCGATCGCAGTGTTTTTTTGCTTTGGAACTACA
CATTTCTGTCAACGATGTCATGACAACTTGGATACCGTTTTGAAAGCCCC
TTGGCTACCACAATGTCCAGCTGGGCCAGCATTACAACATTTATCGACTC
CAGAGTGCCCTCTGCATGTCATTCATCCTCCGACGGGTGAAGAATTTGCA
CTCGGTTGTGCTCTTTGTAGAAAACTGGACACCTTTTAATTTCACAATGA
AACATTTTCATAAATGTGTGCTATGCTTGTGAGAAATATGTTTGAT
back to top

protein sequence of SMED30021490-orf-1

>SMED30021490-orf-1 ID=SMED30021490-orf-1|Name=SMED30021490-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=4279bp
MSFVHVNNSIPDFIAISKMKNAFSENDNEVDECFNNNYYNLSKYLHENKT
PKILIMSLEAMYKTIQDTYESNPIVCCKFLQSILTYLESLQPGDWVSECD
DIIDYLFKLLLGIVQTIDIQTSRVINRSRSMTNSISNSAKNTNSSSNCYE
DGLPPFDCNVSIQKNLCNIATACLFSIGIAKGNISMLLVAVNTVLIRNGL
LDDNDFIQTPNLVLKLKKCSDWSNRNQEIPVSEQFCLINQLPDNVTSESL
ISNGTYLFWLTSIGLLKIGTGFNGSIQGFVYLTNEELAKYCTGWMGIVSN
SILLHVPLPTRSWKMGEMLTFYKINIDNLQIDGQVNLKITNFHGFPSTPG
WKYYLFANYTKLGCCLINEDETYSEQLFMKLFKLNSEKFLVEECEKSIDM
TQHLILKFEIEQSKIFSNPSTLIETCPSLSLACEVLNLEEFCVVRNQSGE
IFYKDIDNVERNNNVENWTRLLYTDYVAAKFHKLIGGIDNKFICAISDDG
LWRININRHSQPRTLCLDRLMPNSRFISKTWASGSCSKDNLALVSKEGQV
LFLEKDSIHSLSTCYGALLSPYHVTQISLGKSHGACLSRNGYLITFGVNN
YYQCGCVSVDNDGKYNEIMQEIDNNNVDSCSQIRSKHQVPTIKPQKLLIY
SDTNASSGIKNRSNFLRIQQISCGHYHTVILTVNGDVYSFGNNKFNQLGR
GYLSNKELPKVVPIQCKSVRITTGSFSTGILSQNGKVFIFGNKITSPQII
DLISNPNDLTDNLQPIFFNFSTNNYKKQIIFCILKQNIFYMKRKPLTLST
HRKSYHQDQFKFLAKDNTILLTLDEQRGLLINISSGTIKIMPDYDEGNFS
SLMNSYFDPRYSVLWSIDSGHGSKKFTVKYSKSNIFQSDNFQDKFDQLID
LPDDISFSSQRYRIALNVLVSAEKLLLKKYADPQNNNQIKTVDSNKEIFT
VKRFTKENSNWLYSPNAHDSIKFSVSETIYIHGIGLYTGPGENTMSIKIY
EETGHDSDTDDLLNTNLFSYDTQFSSLLLFTETDKVEVQNMENKKIIRLM
LPSPIILFSNKLYVIVATITGDSTDFGFHGRSKIDTDLGVTFKFKQSKNS
SNGTHVKEGQIPEIYYSPRMPDIHKLKKDNEKSDYFINAANFTEYLSSQI
SMNSLTSAVALLNWIYTGLTCMFSELPDLQSDSSAQTYSYKLLKSLETLK
LYSKAFTSTLKIIRKHIQYLYPFNGKFNELCHLEETLVKIPSLGYSKDTE
SQETSVVIGDFRIIVRNIFLECKICHYLQSIKSTYGAESLIYAECWKLFT
EDLIPVYKETFEHSFHAFYPEIEDQRFTLQEALLKVYEFCFNKSTDTLCN
YGKIMFLTSLLTAINSANEGFLIFTHKDNSVTRSGENKINGENNFAHRFP
LLREYMRTIWKPSTPCSSDILASTSTMIHCLLAIITLDIKTAYKTCKQIN
SSSTTENDVSEKKLFQQEMTNLINASHQILTNITRLLVDQLNHSAKTPAF
