Integral membrane protein GPR155

Overview
NameIntegral membrane protein GPR155
Smed IDSMED30021477
Length (bp)2630
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Integral membrane protein GPR155 (SMED30021477) t-SNE clustered cells

Violin plots show distribution of expression levels for Integral membrane protein GPR155 (SMED30021477) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Integral membrane protein GPR155 (SMED30021477) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Integral membrane protein GPR155 (SMED30021477) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Integral membrane protein GPR155 vs. Ensembl Human
Match: GPR155 (G protein-coupled receptor 155 [Source:HGNC Symbol;Acc:HGNC:22951])

HSP 1 Score: 278.87 bits (712), Expect = 3.331e-80
Identity = 173/500 (34.60%), Postives = 282/500 (56.40%), Query Frame = 1
Query:  127 LLPSLIQCFSVILIGYLAVKLSVISS-EGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPIN-FGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICS 1608
            L P+L++CF ++L GY+A + +VI+S + K LG +V++FALPAL F++M  +NF++V+W F+ ++ + K  +F    V TLL+  P + F  AG+  +F TQSND ALGYPI+ +LY    PE  +YIYL AP  L+ +NP+ FI  E  +++    AS   I I     + L L  V+ NP+V+M  +G+ FNFIL   +P+ ++  L+   +SFSG ALFYLG+ MVGKI  + +    +L+ ++  KL+ LP + RE+V  L +     N T + S   FLYG  P AP V + +  F +  ++I +G+V+ TF+S P+M+++  ++T            +Q+ +  IS +S+   +W L + +LS++ +   H +T    I   + C G++I      N +     V   G  + F + +       LWT L+A+S  ++K++    +   +    I G+ +P L+   +LI G K N   ID +F YGK Q I +
Sbjct:   42 LFPALLECFGIVLCGYIAGRANVITSTQAKGLGNFVSRFALPALLFKNMVVLNFSNVDWSFLYSILIAKASVFFIVCVLTLLVASPDSRFSKAGLFPIFATQSNDFALGYPIVEALYQTTYPEYLQYIYLVAPISLMMLNPIGFIFCEIQKWKDTQNASQNKIKI-----VGLGLLRVLQNPIVFMVFIGIAFNFILDRKVPVYVENFLDGLGNSFSGSALFYLGLTMVGKIKRLKKSAFVVLILLITAKLLVLPLLCREMVELLDKGDSVVNHT-SLSNYAFLYGVFPVAPGVAIFATQFNMEVEIITSGMVISTFVSAPIMYVSAWLLTFPTMDPKPLAYAIQNVSFDISIVSLISLIWSLAILLLSKKYKQLPHMLTTNLLIAQSIVCAGMMIW-----NFVKEKNFV---GQILVFVLLYSSLYSTYLWTGLLAISLFLLKKRE--RVQIPVGIIIISGWGIPALLVGVLLITG-KHNGDSIDSAFFYGKEQMITT 524          

HSP 2 Score: 104.76 bits (260), Expect = 2.450e-22
Identity = 63/183 (34.43%), Postives = 96/183 (52.46%), Query Frame = 1
Query: 1891 QLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDY-FYRF 2436
            QL RH +L +LL++ +      CLW L N+    +YVEL+F   VFNFGQGFI + IFGLD  LI++PFKR+  +F  +  +    ++  +S E+     +F  +H + C   I K+ R   K     F G   + W+++  L   R  A  +G  L+   V++H+         D+Y FYRF
Sbjct:  654 QLTRHVLLCLLLIIGLFANLSSCLWWLFNQEPGRLYVELQFFCAVFNFGQGFISFGIFGLDKHLIILPFKRRL-EFLWNNKDTAENRDSPVSEEIKMTCQQFIHYHRDLCIRNIVKERRCGAKTSAGTFCGCDLVSWLIEVGLASDRGEAVIYGDRLVQGGVIQHITNEYEF--RDEYLFYRF 833          
BLAST of Integral membrane protein GPR155 vs. Ensembl Human
Match: GPR155 (G protein-coupled receptor 155 [Source:HGNC Symbol;Acc:HGNC:22951])

