Metaxin 1

Overview
NameMetaxin 1
Smed IDSMED30021481
Length (bp)1087
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Metaxin 1 (SMED30021481) t-SNE clustered cells

Violin plots show distribution of expression levels for Metaxin 1 (SMED30021481) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Metaxin 1 (SMED30021481) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Metaxin 1 (SMED30021481) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021481

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30021481SMESG000013267.1 SmedASXL_003685SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30021481SMESG000013267.1 SmedASXL_003685SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Metaxin 1 vs. Ensembl Human
Match: MTX1 (metaxin 1 [Source:HGNC Symbol;Acc:HGNC:7504])

HSP 1 Score: 116.316 bits (290), Expect = 3.586e-29
Identity = 87/305 (28.52%), Postives = 134/305 (43.93%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKH-IIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSANENTLRGKVRVFLTENWIQIRNSSIFVLFVSTMMICYAKSTKVV 1018
            M L+ W     L S+D +SLAV+TY +   AP+ +     PW  PS +LP L+ S    + + H II + RKE Y  +Y+L+    A      S + + L+P + +  W  + NY  VTR  +AEA+ FP++ F    M+ +        RL   T       EE ++  LY  A+ CLT L   L  ++FF  + P  +DA ++ YL  +L        L VH++  + +      I   Y+       P   P     A   T          E   + RN  + VL     M+ YA  + +V
Sbjct:    5 MELFCWSGGWGLPSVDLDSLAVLTYARFTGAPLKVHKISNPWQSPSGTLPALRTSHGEVISVPHKIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLVHTFWIDTKNYVEVTRKWYAEAMPFPLNFFLPGRMQRQ-----YMERLQLLTGEHRPEDEEELEKELYREARECLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLPSGKLQVHLRGLHNLCAYCTHILSLYFPWDGAEVP---PQRQTPAGPET---------EEEPYRRRNQILSVLAGLAAMVGYALLSGIV 292          
BLAST of Metaxin 1 vs. Ensembl Human
Match: MTX1 (metaxin 1 [Source:HGNC Symbol;Acc:HGNC:7504])

HSP 1 Score: 114.775 bits (286), Expect = 8.525e-28
Identity = 87/305 (28.52%), Postives = 134/305 (43.93%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKH-IIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSANENTLRGKVRVFLTENWIQIRNSSIFVLFVSTMMICYAKSTKVV 1018
            M L+ W     L S+D +SLAV+TY +   AP+ +     PW  PS +LP L+ S    + + H II + RKE Y  +Y+L+    A      S + + L+P + +  W  + NY  VTR  +AEA+ FP++ F    M+ +        RL   T       EE ++  LY  A+ CLT L   L  ++FF  + P  +DA ++ YL  +L        L VH++  + +      I   Y+       P   P     A   T          E   + RN  + VL     M+ YA  + +V
Sbjct:  154 MELFCWSGGWGLPSVDLDSLAVLTYARFTGAPLKVHKISNPWQSPSGTLPALRTSHGEVISVPHKIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLVHTFWIDTKNYVEVTRKWYAEAMPFPLNFFLPGRMQRQ-----YMERLQLLTGEHRPEDEEELEKELYREARECLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLPSGKLQVHLRGLHNLCAYCTHILSLYFPWDGAEVP---PQRQTPAGPET---------EEEPYRRRNQILSVLAGLAAMVGYALLSGIV 441          
BLAST of Metaxin 1 vs. Ensembl Human
Match: MTX3 (metaxin 3 [Source:HGNC Symbol;Acc:HGNC:24812])

HSP 1 Score: 105.531 bits (262), Expect = 2.825e-25
Identity = 78/267 (29.21%), Postives = 122/267 (45.69%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAP--VNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSANENTL 901
            + L  W     L S+  ESL V+ Y K + AP  VN+  N   W      +P L    +       I+ + RK+ Y  +Y L+ +  A      + + + L+PAV +  W  S NY +VT+  FA  + FP+SL     M   A ++IL +R      +   L E  V+  +Y  AK CL  L   L   +FF  + P+ +DA ++G+L P+  + +    L  H+KQ + +      I  SY+   +L   + A  E V AN   L
Sbjct:    5 LELSCWGGGWGLPSVHSESLVVMAYAKFSGAPLKVNVIDNT--WRGSRGDVPILTTEDDMVSQPAKILNFLRKQKYNADYELSAKQGADTLAYIALLEEKLLPAVLHTFWVESDNYFTVTKPWFASQIPFPLSLILPGRMSKGALNRILLTRGQPPLYH---LRE--VEAQIYRDAKECLNLLSNRLGTSQFFFGDTPSTLDAYVFGFLAPLYKVRFPKVQLQEHLKQLSNLCRFCDDILSSYFRL-SLGGISPAGQETVDANLQKL 263          
BLAST of Metaxin 1 vs. Ensembl Human
Match: MTX3 (metaxin 3 [Source:HGNC Symbol;Acc:HGNC:24812])

HSP 1 Score: 102.834 bits (255), Expect = 7.104e-25
Identity = 68/243 (27.98%), Postives = 111/243 (45.68%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYH 835
            + L  W     L S+  ESL V+ Y K + AP+ +      W      +P L    +       I+ + RK+ Y  +Y L+ +  A      + + + L+PAV +  W  S NY +VT+  FA  + FP+SL     M   A ++IL +R      +   L E  V+  +Y  AK CL  L   L   +FF  + P+ +DA ++G+L P+  + +    L  H+KQ + +      I  SY+ 
Sbjct:    5 LELSCWGGGWGLPSVHSESLVVMAYAKFSGAPLKVNVIDNTWRGSRGDVPILTTEDDMVSQPAKILNFLRKQKYNADYELSAKQGADTLAYIALLEEKLLPAVLHTFWVESDNYFTVTKPWFASQIPFPLSLILPGRMSKGALNRILLTRGQPPLYH---LRE--VEAQIYRDAKECLNLLSNRLGTSQFFFGDTPSTLDAYVFGFLAPLYKVRFPKVQLQEHLKQLSNLCRFCDDILSSYFR 242          
BLAST of Metaxin 1 vs. Ensembl Human
Match: MTX3 (metaxin 3 [Source:HGNC Symbol;Acc:HGNC:24812])

HSP 1 Score: 88.1965 bits (217), Expect = 1.512e-19
Identity = 59/197 (29.95%), Postives = 96/197 (48.73%), Query Frame = 2
Query:  299 IIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSAN 889
            I+ + RK+ Y  +Y L+ +  A      + + + L+PAV +  W  S NY +VT+  FA  + FP+SL     M   A ++IL +R      +   L E  V+  +Y  AK CL  L   L   +FF  + P+ +DA ++G+L P+  + +    L  H+KQ + +      I  SY+   +L   + A  E V AN
Sbjct:    8 ILNFLRKQKYNADYELSAKQGADTLAYIALLEEKLLPAVLHTFWVESDNYFTVTKPWFASQIPFPLSLILPGRMSKGALNRILLTRGQPPLYH---LRE--VEAQIYRDAKECLNLLSNRLGTSQFFFGDTPSTLDAYVFGFLAPLYKVRFPKVQLQEHLKQLSNLCRFCDDILSSYFRL-SLGGISPAGQETVDAN 198          
BLAST of Metaxin 1 vs. Ensembl Celegans
Match: mtx-1 (Metaxin-1 homolog [Source:UniProtKB/Swiss-Prot;Acc:O45503])

HSP 1 Score: 105.145 bits (261), Expect = 1.216e-25
Identity = 68/246 (27.64%), Postives = 120/246 (48.78%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSS---VGLKHIIPYFRK--ENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSY 829
            M L++WP    L +ID  SL  +   K+  +PV +  + RPW  PS  LP +  +   +      +  +   +K  ++  ++ +LT  + A+L   S  +H +L PAV +  W    NYN+VT+  +A  + FP +L++    + KA  ++L+           K   E +K+A        L +L   L + +FF  NKPT +DA+++GYL P+L +    D L V +  C  ++  + ++   Y
Sbjct:    1 MELHIWPSDFGLPTIDVVSLQFLACSKMCASPVRVIQSTRPWRSPSGELPMVAQTEGEAKPVTDFEKFVDILKKCGQDVVIDADLTTIEKAQLDAFSCYLHHNLYPAVMHTFWTDELNYNTVTQYWYASHLHFPYNLYYLEKRRKKAL-RLLA----------GKNDTEILKEAFM-----ALNTLSTKLGDNKFFCGNKPTSLDALVFGYLAPLLRVPLPNDRLQVQLSACPNLVRFVETVSSIY 230          
BLAST of Metaxin 1 vs. Ensembl Celegans
Match: mtx-2 (Metaxin-2 homolog [Source:UniProtKB/Swiss-Prot;Acc:P34599])

HSP 1 Score: 59.6918 bits (143), Expect = 4.716e-10
Identity = 44/230 (19.13%), Postives = 100/230 (43.48%), Query Frame = 2
Query:  158 ESLAVITYVKIAQAPVNIFTNIRP---WSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHH 838
            + LAV T++++   P N+    RP   +  P   +P L+ +     G   I+ +  K+   +  +L++  +A +    S I   L     +++W H   Y+ VT+  +     +P+S     + + K   ++     + +T+           D +   A +   +L   L  +++   + PT  DA+L+G+++ ++ +   L  +   +K+ + ++E    I Q Y+  
Sbjct:   44 DCLAVQTFLRMTSLPFNV--RQRPNVDFISPDGVVPLLKINKTLITGFNAIVDFVHKKGVTLTSHLSETQVADMRANISMIEHLLTTVEKFVLWNHDETYDKVTKLRYGSVYHWPLSSVLPFVKRRKILEELSDKDWDTKTM-----------DEVGEQADKVFRALSAQLGSQKYLTGDLPTEADALLFGHMYTLITVRLPLTNITNILKKYSNLIEFTKRIEQQYFKQ 260          
BLAST of Metaxin 1 vs. Ensembl Celegans
Match: mtx-2 (Metaxin-2 homolog [Source:UniProtKB/Swiss-Prot;Acc:P34599])