RMSQVNSTNSKQNGHNNNQTYLEDIILTTQSRFKRVVWLDKSAENSRQKF
VEQAINVAEQEIEDVICFAINKNTYQFINGFEVVGDNVIYLEGIKVYCSN
FTESRCLAYIYRIKNFQEGIREKWELIPMEYEWKNEEQDLIASDLIFKRK
LKLEESYRYAVKVFLIAANNKKTLIGQNPVSKLGTRFGYHFNLYETKLRT
TANQNSRQGIIFSLLYSFSTKPQSVTDNQRLERKCVKMCLIELLAQVKYG
LVTMIRETNPEELLSIGQKLFIDTYLPFFCHQLQLVSNVSKKITCLSITF
VRETLIVIQENWKTTDKLINSEKDYFTIIESNHPYEQAKLLHNTIKFPDS
VDAISITFDGHCVTAQPEDFLVVKARTNTANGNQTENKWKIIFKNLSNII
SDWPKKAVIIQGNEIAIEFHTASLYEESLESTYGFKCSIVGHCSKIDAFI
ELLENALTYLASRCATSLLEFRKKSKVIKLLHETNILQKCEPYRSILDQG
LSLSKLPTLTDCLSKSQLEYINSIQTTFVKKFVEGSNYYPETSCSSPAVQ
LSKWLQSCSVVIVSNCRLKLAPTSMPAKYLDELKSSSETNIVGNQISTEV
NKEIILQLELLDQYENQVTSQMSNIEVLFNYNHKGNNPFININEKLFGGH
PVPNTTVPFERTIIGKDIYQSITMMKNYEAHSFEEIRAAGFQETVCKSQR
IKYRWSEEENSFFIDWIPKACGKYNLVITIDKIILKNSKTSDNITLKIDV
TKSSLVKNGPVEKIRKRTENNKDKNDKPKYLWFEGKQSSGLRLRSQPSFN
SPVLGIIPCNTVLRYEEELFTENSVWVRLHFDSFNQWYGYYPSDPLDQRP
ILSIEPVMSNQETIPFRRKAVTIKPQVKSSGFCKKTVKSNLKPFTEGWCL
KEHLNKIFLTPAKINYAAEILQKENIFKILSDTQNQLNNAPYKVLSKTLP
YKRRQSARSNQAEFSKYSSNTVAISLPNSPDMTLRRKTQNKLTISSSASS
SQPNSPGIIRRRSTKGPALQNTQMTGKINALSPLQAETQRALFAAIIWQN
GLVSDLIQIAESINLYSAYHQLEKQINNSTNTDDNRNIPPFDAAPLLSNG
ITRSNSQNTGDMSLLSDSGGLRNFSISAIPRVLPSLADLVANAVAATSNS
ISNDLSPSSNKSPPRPSGSIKRSQSHMDGRSILSGQYGPMHYRDRFYSQV
KEEETTKLGLHVSLDEELLNIGKPSSSNCRLSENLQSEILNKLNQLTKLW
DTVSAILTLSEQQNQFTKEESFSETTQMSSGNSICEEMTNMKHISTNFYQ
KVYDNSVLLLEIEPANASAKSGFPIVSRDINPNSKNGDHQRILSPNHEDE
AISQSRKTKRSLESCFVIPCSSKYFPESEIDLSRSIKLKSHSPTKIYANF
WPLHNLQRPYTFGNNLNLDEMNDQINTAVSYDDSSIYLKCDCWSCLPLLK
ELEPKTKANFSSGNLTANSVPNSSFGAGFSSTAMKQHMLKLSRTDNSSWE
HNIITSSDSNSASIKPHTGSSSCHKSATVISQLLQSMMSLLVNIVASSSS
GMEIFERSMTGSNFLKKDCPTRGMLEMRFCLCYSFISELRLALEVSLRTL
TIEQYSYQTYFWLLENVRNNSSLQIVIWCMFNLLEKHKSIDKSNKPQISL
IEEKNLKVYSQQLWAVGSAVFYRILDNIIHNSNLNNLSVSEIKLLEMTVK
ISSLLLFADGTDESFSQSFINFEKSQVFSCLSELLNHLDDSKVFNGRIIS
THENSIKINSPMDITGLFSCTVTSNSDSAQSLFDNNTDIFWESSGTNLDL
FPCILLKVNQKCSRTIISDQIIVSVYLDRTRDIINGHVTATVRILKTAIY
QQVVIEPDHIGWISFHLENANQIENGINIGFHVVPDEDLHASAANGMAND
KIRVRAVKVLDASESVSTTYYTEDDQLKLRYDLLKEETLKSFIEMTNHIF
YNCFTTSYQNRIEKKELQDNHDIESKSLHDFLVNILFDTGFKSEVISSRL