HSP 1 Score: 278.87 bits (712), Expect = 3.331e-80
Identity = 173/500 (34.60%), Postives = 282/500 (56.40%), Query Frame = 1
Query:  127 LLPSLIQCFSVILIGYLAVKLSVISS-EGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPIN-FGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICS 1608
            L P+L++CF ++L GY+A + +VI+S + K LG +V++FALPAL F++M  +NF++V+W F+ ++ + K  +F    V TLL+  P + F  AG+  +F TQSND ALGYPI+ +LY    PE  +YIYL AP  L+ +NP+ FI  E  +++    AS   I I     + L L  V+ NP+V+M  +G+ FNFIL   +P+ ++  L+   +SFSG ALFYLG+ MVGKI  + +    +L+ ++  KL+ LP + RE+V  L +     N T + S   FLYG  P AP V + +  F +  ++I +G+V+ TF+S P+M+++  ++T            +Q+ +  IS +S+   +W L + +LS++ +   H +T    I   + C G++I      N +     V   G  + F + +       LWT L+A+S  ++K++    +   +    I G+ +P L+   +LI G K N   ID +F YGK Q I +
Sbjct:   42 LFPALLECFGIVLCGYIAGRANVITSTQAKGLGNFVSRFALPALLFKNMVVLNFSNVDWSFLYSILIAKASVFFIVCVLTLLVASPDSRFSKAGLFPIFATQSNDFALGYPIVEALYQTTYPEYLQYIYLVAPISLMMLNPIGFIFCEIQKWKDTQNASQNKIKI-----VGLGLLRVLQNPIVFMVFIGIAFNFILDRKVPVYVENFLDGLGNSFSGSALFYLGLTMVGKIKRLKKSAFVVLILLITAKLLVLPLLCREMVELLDKGDSVVNHT-SLSNYAFLYGVFPVAPGVAIFATQFNMEVEIITSGMVISTFVSAPIMYVSAWLLTFPTMDPKPLAYAIQNVSFDISIVSLISLIWSLAILLLSKKYKQLPHMLTTNLLIAQSIVCAGMMIW-----NFVKEKNFV---GQILVFVLLYSSLYSTYLWTGLLAISLFLLKKRE--RVQIPVGIIIISGWGIPALLVGVLLITG-KHNGDSIDSAFFYGKEQMITT 524          

HSP 2 Score: 104.76 bits (260), Expect = 2.450e-22
Identity = 63/183 (34.43%), Postives = 96/183 (52.46%), Query Frame = 1
Query: 1891 QLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDY-FYRF 2436
            QL RH +L +LL++ +      CLW L N+    +YVEL+F   VFNFGQGFI + IFGLD  LI++PFKR+  +F  +  +    ++  +S E+     +F  +H + C   I K+ R   K     F G   + W+++  L   R  A  +G  L+   V++H+         D+Y FYRF
Sbjct:  654 QLTRHVLLCLLLIIGLFANLSSCLWWLFNQEPGRLYVELQFFCAVFNFGQGFISFGIFGLDKHLIILPFKRRL-EFLWNNKDTAENRDSPVSEEIKMTCQQFIHYHRDLCIRNIVKERRCGAKTSAGTFCGCDLVSWLIEVGLASDRGEAVIYGDRLVQGGVIQHITNEYEF--RDEYLFYRF 833          
BLAST of Integral membrane protein GPR155 vs. Ensembl Human
Match: GPR155 (G protein-coupled receptor 155 [Source:HGNC Symbol;Acc:HGNC:22951])