HSP 1 Score: 59.6918 bits (143), Expect = 4.716e-10
Identity = 44/230 (19.13%), Postives = 100/230 (43.48%), Query Frame = 2
Query:  158 ESLAVITYVKIAQAPVNIFTNIRP---WSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHH 838
            + LAV T++++   P N+    RP   +  P   +P L+ +     G   I+ +  K+   +  +L++  +A +    S I   L     +++W H   Y+ VT+  +     +P+S     + + K   ++     + +T+           D +   A +   +L   L  +++   + PT  DA+L+G+++ ++ +   L  +   +K+ + ++E    I Q Y+  
Sbjct:   44 DCLAVQTFLRMTSLPFNV--RQRPNVDFISPDGVVPLLKINKTLITGFNAIVDFVHKKGVTLTSHLSETQVADMRANISMIEHLLTTVEKFVLWNHDETYDKVTKLRYGSVYHWPLSSVLPFVKRRKILEELSDKDWDTKTM-----------DEVGEQADKVFRALSAQLGSQKYLTGDLPTEADALLFGHMYTLITVRLPLTNITNILKKYSNLIEFTKRIEQQYFKQ 260          
BLAST of Metaxin 1 vs. Ensembl Fly
Match: CG9393 (gene:FBgn0037710 transcript:FBtr0332808)

HSP 1 Score: 68.9366 bits (167), Expect = 8.876e-13
Identity = 59/271 (21.77%), Postives = 115/271 (42.44%), Query Frame = 2
Query:  113 LYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSANENTLRGKVRVFL 925
            LYV+     L SID E L  +  ++  + P+++ T+  P    +  LP+LQ       G + I      E Y ++ +L+ +        ++ +  +L     Y ++    N+++ TR L+A+   FP + ++ +  + +A   ++     F   +K    E    D L   AK+ +  L   L  K +F  +  +  DA++Y YL  I  +    + L  H+K C  ++  +  I +  +     ++      +  S  E +L    R FL
Sbjct:    9 LYVYKGEYGLPSIDFECLRALCLLRFTRCPMDVQTSSNPLRSGAGKLPYLQIGNQKFAGYRQIKRVLDLEGYPIDAHLSTKQKHLSTAYANWVFTNLHAYYHYFLFGEPHNFDTTTRGLYAKRTPFPFNFYYPSSYQREACD-VVQVMAGFDVNDKLDKHE---GDYLVVNAKKVVNLLSRKLGRKVWFFGDTYSEFDAIVYSYLAIIFKIALPNNPLQNHIKGCQNLVNFINRITKDIFRIEGYSSVKLT--KTPSGTEASLTASERKFL 273          
BLAST of Metaxin 1 vs. Ensembl Fly
Match: CG9393 (gene:FBgn0037710 transcript:FBtr0082113)

HSP 1 Score: 68.1662 bits (165), Expect = 1.586e-12
Identity = 59/271 (21.77%), Postives = 115/271 (42.44%), Query Frame = 2
Query:  113 LYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSANENTLRGKVRVFL 925
            LYV+     L SID E L  +  ++  + P+++ T+  P    +  LP+LQ       G + I      E Y ++ +L+ +        ++ +  +L     Y ++    N+++ TR L+A+   FP + ++ +  + +A   ++     F   +K    E    D L   AK+ +  L   L  K +F  +  +  DA++Y YL  I  +    + L  H+K C  ++  +  I +  +     ++      +  S  E +L    R FL
Sbjct:    9 LYVYKGEYGLPSIDFECLRALCLLRFTRCPMDVQTSSNPLRSGAGKLPYLQIGNQKFAGYRQIKRVLDLEGYPIDAHLSTKQKHLSTAYANWVFTNLHAYYHYFLFGEPHNFDTTTRGLYAKRTPFPFNFYYPSSYQREACD-VVQVMAGFDVNDKLDKHE---GDYLVVNAKKVVNLLSRKLGRKVWFFGDTYSEFDAIVYSYLAIIFKIALPNNPLQNHIKGCQNLVNFINRITKDIFRIEGYSSVKLT--KTPSGTEASLTASERKFL 273          
BLAST of Metaxin 1 vs. Ensembl Zebrafish
Match: mtx1b (metaxin 1b [Source:ZFIN;Acc:ZDB-GENE-021210-1])

HSP 1 Score: 124.02 bits (310), Expect = 3.295e-32
Identity = 84/305 (27.54%), Postives = 143/305 (46.89%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGL-KHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSANENTLRGKVRVFLTENWIQIRNSSIFVLFVSTMMICYAKSTKVV 1018
            + L+ W     L S+D + LAV+ Y K A AP+ +     PW  P+ SLP L+     S+     II + RK+ Y  +Y+L+ ++ A      S + + L+PA+ Y +W  S NY  VTR  +AE + FP++    N M S+   K+   R +       +L +E  +DA       C+T L   L  ++FF  + P+ +DA ++ +L P+L +      L  H+   N + +   +I   Y+     ++   AP   +    ++       F  E  ++ RN  + VLF    M+ YA  T ++
Sbjct:    5 LELFCWKGDYGLPSVDVDCLAVLAYAKFAGAPIKVHKITNPWRSPTGSLPALKTREEGSISQPSKIIIHLRKQKYNADYDLSAKEGADTLAFVSLLEEKLLPALVYTLWIDSKNYVDVTRCWYAENIPFPLNFLLPNRMHSQQLEKLRLVRGDPVLEPGEQLEKELYRDAF-----ECMTLLSQRLGSQKFFFGDSPSSLDAYVFAHLAPLLKIKLPNGKLQQHLNSLNNLEQFCSNILLLYFP----SDQREAPARKIHVQSDS-----SDFDNEPHMR-RNQILSVLFAVGAMLGYAVLTGII 294          
BLAST of Metaxin 1 vs. Ensembl Zebrafish
Match: mtx1a (metaxin 1a [Source:ZFIN;Acc:ZDB-GENE-060606-2])

HSP 1 Score: 104.76 bits (260), Expect = 4.251e-25
Identity = 62/212 (29.25%), Postives = 104/212 (49.06%), Query Frame = 2
Query:  113 LYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGL-KHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHL 745
            L+ W     L S++ + L V+ Y + A AP+ I     PW  P+ SLP L+     S      II   RK+ +  +Y+L+ ++ A      S + + L+PA+ Y +W    NY  VTR  + E + FP++ F    M+++   ++   R N       +  EE  K+ LY+ A  CL  L   L   +FF  + P+ +DA ++G+L P+  +
Sbjct:    7 LFCWKAGLGLPSVNTDCLIVLAYARFAGAPLKIHKISNPWRSPTGSLPALRTKDEGSCSQPSQIIIQLRKQKFNADYDLSAKEGADTLAFISLLEERLLPALIYALWIDPKNYVEVTRRWYGENMSFPLNFFLPGRMQNRQLERLRLIRGN----GTLEAGEEAEKE-LYHDALECLNLLSQRLGSNKFFFGDSPSSLDAYVFGHLAPLFKI 213          
BLAST of Metaxin 1 vs. Ensembl Zebrafish
Match: mtx3 (metaxin 3 [Source:NCBI gene;Acc:402916])

HSP 1 Score: 93.9745 bits (232), Expect = 2.429e-21
Identity = 62/249 (24.90%), Postives = 116/249 (46.59%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTN 853
            + L  W     L S+  +SL V+ Y K A A + +      W   + S+P + +   +      I+ + RK+ +  ++ LT +  A      + + + L PA+ +  W  + NY ++TR  F     FP++ F      S A S+IL ++     +N   +TE  V+  +Y+ AK CL  L + L    FF  + PT +DA ++G++ P++        L  H+ Q + + +   +I ++Y+    + N
Sbjct:    5 IELLCWGGDWDLPSVQTDSLTVLAYAKFAGAELTVKFVDWTWRTITASVPQIHYEGTTVTEPTQILNFLRKQRFNADFELTAKQGADTMAYIALLEEKLRPALLHTFWVDAENYANLTRPWFTSHSPFPLNFFVPGRQASLALSRILLTKAESPLLN---ITE--VEGKIYSEAKECLNLLSHRLGNFNFFFGDTPTSLDAFVFGHIAPLIKAPLPSGQLQKHLNQLDNLCQFCNTILKNYFTDATVEN 248          
BLAST of Metaxin 1 vs. Ensembl Zebrafish
Match: mtx3 (metaxin 3 [Source:NCBI gene;Acc:402916])