SSLQRRVLSHIITQINVEVTKMLIDRQDGSVHINNDNECKHEGLMKKYDP
TRCSCCFQLLNQVLALSGAQAGLRYLIHQAQLIRDLIILLYIGSDKIRQQ
VMFAITRIFSAVSPRSLEDILFGVIHPNEFENPQNVKIKLEKPFIPLNLL
IIFAGKSLSIQMKSKSCSQQSGLKPFQDFLQKINNLPNFIQTSHCDSNFA
SKIYQLICQLSDENNHAAWFVYIQEWLRDIFECFMAINQNSDFINWENPN
LYFLICLLPLFENVKLANFWNNLSSTARVLKSGEKKMCTNHDDESTIATV
ICYTCQPISNATDPTDLSLSARLIFLCAECDRYLHLSKMTKYHIRDNLNI
QPISPKDNLSLCDCIVNSHESCVRLKSSKFIVTVDTSTLKILINLSQNAM
NNNNTTTNNNNDITPNNTDIEISKPSDQNERCRFCNETSTNVDNKFACLA
QECQIKSSVACSDKIQPCGHWCLGVVLIGKNESKMKKVCPPLCIVPTCSN
QSTLSKFGLKQDGDDVCMICFTDTLSEGPIIILENCRHMLHYHCARRQIQ
AGWPGYRVSFNFRKCPFCKQKIEHPALQDLLEPYDILEKEVKRKALLRLE
HEGLIDSPEMKDSDGAIKELPEEFALHKYCYYLCYKCKNSYYGGEARCEP
DMLLNTQTNNDRVNNSPVMDPATELCCAACSDVAQAKICPKHSTDFLEYK
CRYCCSIAVFFCFGTTHFCQRCHDNLDTVLKAPWLPQCPAGPALQHLSTP
ECPLHVIHPPTGEEFALGCALCRKLDTF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005085guanyl-nucleotide exchange factor activity
GO:0008536Ran GTPase binding
GO:0042802identical protein binding
GO:0061630ubiquitin protein ligase activity
GO:0008270zinc ion binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0015630microtubule cytoskeleton
GO:0030424axon
GO:0043231intracellular membrane-bounded organelle
Vocabulary: biological process
TermDefinition
GO:0008045motor neuron axon guidance
GO:0016567protein ubiquitination
GO:0021785branchiomotor neuron axon guidance
GO:0021952central nervous system projection neuron axonogenesis
GO:0031398positive regulation of protein ubiquitination
GO:0032880regulation of protein localization
GO:0032922circadian regulation of gene expression
GO:0042177negative regulation of protein catabolic process
GO:0048667cell morphogenesis involved in neuron differentiation
GO:0050905neuromuscular process
GO:0051493regulation of cytoskeleton organization
GO:1902667regulation of axon guidance
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001841Znf_RING
IPR012983PHR
IPR009091RCC1/BLIP-II
IPR013083Znf_RING/FYVE/PHD
IPR000408Reg_chr_condens
IPR008979Galactose-bd-like_sf