HSP 1 Score: 278.87 bits (712), Expect = 3.331e-80
Identity = 173/500 (34.60%), Postives = 282/500 (56.40%), Query Frame = 1
Query:  127 LLPSLIQCFSVILIGYLAVKLSVISS-EGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPIN-FGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICS 1608
            L P+L++CF ++L GY+A + +VI+S + K LG +V++FALPAL F++M  +NF++V+W F+ ++ + K  +F    V TLL+  P + F  AG+  +F TQSND ALGYPI+ +LY    PE  +YIYL AP  L+ +NP+ FI  E  +++    AS   I I     + L L  V+ NP+V+M  +G+ FNFIL   +P+ ++  L+   +SFSG ALFYLG+ MVGKI  + +    +L+ ++  KL+ LP + RE+V  L +     N T + S   FLYG  P AP V + +  F +  ++I +G+V+ TF+S P+M+++  ++T            +Q+ +  IS +S+   +W L + +LS++ +   H +T    I   + C G++I      N +     V   G  + F + +       LWT L+A+S  ++K++    +   +    I G+ +P L+   +LI G K N   ID +F YGK Q I +
Sbjct:   42 LFPALLECFGIVLCGYIAGRANVITSTQAKGLGNFVSRFALPALLFKNMVVLNFSNVDWSFLYSILIAKASVFFIVCVLTLLVASPDSRFSKAGLFPIFATQSNDFALGYPIVEALYQTTYPEYLQYIYLVAPISLMMLNPIGFIFCEIQKWKDTQNASQNKIKI-----VGLGLLRVLQNPIVFMVFIGIAFNFILDRKVPVYVENFLDGLGNSFSGSALFYLGLTMVGKIKRLKKSAFVVLILLITAKLLVLPLLCREMVELLDKGDSVVNHT-SLSNYAFLYGVFPVAPGVAIFATQFNMEVEIITSGMVISTFVSAPIMYVSAWLLTFPTMDPKPLAYAIQNVSFDISIVSLISLIWSLAILLLSKKYKQLPHMLTTNLLIAQSIVCAGMMIW-----NFVKEKNFV---GQILVFVLLYSSLYSTYLWTGLLAISLFLLKKRE--RVQIPVGIIIISGWGIPALLVGVLLITG-KHNGDSIDSAFFYGKEQMITT 524          

HSP 2 Score: 104.76 bits (260), Expect = 2.450e-22
Identity = 63/183 (34.43%), Postives = 96/183 (52.46%), Query Frame = 1
Query: 1891 QLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDY-FYRF 2436
            QL RH +L +LL++ +      CLW L N+    +YVEL+F   VFNFGQGFI + IFGLD  LI++PFKR+  +F  +  +    ++  +S E+     +F  +H + C   I K+ R   K     F G   + W+++  L   R  A  +G  L+   V++H+         D+Y FYRF
Sbjct:  654 QLTRHVLLCLLLIIGLFANLSSCLWWLFNQEPGRLYVELQFFCAVFNFGQGFISFGIFGLDKHLIILPFKRRL-EFLWNNKDTAENRDSPVSEEIKMTCQQFIHYHRDLCIRNIVKERRCGAKTSAGTFCGCDLVSWLIEVGLASDRGEAVIYGDRLVQGGVIQHITNEYEF--RDEYLFYRF 833          
BLAST of Integral membrane protein GPR155 vs. Ensembl Human
Match: GPR155 (G protein-coupled receptor 155 [Source:HGNC Symbol;Acc:HGNC:22951])