HSP 1 Score: 93.9745 bits (232), Expect = 2.649e-21
Identity = 62/249 (24.90%), Postives = 116/249 (46.59%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTN 853
            + L  W     L S+  +SL V+ Y K A A + +      W   + S+P + +   +      I+ + RK+ +  ++ LT +  A      + + + L PA+ +  W  + NY ++TR  F     FP++ F      S A S+IL ++     +N   +TE  V+  +Y+ AK CL  L + L    FF  + PT +DA ++G++ P++        L  H+ Q + + +   +I ++Y+    + N
Sbjct:    9 IELLCWGGDWDLPSVQTDSLTVLAYAKFAGAELTVKFVDWTWRTITASVPQIHYEGTTVTEPTQILNFLRKQRFNADFELTAKQGADTMAYIALLEEKLRPALLHTFWVDAENYANLTRPWFTSHSPFPLNFFVPGRQASLALSRILLTKAESPLLN---ITE--VEGKIYSEAKECLNLLSHRLGNFNFFFGDTPTSLDAFVFGHIAPLIKAPLPSGQLQKHLNQLDNLCQFCNTILKNYFTDATVEN 252          
BLAST of Metaxin 1 vs. Ensembl Zebrafish
Match: mtx2 (metaxin 2 [Source:ZFIN;Acc:ZDB-GENE-021210-2])

HSP 1 Score: 61.2326 bits (147), Expect = 3.186e-10
Identity = 48/228 (21.05%), Postives = 97/228 (42.54%), Query Frame = 2
Query:  161 SLAVITYVKIAQAPVNIFTNIRP-WSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHR 841
            SLAV T++++   PV +       +  PS  +PF+Q        L  I+ + + + + +   L D   A++      ++  L+ A  Y+ W        ++R  ++    +P++          A  K    R     +  +  + E V    Y    +C  +L   L  + +F + +PT +DA+++G+L+ IL      D L+  VK  + ++     I Q+Y+  +
Sbjct:   41 SLAVQTFLRMCGLPVQVSCRANAEYMSPSGKVPFIQVGNQVVSELGPIVQFTKAKGHSLSDGLDDVQRAEMKAYMELVNNMLLTAELYIQWCDDFTATEISRPRYSSPYSWPLNHIL-------AYQKQWEVRRKMNAIGWSGKSLEQV----YEDVSQCCQALSQRLGTQPYFFNKQPTELDALVFGHLFTILTTQLTSDELVEKVKSYSNLLSFCHRIEQAYFKEQ 257          
BLAST of Metaxin 1 vs. Ensembl Xenopus
Match: MTX3 (metaxin 3 [Source:NCBI gene;Acc:100493350])

HSP 1 Score: 103.99 bits (258), Expect = 1.274e-24
Identity = 68/248 (27.42%), Postives = 114/248 (45.97%), Query Frame = 2
Query:  104 FMNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAK-----LTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYY 832
             M L  W     L S+ PE L V+ Y + A AP+ +      W+ P  ++P L  +        +I+ + RK+ Y  +Y L+ ++ +      + + + L+PAV +  W  + NY SVTR  +A    FP++ +    M   A ++IL        V K +     LTE  V+  LY  AK CL  +   L   ++F  + PT +DA ++G+L P+         L  H+KQ + +      I  +Y+
Sbjct:   23 MMELRCWGGDWGLPSVHPECLVVLAYARFAGAPLKVTPIDYTWASPKGTVPLLTSAGEDISQPANILNFLRKQKYNADYVLSAKEGSDTLAYIALLEEKLLPAVLHTFWVDTDNYCSVTRPWYASRTPFPLNYYLPGRMSRDALNRIL--------VTKGQPPLYCLTE--VEAQLYKDAKECLNLISNRLGTAQYFFGSTPTSLDAFVFGFLAPLYKAHLPKVNLQQHLKQLSNLCHFCDHILSTYF 260          
BLAST of Metaxin 1 vs. Ensembl Xenopus
Match: dcaf17 (DDB1 and CUL4 associated factor 17 [Source:Xenbase;Acc:XB-GENE-6043873])

HSP 1 Score: 55.0694 bits (131), Expect = 4.452e-8
Identity = 50/247 (20.24%), Postives = 107/247 (43.32%), Query Frame = 2
Query:  110 NLYVWPPLGA---LESIDPESLAVITYVKIAQAPVNIFTNIRP-WSCPSYSLPFLQHSLNSSVG-LKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYH 835
            N  ++ PL +   L S +   LAV  ++K+   PV +       +  PS  +PF+ H  N  +  L  I+ + + + + +   L +   A++      ++  L+ A  Y+ W   +    +T+  ++    +P++ F     K +   K+ +     +T+ +           ++    +C  +L   L  + +F + +PT +DA+++G+L+ IL      D L   VK  + ++     I Q Y+ 
Sbjct:   21 NAALYQPLKSEQVLLSDNASCLAVQAFLKMCNLPVQVVCRANAEYMSPSGKVPFI-HVGNQVISELGPIVQFVKAKGHSLSDGLDEVQRAEMKAYMELVNNMLLTAELYIQWCDEATLEEITQPRYSFPYSWPLNYFLVFQRKWEIKRKMKAIGWATKTLEQ-----------VFEDVDQCCQALSQRLGTQPYFFNKQPTELDALVFGHLFTILTTQLTNDELQEKVKNYSNLIAFCRRIEQHYFE 255          
BLAST of Metaxin 1 vs. Ensembl Mouse
Match: Mtx1 (metaxin 1 [Source:MGI Symbol;Acc:MGI:103025])

HSP 1 Score: 109.768 bits (273), Expect = 3.852e-26
Identity = 70/226 (30.97%), Postives = 109/226 (48.23%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKH-IIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVK 781
            M L+ W     L S+D +SLAV+TY +   AP+ I     PW  PS +LP L+ S    + + H II + RKE Y  +Y+L+    A      S + + L+P + +  W  + NY  VTR  +AEA+ FP++ F    M+ +        RL           EE ++  LY  A+ CLT L   L  ++FF  + P  +DA ++ +L  +L        L  H++
Sbjct:  149 MELFCWSGGWGLPSVDLDSLAVLTYTRFTGAPLKIHKTSNPWQSPSGTLPALRTSDGKVITVPHKIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLIHTFWIDAKNYVEVTRKWYAEAMPFPLNFFLPGRMQRQ-----YMERLQLLCGEHKSENEEELEKELYQEARECLTLLSQRLGSQKFFFGDAPASLDAFVFSHLALLLQAKLPSGKLQAHLR 369          
BLAST of Metaxin 1 vs. Ensembl Mouse
Match: Mtx3 (metaxin 3 [Source:MGI Symbol;Acc:MGI:2686040])

HSP 1 Score: 98.5969 bits (244), Expect = 5.427e-23
Identity = 71/265 (26.79%), Postives = 116/265 (43.77%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSANENTL 901
            M L  W     L S+  ESL V+ Y K + AP+ I      W      +P L    +       I+ + RK+ Y  +  L+ +  A      + + + L+PAV +  W  + NY +VT+  FA  + FP+SL     M   A ++IL +R      +  +     V+  +Y  A+ CL  L   L   +FF  + P+ +DA ++G+L P+  + +    L  H+KQ   +      I  SY+        + A  E+V AN   L
Sbjct:    5 MELSCWGGGWGLPSVHSESLVVLAYAKFSGAPLKINIIDNTWRGSRGDVPILTTEDSIVSKPAKILNFLRKQKYNADCELSAKQGADTLAYIALLEEKLLPAVLHTFWVENENYFTVTKPWFASRIPFPLSLILPGRMSRGALNRILLTRGEPPLYHVQE-----VEAQIYRDARECLNLLSNRLGTSQFFFGDTPSTLDAYVFGFLAPLYKVSFPKVHLQKHLKQLCNLCRFCDDILDSYFRP-GPGGVSPAGQEMVDANLQKL 263          
BLAST of Metaxin 1 vs. Ensembl Mouse
Match: Mtx1 (metaxin 1 [Source:MGI Symbol;Acc:MGI:103025])

HSP 1 Score: 98.2117 bits (243), Expect = 6.855e-23
Identity = 79/291 (27.15%), Postives = 127/291 (43.64%), Query Frame = 2
Query:  149 IDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKH-IIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSANENTLRGKVRVFLTENWIQIRNSSIFVLFVSTMMICYAKSTKVV 1018
            +D +SLAV+TY +   AP+ I     PW  PS +LP L+ S    + + H II + RKE Y  +Y+L+    A      S + + L+P + +  W  + NY  VTR  +AEA+ FP++ F    M+ +        RL           EE ++  LY  A+ CLT L   L  ++FF  + P  +DA ++ +L  +L        L  H++  + +      I   Y+       P   P +  +A E            E   + R   + VL     M+ YA  + +V
Sbjct:    2 VDLDSLAVLTYTRFTGAPLKIHKTSNPWQSPSGTLPALRTSDGKVITVPHKIITHLRKE-YNADYDLSARQGADTLAFMSLLEEKLLPVLIHTFWIDAKNYVEVTRKWYAEAMPFPLNFFLPGRMQRQ-----YMERLQLLCGEHKSENEEELEKELYQEARECLTLLSQRLGSQKFFFGDAPASLDAFVFSHLALLLQAKLPSGKLQAHLRGLHNLCAYCTHILNLYFPRDGDEVP--LPRQTPAAPET----------EEEPYRRRTQILSVLAGLAAMVGYALLSGIV 274          
BLAST of Metaxin 1 vs. Ensembl Mouse
Match: Mtx1 (metaxin 1 [Source:MGI Symbol;Acc:MGI:103025])

HSP 1 Score: 93.2041 bits (230), Expect = 3.758e-22
Identity = 49/147 (33.33%), Postives = 77/147 (52.38%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKH-IIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKI 544
            M L+ W     L S+D +SLAV+TY +   AP+ I     PW  PS +LP L+ S    + + H II + RKE Y  +Y+L+    A      S + + L+P + +  W  + NY  VTR  +AEA+ FP++ F    M+ +   ++
Sbjct:   12 MELFCWSGGWGLPSVDLDSLAVLTYTRFTGAPLKIHKTSNPWQSPSGTLPALRTSDGKVITVPHKIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLIHTFWIDAKNYVEVTRKWYAEAMPFPLNFFLPGRMQRQYMERL 158          
BLAST of Metaxin 1 vs. Ensembl Mouse
Match: Mtx1 (metaxin 1 [Source:MGI Symbol;Acc:MGI:103025])

HSP 1 Score: 91.6633 bits (226), Expect = 3.277e-20
Identity = 84/343 (24.49%), Postives = 133/343 (38.78%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSY--------------------------------------SLPFLQHSLNSSVGLKH-IIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSANENTLRGKVRVFLTENWIQIRNSSIFVLFVSTMMICYAKSTKVV 1018
            M L+ W     L S+D +SLAV+TY +   AP+ I     PW  PS                                       +LP L+ S    + + H II + RKE Y  +Y+L+    A      S + + L+P + +  W  + NY  VTR  +AEA+ FP++ F    M+ +        RL           EE ++  LY  A+ CLT L   L  ++FF  + P  +DA ++ +L  +L        L  H++  + +      I   Y+       P   P +  +A E            E   + R   + VL     M+ YA  + +V
Sbjct:   10 MELFCWSGGWGLPSVDLDSLAVLTYTRFTGAPLKIHKTSNPWQSPSGIPEGQECARGGAGDRNAMQMSMTRQAGPCEYTSFSISGTLPALRTSDGKVITVPHKIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLIHTFWIDAKNYVEVTRKWYAEAMPFPLNFFLPGRMQRQ-----YMERLQLLCGEHKSENEEELEKELYQEARECLTLLSQRLGSQKFFFGDAPASLDAFVFSHLALLLQAKLPSGKLQAHLRGLHNLCAYCTHILNLYFPRDGDEVP--LPRQTPAAPET----------EEEPYRRRTQILSVLAGLAAMVGYALLSGIV 335          
BLAST of Metaxin 1 vs. UniProt/SwissProt
Match: sp|Q27HK4|MTX1_PIG (Metaxin-1 OS=Sus scrofa OX=9823 GN=MTX1 PE=2 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 5.852e-28
Identity = 75/241 (31.12%), Postives = 112/241 (46.47%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKH-IIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYL-------WPILHLDYELDGLIVHVKQCNKIMEL 805
            M L+ W     L S+D +SLAV+TY +   AP+ +     PW  PS +LP L+ S    + + H II + RKE Y  +Y+L+    A      S + + L+P + +  W  + NY  VTR  +AEA+ FP++ F    M+ +        RL           EE ++  LY  A+ CLT L   L  ++FF  + P  +DA ++ YL        P   L   L GL      C  I+ L
Sbjct:    5 MELFCWSGGWGLPSVDLDSLAVLTYARFTGAPLKVHKITNPWRSPSGTLPALRTSQGEVISVPHKIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLIHTFWVDAKNYVEVTRKWYAEAMPFPLNFFLPGRMQRQ-----YMERLQLLCGEHRPEEEEELEKELYQEARECLTLLSQRLGAQKFFFGDAPASLDAFVFSYLALLQQAKLPSGKLQAHLRGLHNLCAYCTHILSL 240          
BLAST of Metaxin 1 vs. UniProt/SwissProt
Match: sp|Q2TBS1|MTX1_BOVIN (Metaxin-1 OS=Bos taurus OX=9913 GN=MTX1 PE=2 SV=1)

HSP 1 Score: 112.849 bits (281), Expect = 2.832e-27
Identity = 85/305 (27.87%), Postives = 131/305 (42.95%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKH-IIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSANENTLRGKVRVFLTENWIQIRNSSIFVLFVSTMMICYAKSTKVV 1018
            M L+ W     L S+D +SLAV+TY +   AP+ +     PW  PS +LP L+ S    + + H II + RKE Y  +Y+L+    A      S + + L+P + +  W  + NY  VTR  +AEA+ FP++ F    M+ +        RL           EE ++  LY  A+ CLT L   L  ++FF  + P  +DA ++ YL  +         L  H++  + +      I   Y+       P   P     AN  T          E   + RN  + VL     M  YA  + +V
Sbjct:    5 MELFCWSGGWGLPSVDLDSLAVLTYARFTGAPLKVHKITNPWRSPSGTLPALRTSHGEVISVPHRIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLKHTFWIDAKNYVEVTRKWYAEAMPFPLNFFLPGRMQRQ-----YMERLQLLCGEHRPEDEEELEKELYQEAQECLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLQQAKLPSGKLQAHLRGLHNLCAYCAHILSLYFPWEGAKAP---PPRQTPANPET---------EEEPYRRRNQILTVLAGLAAMAGYALLSGIV 292          
BLAST of Metaxin 1 vs. UniProt/SwissProt
Match: sp|Q13505|MTX1_HUMAN (Metaxin-1 OS=Homo sapiens OX=9606 GN=MTX1 PE=1 SV=3)

HSP 1 Score: 114.775 bits (286), Expect = 4.094e-27
Identity = 87/305 (28.52%), Postives = 134/305 (43.93%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKH-IIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSANENTLRGKVRVFLTENWIQIRNSSIFVLFVSTMMICYAKSTKVV 1018
            M L+ W     L S+D +SLAV+TY +   AP+ +     PW  PS +LP L+ S    + + H II + RKE Y  +Y+L+    A      S + + L+P + +  W  + NY  VTR  +AEA+ FP++ F    M+ +        RL   T       EE ++  LY  A+ CLT L   L  ++FF  + P  +DA ++ YL  +L        L VH++  + +      I   Y+       P   P     A   T          E   + RN  + VL     M+ YA  + +V
Sbjct:  154 MELFCWSGGWGLPSVDLDSLAVLTYARFTGAPLKVHKISNPWQSPSGTLPALRTSHGEVISVPHKIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLVHTFWIDTKNYVEVTRKWYAEAMPFPLNFFLPGRMQRQ-----YMERLQLLTGEHRPEDEEELEKELYREARECLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLPSGKLQVHLRGLHNLCAYCTHILSLYFPWDGAEVP---PQRQTPAGPET---------EEEPYRRRNQILSVLAGLAAMVGYALLSGIV 441          
BLAST of Metaxin 1 vs. UniProt/SwissProt
Match: sp|Q4R3I0|MTX1_MACFA (Metaxin-1 OS=Macaca fascicularis OX=9541 GN=MTX1 PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 4.754e-27
Identity = 84/305 (27.54%), Postives = 134/305 (43.93%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKH-IIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSANENTLRGKVRVFLTENWIQIRNSSIFVLFVSTMMICYAKSTKVV 1018
            M L+ W     L S+D +SLAV+TY +   AP+ +     PW  PS +LP L+ S    + + H II + RKE Y  +Y+L+    A      S + + L+P + +  W  + NY  VTR  +AEA+ FP++ F    M+ +        RL   +       EE ++  LY  A+ CLT L   L  ++FF  + P  +DA ++ YL  +L        L  H++  + +      I   Y+       P   P +  +  E            E   + RN  + VL     M+ YA  + +V
Sbjct:    5 MELFCWSGGWGLPSVDLDSLAVLTYARFTGAPLKVHKISNPWRSPSGTLPALRTSHGEVISVPHKIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLVHTFWIDTKNYVEVTRKWYAEAMPFPLNFFLPGRMQRQYM-----ERLELLSGEHMPEDEEELEKELYREARECLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLPSGKLQAHLRGLHNLCAYCTHILSLYFPWDGAEVP--PPRQTPAGPET----------EEEPYRRRNQILSVLAGLAAMVGYALLSGIV 292          
BLAST of Metaxin 1 vs. UniProt/SwissProt
Match: sp|P47802|MTX1_MOUSE (Metaxin-1 OS=Mus musculus OX=10090 GN=Mtx1 PE=1 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.931e-25
Identity = 71/243 (29.22%), Postives = 113/243 (46.50%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGL-KHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYY 832
            M L+ W     L S+D +SLAV+TY +   AP+ I     PW  PS +LP L+ S    + +   II + RKE Y  +Y+L+    A      S + + L+P + +  W  + NY  VTR  +AEA+ FP++ F    M+ +        RL           EE ++  LY  A+ CLT L   L  ++FF  + P  +DA ++ +L  +L        L  H++  + +      I   Y+
Sbjct:    5 MELFCWSGGWGLPSVDLDSLAVLTYTRFTGAPLKIHKTSNPWQSPSGTLPALRTSDGKVITVPDKIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLIHTFWIDAKNYVEVTRKWYAEAMPFPLNFFLPGRMQRQ-----YMERLQLLCGEHKSENEEELEKELYQEARECLTLLSQRLGSQKFFFGDAPASLDAFVFSHLALLLQAKLPSGKLQAHLRGLHNLCAYCTHILNLYF 242          
BLAST of Metaxin 1 vs. TrEMBL
Match: A0A087VYH0 (Metaxin 1 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000092500 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 4.367e-43
Identity = 89/256 (34.77%), Postives = 137/256 (53.52%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYE--------LDGLIVHVKQCNKIMELLVSIHQSYYHHRALT 850
            M+LYVWP    +ES D + L VITY+++ + P+N+ +         Y  P L H  N   G+  II Y RKENYG+EY L+DE+LA L  L +++ + + PA  +L+W  +S Y+S T  L+   + +   L++    + K       S+L+  T    K     V+  LY    RCLT+L YIL++K+FF  +KP+ +DA L+G LWP+L+ D             LI HV QC  +++L   + +  +   A T
Sbjct:    1 MDLYVWPDGRGIESFDSDCLVVITYLRLGKCPINLKSCRNSDKSCFYRTPLLIHGSNEVTGVSKIIAYLRKENYGLEYELSDEELACLESLVTSLERRVTPACRWLIWADTSVYHSYTSLLYRSNLSYLQGLWYPRRWRDKLIQSAEFSQLSLCTNGNTKNRYGDVEVTLYEGVIRCLTALSYILSDKQFFFGDKPSAIDAYLFGRLWPLLNYDCMRRQQESKICHRLINHVYQCENLLQLCCRVQRLCFPSAAST 256          
BLAST of Metaxin 1 vs. TrEMBL
Match: A0A068X4V1 (Metaxin 1 OS=Echinococcus granulosus OX=6210 GN=EgrG_000092500 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 4.531e-43
Identity = 87/247 (35.22%), Postives = 133/247 (53.85%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYE--------LDGLIVHVKQCNKIMELLVSIHQ 823
            M+LYVWP    +ES D + L VITY+++   P+N+ +         Y  P L H  N   G+  II Y RKENYG+EY L+DE+LA+L  L +++ + + PA  +L+W  +S Y+S T  L+   + +   L++    + K       S+L   T    K     V+  LY    RCLT+L YIL++K+FF  +KP+ +DA L+G LWP+L+ D             LI HV QC  +++L   + +
Sbjct:    1 MDLYVWPDGRGIESFDSDCLVVITYLRLGGCPINLKSCRNSDKSYFYRTPLLIHGSNEVTGVSKIIEYLRKENYGLEYELSDEELARLESLVTSLERRVTPACRWLIWADTSVYHSYTSLLYRSNLSYLQGLWYPRRWRDKLIQSAEFSQLTLCTNGNTKNRYRDVELTLYEGVIRCLTALSYILSDKQFFFGDKPSAIDAYLFGRLWPLLNYDCMRRQQESKICHRLINHVYQCENLLQLCCRVQR 247          
BLAST of Metaxin 1 vs. TrEMBL
Match: W6U974 (Metaxin-3 OS=Echinococcus granulosus OX=6210 GN=EGR_10109 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 4.749e-43
Identity = 87/247 (35.22%), Postives = 133/247 (53.85%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYE--------LDGLIVHVKQCNKIMELLVSIHQ 823
            M+LYVWP    +ES D + L VITY+++   P+N+ +         Y  P L H  N   G+  II Y RKENYG+EY L+DE+LA+L  L +++ + + PA  +L+W  +S Y+S T  L+   + +   L++    + K       S+L   T    K     V+  LY    RCLT+L YIL++K+FF  +KP+ +DA L+G LWP+L+ D             LI HV QC  +++L   + +
Sbjct:    1 MDLYVWPDGRGIESFDSDCLVVITYLRLGGCPINLKSCRNSDKSYFYRTPLLIHGSNEVTGVSKIIEYLRKENYGLEYELSDEELARLESLVTSLERRVTPACRWLIWADTSVYHSYTSLLYRSNLSYLQGLWYPRRWRDKLIQSAEFSQLTLCTNGNTKNRYRDVELTLYEGVIRCLTALSYILSDKQFFFGDKPSAIDAYLFGRLWPLLNYDCMRRQQESKICHRLINHVYQCENLLQLCCRVQR 247          
BLAST of Metaxin 1 vs. TrEMBL
Match: A0A5K3F6V5 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 4.716e-41
Identity = 84/272 (30.88%), Postives = 150/272 (55.15%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDY-------ELDGLIVHVKQCNKIMELLVSIHQSYYHHRA---LTNPNRAPNEIVSANE 892
            M+L++WP    ++S D + L +ITY+++ + P+N+F++  P      S+P L H  N    +  II Y RKENYG+EY L+DE+LA+L  L +++ + + PA  +L+W  ++ YNS T  L+   + +   L+     + +       S+L+  + + +K   + V+ +L+  A+RCLT+L Y+L +K FF   +P+ +DA ++G LWP+L+ D         +  LI HV QC  +  L   + +  +   A   LT+P     E+ + ++
Sbjct:    1 MDLHIWPGSSGIDSFDSDCLVIITYLRLGKCPINLFSS-PPQKSDMNSIPLLVHGSNEVTTVHKIIEYLRKENYGLEYELSDEELARLDSLVTSLERRITPAFRWLLWADTNVYNSYTSLLYRSKLPYFYGLWLLRCWRKRIIENTEFSQLSLCSKSNSKNRYKEVESSLFEGARRCLTALSYVLGKKPFFFGERPSAIDAYVFGRLWPLLNYDRLCRKQNSNIHRLISHVYQCENLFLLCRRVQRLCFPSGADSFLTSPASDLREVQATDK 271          
BLAST of Metaxin 1 vs. TrEMBL
Match: A0A0R3WJH1 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS820 PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 8.336e-41
Identity = 83/247 (33.60%), Postives = 133/247 (53.85%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDG--------LIVHVKQCNKIMELLVSIHQ 823
            M+LYVWP    +ES D + L VITY+++    +N+ +         +++P L H  N+   +  II Y RKENYG+EY L+DE+LA+L  L +++ + + PA  +L+W  S+ Y S T + +   + +   L++    + K       S+L   T   AK     V+  LY  A RCLT+L YIL +K+FF  +KP+ +DA ++G LWP+L+ D             LI H+ QC  ++ L   + +
Sbjct:    1 MDLYVWPCSEGIESFDSDCLVVITYLRLGGCLINLNSCRDCDKSDFHNIPLLVHGSNTVTTVSKIINYLRKENYGLEYELSDEELARLESLVTSVERRVTPACRWLIWADSNVYRSYTSAFYRSNLSYLQGLWYPRRWRDKLVEAAEFSQLALCTNRDAKGRRRNVEMTLYEGAIRCLTALSYILGDKQFFFGDKPSAIDAYVFGRLWPLLNYDRLCRQQESKICHRLISHIYQCENLLNLCGRVQR 247          
BLAST of Metaxin 1 vs. Ensembl Cavefish
Match: mtx1b (metaxin-1-like [Source:NCBI gene;Acc:103026555])

HSP 1 Score: 117.472 bits (293), Expect = 7.468e-30
Identity = 80/305 (26.23%), Postives = 132/305 (43.28%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGL-KHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSANENTLRGKVRVFLTENWIQIRNSSIFVLFVSTMMICYAKSTKVV 1018
            M LY W     L S+D + L V+ Y K A AP+ +     PW  P+  LP L+     S      II   RK+ Y  +Y+L+ ++ A      S + + L+PA+ Y  W  + NY   TR  +AE + FP++    N M  +   ++   R +       +L +E  +DAL      C+T L   L   +FF  + P+ +DA ++G+L PIL +    + L  H+     + +   +I   Y+   +   P R  +      +       R          RN  + VLF    M+ YA  + ++
Sbjct:    5 MELYCWRGDHGLPSVDVDCLTVLAYAKFAGAPLKVHKITNPWRSPTGILPALKTREEGSFSQPSKIIIQLRKQKYNADYDLSAKEGADTLAFVSLLEEKLLPALIYTQWVDAKNYVDATRRWYAENIPFPLNFLLPNRMHGRQLERLRLVRGDPALEPGEQLEKELYQDAL-----ECMTLLSQRLGSHKFFFGDSPSSLDAYVFGHLAPILKIKLPNNKLQQHINSLENLRQFCNNILVLYFPSESRELPTRKVSPQAEGGDFDNEPHKR----------RNQILSVLFAVGAMLGYAVLSGII 294          
BLAST of Metaxin 1 vs. Ensembl Cavefish
Match: mtx1a (metaxin-1-like [Source:NCBI gene;Acc:103044318])

HSP 1 Score: 114.005 bits (284), Expect = 1.266e-28
Identity = 82/303 (27.06%), Postives = 135/303 (44.55%), Query Frame = 2
Query:  113 LYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKH-IIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSANENTLRGKVRVFLTENWIQIRNSSIFVLFVSTMMICYAKSTKVV 1018
            L+ W     L S+DP+SL V+ Y + A AP+ I     PW  P+  LP L+     S    + II   RK+ Y  +Y+L+ ++ A      S + + L+PA+ Y +W    NY  VTR   A+ + FP++ F  + M+ +        R+     N+A    E  +  L + A  C+  L   L   +FF  + P+ +DA ++G+L P+L +      L  H+K    +     +I   Y+       PN +   +     +T  G    F  E + + R   + VL     M+ YA  T +V
Sbjct:    7 LFCWKGGWGLPSVDPDSLIVLAYARFAGAPLKIHKISNPWRSPTGCLPALKTKDEGSFSQPNKIIIQLRKQKYNADYDLSAKEGADTLAFISLLQEMLMPALIYTLWVDPKNYVEVTRRWHADNISFPLNFFLPSRMQRQQL-----ERVQLMRGNRALEAGEEAEKELNHDALECMNLLSQRLGSNKFFFGDSPSSLDAYVFGHLAPLLKIKLPSSSLQQHLKSLENLDSFCCNILSLYF-------PNESREGVGRPVSSTPEGS--EFDNEPY-KRRKQLLSVLVAVAAMLSYALLTGIV 294          
BLAST of Metaxin 1 vs. Ensembl Cavefish
Match: mtx1a (metaxin-1-like [Source:NCBI gene;Acc:103044318])

HSP 1 Score: 113.62 bits (283), Expect = 3.445e-28
Identity = 82/304 (26.97%), Postives = 135/304 (44.41%), Query Frame = 2
Query:  110 NLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKH-IIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSANENTLRGKVRVFLTENWIQIRNSSIFVLFVSTMMICYAKSTKVV 1018
             L+ W     L S+DP+SL V+ Y + A AP+ I     PW  P+  LP L+     S    + II   RK+ Y  +Y+L+ ++ A      S + + L+PA+ Y +W    NY  VTR   A+ + FP++ F  + M+ +        R+     N+A    E  +  L + A  C+  L   L   +FF  + P+ +DA ++G+L P+L +      L  H+K    +     +I   Y+       PN +   +     +T  G    F  E + + R   + VL     M+ YA  T +V
Sbjct:   46 ELFCWKGGWGLPSVDPDSLIVLAYARFAGAPLKIHKISNPWRSPTGCLPALKTKDEGSFSQPNKIIIQLRKQKYNADYDLSAKEGADTLAFISLLQEMLMPALIYTLWVDPKNYVEVTRRWHADNISFPLNFFLPSRMQRQQL-----ERVQLMRGNRALEAGEEAEKELNHDALECMNLLSQRLGSNKFFFGDSPSSLDAYVFGHLAPLLKIKLPSSSLQQHLKSLENLDSFCCNILSLYF-------PNESREGVGRPVSSTPEGS--EFDNEPY-KRRKQLLSVLVAVAAMLSYALLTGIV 334          
BLAST of Metaxin 1 vs. Ensembl Cavefish
Match: mtx3 (metaxin 3 [Source:NCBI gene;Acc:103040731])

HSP 1 Score: 97.4413 bits (241), Expect = 1.090e-22
Identity = 75/261 (28.74%), Postives = 119/261 (45.59%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSAN 889
            M L  W     L S+  ESL V+ Y K A A + +      W   + S+P L    +S+     I+   RK  +  +Y L+ +  A      + + + L PA+ +  W  + NY ++TR  FA    FP++ F      S A S+IL   L         +TE  V+  +Y+ AK CL  L + L    +F  N PT +DA ++GYL P+         L  H+KQ + + +   SI ++Y+   A +  + A  + V AN
Sbjct:    5 MELLCWGGDWDLPSVHTESLIVLAYAKFAGASLTVKPVDWTWRTITASIPQLYCEGSSATEPAQILNLLRKNRFNADYELSAKQGADTMAYIALLEEKLRPALLHTFWVDAENYANLTRPWFASHSPFPLNFFVPARQASLALSRIL---LTKAEAPLHSITE--VEGKIYSEAKECLNLLSHRLGISHYFFGNMPTSLDAFVFGYLAPLHKASLPSGQLQQHLKQLHNLCQFCSSILKNYF-TEAGSGSSPASQDAVDAN 259          
BLAST of Metaxin 1 vs. Ensembl Cavefish
Match: mtx1a (metaxin-1-like [Source:NCBI gene;Acc:103044318])

HSP 1 Score: 80.4925 bits (197), Expect = 8.234e-17
Identity = 61/240 (25.42%), Postives = 105/240 (43.75%), Query Frame = 2
Query:  299 IIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSANENTLRGKVRVFLTENWIQIRNSSIFVLFVSTMMICYAKSTKVV 1018
            II   RK+ Y  +Y+L+ ++ A      S + + L+PA+ Y +W    NY  VTR   A+ + FP++ F  + M+ +        R+     N+A    E  +  L + A  C+  L   L   +FF  + P+ +DA ++G+L P+L +      L  H+K    +     +I   Y+       PN +   +     +T  G    F  E + + R   + VL     M+ YA  T +V
Sbjct:   42 IIIQLRKQKYNADYDLSAKEGADTLAFISLLQEMLMPALIYTLWVDPKNYVEVTRRWHADNISFPLNFFLPSRMQRQQL-----ERVQLMRGNRALEAGEEAEKELNHDALECMNLLSQRLGSNKFFFGDSPSSLDAYVFGHLAPLLKIKLPSSSLQQHLKSLENLDSFCCNILSLYF-------PNESREGVGRPVSSTPEGS--EFDNEPYKR-RKQLLSVLVAVAAMLSYALLTGIV 266          
BLAST of Metaxin 1 vs. Ensembl Sea Lamprey
Match: mtx3 (metaxin 3 [Source:NCBI gene;Acc:402916])

HSP 1 Score: 93.2041 bits (230), Expect = 8.803e-22
Identity = 66/249 (26.51%), Postives = 108/249 (43.37%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTN 853
            M L  W     L S+D   L V+ Y   + APV +     P    +  LP L+    +     +I+  FRKE Y  +Y+L+ +  A      + I + L PA+ +  W    NY  VTR  +A  + FP      N++    +S+   +RL         ++   ++  +Y  AK CL  L + L EK FF    P+ +DAV++G+L P+L        L +H+K    +      +    +  +A  N
Sbjct:    6 MELLCWRGDWGLPSVDSGCLIVMAYAHFSNAPVKLKKTGNPRESLTGCLPILKSGEKTISKPLNILNCFRKEQYNADYDLSPKQGADTMAFVALIEEKLFPALLHTFWVDDQNYTGVTRPWYASTMPFPF-----NMLAPYRSSRQALTRLKLSVGRPPYMSLAEMEAQIYWDAKECLNLLSFQLGEKAFFFGEMPSSLDAVVFGHLAPLLKAPLLTKKLQLHLKAIENLCAFCERVLMRCFPGQAPVN 249          
BLAST of Metaxin 1 vs. Ensembl Sea Lamprey
Match: mtx2 (metaxin 2 [Source:ZFIN;Acc:ZDB-GENE-021210-2])

HSP 1 Score: 56.6102 bits (135), Expect = 1.592e-9
Identity = 46/228 (20.18%), Postives = 102/228 (44.74%), Query Frame = 2
Query:  164 LAVITYVKIAQAPVNIFTNIRPWS---CPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHH 838
            LAV  ++++   PV +    RP +    PS  +PF+    +    L  I+ + + + + +  +L ++  A++      ++  L+ A  Y++W   +    ++R  +     +P++       +  A  K    R   + ++ A  T E V D +     +CL +L   L  + +F   +PT +DA+++G+L+ +L  +   D L   V+    + +L   + + Y+  
Sbjct:   41 LAVQAFLRMCSLPVYVV--YRPNAEQMSPSGKVPFIHVGNHVVSELGPIVQFVKAKGHCLSSSLDEQQKAEMKAYMELVNNVLLTAELYILWCDDTTCKEISRPRYGSPYPWPLN-------RLLAYQKQWEVRRKMKALSWASKTPEQVHDEV----NQCLRALSLRLGSQSYFFGRQPTELDALVFGHLFTLLTTELSSDTLPELVRAYPNLADLCQRVERQYFRE 255          
BLAST of Metaxin 1 vs. Ensembl Nematostella
Match: EDO33160 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST15])

HSP 1 Score: 100.523 bits (249), Expect = 4.147e-24
Identity = 58/209 (27.75%), Postives = 103/209 (49.28%), Query Frame = 2
Query:  101 NFMNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYL 727
            + + L+ WP    L S+D   LAV++YVK A  P+ +  + + W  P++  P ++           I+ + R++N+  +Y LT +  A      + I   L+PA+ Y +W  S NY   TR ++A  +  P++ F    +   A  K L  R+  +   + +     +++ L+  A  CLT L  +L +K+FF    PT +DAV + +L
Sbjct:    3 DVLELFSWPGDFGLPSVDIPCLAVLSYVKFAGCPLKVNRSNKFWKSPTWEFPVMKSGEEVLTSPYKIMDHLRQKNFNADYQLTAKQGADTLAFIALIEDKLLPAMHYTLWVDSKNYVEFTRPMYARKLPLPLNFFVPGRI---ANQKKL--RIGHKLDPEEEEANGELENMLFKEAIECLTHLSVLLGDKDFFFGESPTTLDAVAFAHL 206          
BLAST of Metaxin 1 vs. Ensembl Nematostella
Match: EDO34336 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPN8])

HSP 1 Score: 49.2914 bits (116), Expect = 7.187e-7
Identity = 49/225 (21.78%), Postives = 98/225 (43.56%), Query Frame = 2
Query:  167 AVITYVKIAQAPVNI--FTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSL-FWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYY 832
            ++I ++K  Q P ++    N    S P+  +P L+   +   G + I      +   V  +    D A++    S I++ ++P   Y++W         T    ++   FP+ L +  +  K  A  + L + LN+Q   +A + EEF         ++   +L   L   ++FI  +PT VDA+ +G++  IL      D L+  V +   + + ++ I   ++
Sbjct:   31 SLIAFLKFCQLPYDLKCVKNAESMS-PTGEVPLLRAGKDLVGGPQDIFSLVNHKGLSVSQDFEARDKAEMKAYISLINRSILPTELYMLWCKPGWQIRTTHQYGSQ---FPVPLNYILSYRKQWAAHRSLHA-LNWQRKKEAGVVEEF---------EKACQALAEKLGTNQYFIQGRPTEVDALAFGHINSILSRYQPDDTLVAIVHKHRNLEDFVMRILNDFF 241          
BLAST of Metaxin 1 vs. Ensembl Nematostella
Match: EDO43101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZI7])

HSP 1 Score: 48.521 bits (114), Expect = 1.067e-6
Identity = 47/209 (22.49%), Postives = 88/209 (42.11%), Query Frame = 2
Query:  113 LYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKE-NYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNK---AKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYL 727
            L+  PP   +    P SL + TY+++ + P   F   +  S     +PF+++  +        I Y  K+ N   + +L+ E  A  H + +   ++   ++ Y  W    NY    +             ++SNL       K L  +L+     K   A    +  K+ +Y  A+  L ++  +L EKEFF+ ++P  +D  ++G L
Sbjct:    3 LHQHPPGPTIPGFLPNSLKLETYLRMVKIPYENFYESKLGSSKE-KVPFIEYQGDKVQDTNFCIKYLNKKFNVDPDAHLSAEQKAMCHAIQAMAEENTYWSLAYYRW--VDNYQETKK-------------YYSNLA---PVYKDLRPKLDQNKCIKCMQAHGIGKHTKEEIYAIAEEDLRAMSALLGEKEFFMDSEPCTLDCTMFGLL 192          
BLAST of Metaxin 1 vs. Ensembl Nematostella
Match: EDO27861 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T835])

HSP 1 Score: 46.9802 bits (110), Expect = 4.264e-6
Identity = 21/69 (30.43%), Postives = 37/69 (53.62%), Query Frame = 2
Query:  299 IIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLF 505
            I+ + R++N+  +Y LT +  A      + I   L+PA+ Y +W  S NY   TR ++A  +  P++ F
Sbjct:   19 IMDHLRQKNFNADYQLTAKQGADTLAFIALIEDKLLPAMHYTLWVDSKNYVEFTRPMYARKLPLPLNFF 87          
BLAST of Metaxin 1 vs. Ensembl Medaka
Match: mtx1a (metaxin-1 [Source:NCBI gene;Acc:101163689])

HSP 1 Score: 114.39 bits (285), Expect = 8.513e-29
Identity = 73/242 (30.17%), Postives = 116/242 (47.93%), Query Frame = 2
Query:  110 NLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVG-LKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYY 832
             L+ W     L S+  + L V+ Y + A AP+ +     PW  PS SLP  + S   ++     II + RK+ +  +Y+L+ ++ A      S + + L PA+ Y  W    NY  VTR  FAE + FP++ F    M+S+   K+   RL  Q   + +  EE  K+ LY  A  CL  L   L  ++FF  + P+ +DA ++G+L PIL        L  H+K  + +     +I   Y+
Sbjct:    6 ELFCWEGDWGLPSVSTDCLVVLAYAQFAGAPLKVRKICNPWRSPSGSLPAFRTSQKETLSRTSDIIIHLRKQKFNADYDLSAKEGADSLAFISLMDEKLKPALIYTFWIEPKNYVDVTRRWFAEHMPFPLNFFLPGRMQSQQLEKL---RL-LQGDERLEAGEELEKE-LYRDATECLNLLSQRLGSQKFFFGDSPSSLDAYVFGHLAPILRCKLPNGKLQQHLKSLDNLANFCSNILLLYF 242          
BLAST of Metaxin 1 vs. Ensembl Medaka
Match: mtx3 (metaxin 3 [Source:NCBI gene;Acc:101155695])

HSP 1 Score: 78.1814 bits (191), Expect = 6.914e-16
Identity = 50/180 (27.78%), Postives = 84/180 (46.67%), Query Frame = 2
Query:  296 HIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQ-------CNKIMELLVS 814
             I+ + RK+ +  +Y LT    A      + + + L PA+ +  W  + NY S+TR  FA    FP++    + +   A S+IL   L        +++E  ++  +Y+ AK CL  L Y L     F  N PT +DA ++G++ P+         L  H+KQ       C+ I+E+  S
Sbjct:   60 QILSFMRKQRFNADYELTARQGADTMAYIALLEEKLRPALLHTFWVDTENYTSLTRPWFASRSPFPLNFIVPSRLARMALSRIL---LTKGEAPLHRISE--IEGKIYSDAKECLNLLSYRLGTANHFFGNSPTSLDAFVFGFVAPLHRASLPSSHLQSHLKQLENLTHFCDNILEVYFS 234          
BLAST of Metaxin 1 vs. Ensembl Medaka
Match: mtx3 (metaxin 3 [Source:NCBI gene;Acc:101155695])

HSP 1 Score: 76.6406 bits (187), Expect = 8.809e-16
Identity = 51/181 (28.18%), Postives = 83/181 (45.86%), Query Frame = 2
Query:  296 HIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKD-ALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQ-------CNKIMELLVS 814
             I+ + RK+ +  +Y LT    A      + + + L PA+ +  W  + NY S+TR  FA    FP++    + +   A S+IL       T  +  L+   V+   +Y+ AK CL  L Y L     F  N PT +DA ++G++ P+         L  H+KQ       C+ I+E+  S
Sbjct:    7 QILSFMRKQRFNADYELTARQGADTMAYIALLEEKLRPALLHTFWVDTENYTSLTRPWFASRSPFPLNFIVPSRLARMALSRIL------LTKGECGLSTLPVRHLRIYSDAKECLNLLSYRLGTANHFFGNSPTSLDAFVFGFVAPLHRASLPSSHLQSHLKQLENLTHFCDNILEVYFS 181          
BLAST of Metaxin 1 vs. Ensembl Medaka
Match: mtx2 (metaxin 2 [Source:NCBI gene;Acc:101167474])

HSP 1 Score: 61.2326 bits (147), Expect = 2.207e-10
Identity = 51/231 (22.08%), Postives = 103/231 (44.59%), Query Frame = 2
Query:  161 SLAVITYVKIAQAPVNIFTNIRP---WSCPSYSLPFLQHSLNSSVG-LKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHR 841
            SLAV TY+++   PV +    RP   +  PS  +PF+ H  N  V  L  I+ + + + + +   L D   A++      ++  L+ A  ++ W   +  + +TR  +     +P++L  +   + +   K+ +     +TV           D +Y    +C  +L   L  + +F    PT +DA+++G+L+ IL        L+  V+  + ++     I Q+Y+  +
Sbjct:   41 SLAVQTYLRMCGLPVQVV--CRPNAEYMSPSGKIPFI-HVGNQVVSELGPIVQFSKAKGHSLSDGLDDVQRAEMKAYMELVNNMLLTAELFIQWCDETTVSQITRHRYGTPYSWPLNLILAYQKQWEVRRKMNAVGWGGKTV-----------DQVYEDVSQCCQALSQRLGTQPYFF-KIPTELDALVFGHLFTILTTQLTNTELLERVRSYSNLLSFCRRIEQTYFESK 256          
BLAST of Metaxin 1 vs. Ensembl Medaka
Match: mtx2 (metaxin 2 [Source:NCBI gene;Acc:101167474])

HSP 1 Score: 55.4546 bits (132), Expect = 1.797e-8
Identity = 47/226 (20.80%), Postives = 99/226 (43.81%), Query Frame = 2
Query:  176 TYVKIAQAPVNIFTNIRP---WSCPSYSLPFLQHSLNSSVG-LKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHR 841
            TY+++   PV +    RP   +  PS  +PF+ H  N  V  L  I+ + + + + +   L D   A++      ++  L+ A  ++ W   +  + +TR  +     +P++L  +   + +   K+ +     +TV           D +Y    +C  +L   L  + +F    PT +DA+++G+L+ IL        L+  V+  + ++     I Q+Y+  +
Sbjct:   47 TYLRMCGLPVQVV--CRPNAEYMSPSGKIPFI-HVGNQVVSELGPIVQFSKAKGHSLSDGLDDVQRAEMKAYMELVNNMLLTAELFIQWCDETTVSQITRHRYGTPYSWPLNLILAYQKQWEVRRKMNAVGWGGKTV-----------DQVYEDVSQCCQALSQRLGTQPYFF-KIPTELDALVFGHLFTILTTQLTNTELLERVRSYSNLLSFCRRIEQTYFESK 257          
BLAST of Metaxin 1 vs. Planmine SMEST
Match: SMESG000013267.1 (SMESG000013267.1)

HSP 1 Score: 629.402 bits (1622), Expect = 0.000e+0
Identity = 305/305 (100.00%), Postives = 305/305 (100.00%), Query Frame = 2
Query:  107 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSANENTLRGKVRVFLTENWIQIRNSSIFVLFVSTMMICYAKSTKVVK 1021
            MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSANENTLRGKVRVFLTENWIQIRNSSIFVLFVSTMMICYAKSTKVVK
Sbjct:    1 MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLPFLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLIPAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSRLNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVDAVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNPNRAPNEIVSANENTLRGKVRVFLTENWIQIRNSSIFVLFVSTMMICYAKSTKVVK 305          
The following BLAST results are available for this feature:
BLAST of Metaxin 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MTX13.586e-2928.52metaxin 1 [Source:HGNC Symbol;Acc:HGNC:7504][more]
MTX18.525e-2828.52metaxin 1 [Source:HGNC Symbol;Acc:HGNC:7504][more]
MTX32.825e-2529.21metaxin 3 [Source:HGNC Symbol;Acc:HGNC:24812][more]
MTX37.104e-2527.98metaxin 3 [Source:HGNC Symbol;Acc:HGNC:24812][more]
MTX31.512e-1929.95metaxin 3 [Source:HGNC Symbol;Acc:HGNC:24812][more]
back to top
BLAST of Metaxin 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
mtx-11.216e-2527.64Metaxin-1 homolog [Source:UniProtKB/Swiss-Prot;Ac... [more]
mtx-24.716e-1019.13Metaxin-2 homolog [Source:UniProtKB/Swiss-Prot;Ac... [more]
mtx-24.716e-1019.13Metaxin-2 homolog [Source:UniProtKB/Swiss-Prot;Ac... [more]
back to top
BLAST of Metaxin 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG93938.876e-1321.77gene:FBgn0037710 transcript:FBtr0332808[more]
CG93931.586e-1221.77gene:FBgn0037710 transcript:FBtr0082113[more]
back to top
BLAST of Metaxin 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtx1b3.295e-3227.54metaxin 1b [Source:ZFIN;Acc:ZDB-GENE-021210-1][more]
mtx1a4.251e-2529.25metaxin 1a [Source:ZFIN;Acc:ZDB-GENE-060606-2][more]
mtx32.429e-2124.90metaxin 3 [Source:NCBI gene;Acc:402916][more]
mtx32.649e-2124.90metaxin 3 [Source:NCBI gene;Acc:402916][more]
mtx23.186e-1021.05metaxin 2 [Source:ZFIN;Acc:ZDB-GENE-021210-2][more]
back to top
BLAST of Metaxin 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MTX31.274e-2427.42metaxin 3 [Source:NCBI gene;Acc:100493350][more]
dcaf174.452e-820.24DDB1 and CUL4 associated factor 17 [Source:Xenbase... [more]
back to top
BLAST of Metaxin 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mtx13.852e-2630.97metaxin 1 [Source:MGI Symbol;Acc:MGI:103025][more]
Mtx35.427e-2326.79metaxin 3 [Source:MGI Symbol;Acc:MGI:2686040][more]
Mtx16.855e-2327.15metaxin 1 [Source:MGI Symbol;Acc:MGI:103025][more]
Mtx13.758e-2233.33metaxin 1 [Source:MGI Symbol;Acc:MGI:103025][more]
Mtx13.277e-2024.49metaxin 1 [Source:MGI Symbol;Acc:MGI:103025][more]
back to top
BLAST of Metaxin 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q27HK4|MTX1_PIG5.852e-2831.12Metaxin-1 OS=Sus scrofa OX=9823 GN=MTX1 PE=2 SV=1[more]
sp|Q2TBS1|MTX1_BOVIN2.832e-2727.87Metaxin-1 OS=Bos taurus OX=9913 GN=MTX1 PE=2 SV=1[more]
sp|Q13505|MTX1_HUMAN4.094e-2728.52Metaxin-1 OS=Homo sapiens OX=9606 GN=MTX1 PE=1 SV=... [more]
sp|Q4R3I0|MTX1_MACFA4.754e-2727.54Metaxin-1 OS=Macaca fascicularis OX=9541 GN=MTX1 P... [more]
sp|P47802|MTX1_MOUSE1.931e-2529.22Metaxin-1 OS=Mus musculus OX=10090 GN=Mtx1 PE=1 SV... [more]
back to top
BLAST of Metaxin 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A087VYH04.367e-4334.77Metaxin 1 OS=Echinococcus multilocularis OX=6211 G... [more]
A0A068X4V14.531e-4335.22Metaxin 1 OS=Echinococcus granulosus OX=6210 GN=Eg... [more]
W6U9744.749e-4335.22Metaxin-3 OS=Echinococcus granulosus OX=6210 GN=EG... [more]
A0A5K3F6V54.716e-4130.88Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3WJH18.336e-4133.60Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
back to top
BLAST of Metaxin 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtx1b7.468e-3026.23metaxin-1-like [Source:NCBI gene;Acc:103026555][more]
mtx1a1.266e-2827.06metaxin-1-like [Source:NCBI gene;Acc:103044318][more]
mtx1a3.445e-2826.97metaxin-1-like [Source:NCBI gene;Acc:103044318][more]
mtx31.090e-2228.74metaxin 3 [Source:NCBI gene;Acc:103040731][more]
mtx1a8.234e-1725.42metaxin-1-like [Source:NCBI gene;Acc:103044318][more]
back to top
BLAST of Metaxin 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mtx38.803e-2226.51metaxin 3 [Source:NCBI gene;Acc:402916][more]
mtx21.592e-920.18metaxin 2 [Source:ZFIN;Acc:ZDB-GENE-021210-2][more]
back to top
BLAST of Metaxin 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metaxin 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO331604.147e-2427.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343367.187e-721.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431011.067e-622.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO278614.264e-630.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Metaxin 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mtx1a8.513e-2930.17metaxin-1 [Source:NCBI gene;Acc:101163689][more]
mtx36.914e-1627.78metaxin 3 [Source:NCBI gene;Acc:101155695][more]
mtx38.809e-1628.18metaxin 3 [Source:NCBI gene;Acc:101155695][more]
mtx22.207e-1022.08metaxin 2 [Source:NCBI gene;Acc:101167474][more]
mtx21.797e-820.80metaxin 2 [Source:NCBI gene;Acc:101167474][more]
back to top
BLAST of Metaxin 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000013267.10.000e+0100.00SMESG000013267.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021481 ID=SMED30021481|Name=Metaxin 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1087bp
GTGCAATATCTATTTTCGAATCGTTTATACAATTATATTATAATAAAATT
TTGAAAATATATTTTTTATTACTACATAAAAAGTTATATATTTATAGTTA
AATTTTATGAATTTGTATGTTTGGCCGCCTTTAGGTGCATTAGAGTCGAT
TGATCCAGAAAGTTTAGCTGTCATTACTTATGTTAAAATAGCACAAGCTC
CAGTAAATATTTTCACAAACATTAGACCATGGTCGTGCCCAAGTTACTCA
TTACCATTTCTTCAGCATAGCTTAAACTCTTCTGTTGGACTTAAACATAT
AATTCCTTATTTTAGAAAAGAGAATTACGGTGTCGAGTATAATCTTACTG
ATGAAGATCTGGCCAAATTACACGTGCTGTCATCAAACATTCACCAGGAT
CTCATCCCAGCAGTGGATTATCTGATGTGGTATCACAGCTCCAATTACAA
CTCTGTCACTCGATCTCTGTTCGCTGAAGCTGTGGGATTTCCGATGAGTT
TATTCTGGTCAAATCTCATGAAAAGTAAGGCAACCAGCAAAATATTAAGC
AGCCGTTTAAACTTCCAAACTGTCAACAAAGCCAAATTGACTGAGGAATT
CGTGAAAGATGCGCTATACAACACGGCGAAACGATGCCTGACTTCTCTAG
AGTACATTTTAAACGAGAAAGAATTTTTCATTTCCAACAAACCGACATAT
GTCGATGCCGTTTTATACGGGTACTTGTGGCCGATTCTGCACCTTGACTA
CGAACTCGACGGTCTCATAGTCCATGTCAAGCAATGCAACAAGATCATGG
AACTTCTCGTCAGCATTCACCAATCATATTATCACCACAGAGCTTTAACC
AATCCTAATCGGGCTCCAAATGAAATCGTAAGCGCCAATGAGAATACTCT
TCGGGGAAAGGTGCGAGTTTTTCTCACGGAAAATTGGATCCAGATTAGAA
ACAGTAGTATATTTGTGCTTTTTGTGTCGACAATGATGATTTGTTATGCA
AAATCCACAAAGGTTGTCAAATAGTGAAATAAATTTAGAATTTTAAATTG
TTCGACTTTTTTTTCTCATTTGTTATAAAAGTTGCGC
back to top

protein sequence of SMED30021481-orf-1

>SMED30021481-orf-1 ID=SMED30021481-orf-1|Name=SMED30021481-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=306bp
MNLYVWPPLGALESIDPESLAVITYVKIAQAPVNIFTNIRPWSCPSYSLP
FLQHSLNSSVGLKHIIPYFRKENYGVEYNLTDEDLAKLHVLSSNIHQDLI
PAVDYLMWYHSSNYNSVTRSLFAEAVGFPMSLFWSNLMKSKATSKILSSR
LNFQTVNKAKLTEEFVKDALYNTAKRCLTSLEYILNEKEFFISNKPTYVD
AVLYGYLWPILHLDYELDGLIVHVKQCNKIMELLVSIHQSYYHHRALTNP
NRAPNEIVSANENTLRGKVRVFLTENWIQIRNSSIFVLFVSTMMICYAKS
TKVVK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0001401mitochondrial sorting and assembly machinery complex
GO:0005741mitochondrial outer membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036282Glutathione-S-Trfase_C_sf
IPR019564Sam37/metaxin_N
IPR010987Glutathione-S-Trfase_C-like
IPR033468Metaxin_GST
Vocabulary: biological process
TermDefinition
GO:0006626protein targeting to mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019564Mitochondrial outer membrane transport complex Sam37/metaxin, N-terminal domainPFAMPF10568Tom37coord: 19..133
e-value: 1.8E-22
score: 80.0
IPR033468Metaxin, glutathione S-transferase domainPFAMPF17171GST_C_6coord: 174..233
e-value: 4.7E-12
score: 45.5
NoneNo IPR availableGENE3DG3DSA:1.20.1050.10coord: 133..233
e-value: 6.6E-6
score: 28.3
NoneNo IPR availablePANTHERPTHR12289:SF34METAXIN-1coord: 1..254
NoneNo IPR availablePANTHERPTHR12289METAXIN RELATEDcoord: 1..254
IPR036282Glutathione S-transferase, C-terminal domain superfamilySUPERFAMILYSSF47616GST C-terminal domain-likecoord: 163..216