HSP 1 Score: 252.292 bits (643), Expect = 6.232e-71
Identity = 167/500 (33.40%), Postives = 270/500 (54.00%), Query Frame = 1
Query:  127 LLPSLIQCFSVILIGYLAVKLSVISS-EGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPIN-FGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICS 1608
            L P+L++CF ++L GY+A + +VI+S + K LG +V++FALPAL F++M  +NF++V+W F+ ++ + K  +F    V TLL+  P + F  AG+  +F TQSND ALGYPI+ +LY    PE  +YIYL AP  L+ +NP+ FI  E  +++    AS   I I     + L L  V+ NP+V+M  +G+ FNFIL   +P+ ++  L+   +SFSG ALFYLG+ MVGKI  + +    +L+ ++  KL+ LP + RE+V  L +     N T + S   FLYG  P AP V + +  F +  ++I +G+V+ TF+S P+M+++  ++T            +Q+ +  IS +S+                            I + + C G++I      N +     V   G  + F + +       LWT L+A+S  ++K++    +   +    I G+ +P L+   +LI G K N   ID +F YGK Q I +
Sbjct:   42 LFPALLECFGIVLCGYIAGRANVITSTQAKGLGNFVSRFALPALLFKNMVVLNFSNVDWSFLYSILIAKASVFFIVCVLTLLVASPDSRFSKAGLFPIFATQSNDFALGYPIVEALYQTTYPEYLQYIYLVAPISLMMLNPIGFIFCEIQKWKDTQNASQNKIKI-----VGLGLLRVLQNPIVFMVFIGIAFNFILDRKVPVYVENFLDGLGNSFSGSALFYLGLTMVGKIKRLKKSAFVVLILLITAKLLVLPLLCREMVELLDKGDSVVNHT-SLSNYAFLYGVFPVAPGVAIFATQFNMEVEIITSGMVISTFVSAPIMYVSAWLLTFPTMDPKPLAYAIQNVSFDISIVSL----------------------------ISLSIVCAGMMIW-----NFVKEKNFV---GQILVFVLLYSSLYSTYLWTGLLAISLFLLKKRE--RVQIPVGIIIISGWGIPALLVGVLLITG-KHNGDSIDSAFFYGKEQMITT 496          

HSP 2 Score: 104.76 bits (260), Expect = 2.646e-22
Identity = 63/183 (34.43%), Postives = 96/183 (52.46%), Query Frame = 1
Query: 1891 QLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDY-FYRF 2436
            QL RH +L +LL++ +      CLW L N+    +YVEL+F   VFNFGQGFI + IFGLD  LI++PFKR+  +F  +  +    ++  +S E+     +F  +H + C   I K+ R   K     F G   + W+++  L   R  A  +G  L+   V++H+         D+Y FYRF
Sbjct:  626 QLTRHVLLCLLLIIGLFANLSSCLWWLFNQEPGRLYVELQFFCAVFNFGQGFISFGIFGLDKHLIILPFKRRL-EFLWNNKDTAENRDSPVSEEIKMTCQQFIHYHRDLCIRNIVKERRCGAKTSAGTFCGCDLVSWLIEVGLASDRGEAVIYGDRLVQGGVIQHITNEYEF--RDEYLFYRF 805          
BLAST of Integral membrane protein GPR155 vs. Ensembl Fly
Match: anchor (gene:FBgn0036741 transcript:FBtr0333121)

HSP 1 Score: 296.975 bits (759), Expect = 2.037e-86
Identity = 177/529 (33.46%), Postives = 293/529 (55.39%), Query Frame = 1
Query:  118 LENLLPSLIQCFSVILIGYLAVKLSVIS-SEGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPINFGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEY--------------RAACLASSTSI-HISLTRRILLVLKNVI---LNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILV--FILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIF------GKKQNTVDIDPSFQYGKIQTICSI 1611
            + N  P+L+QCF +I+ GY+A +  +IS +E K LG +V  FALP+L F S+  +N++ VNW F+LA+ + K ++F   ++ +LL+ +P+N+   G++++F TQSND A+GYPI+++LY    PE A Y+YL AP  L  +NP+  +L+E  +                  C A   S  +  L  R +LV   +I    NPL+ MT++GV   F+  + LP ++  TL +   SFS  ALF LG+ +VG      RK I  L+   ++L K++ LP + R+  V+++Q   + N T   S  GFLYG  P AP  F+I+  + +  +++A  +V  TF+S PLMFI+ +++++       Y + L + +  IS      C  +L + I+++R +    R+T C  +  L+ C+G+++         +    V  W  Y+QF +F IG    RLWT L+A+S   ++ +S+ F++K   Y  +F + VP +++A ++ F      G+K N     PSFQYG  Q   S+
Sbjct:   47 MNNFYPALVQCFGIIICGYIAGRFKIISNAETKGLGTFVGTFALPSLIFLSLVELNWSAVNWSFLLAMLVSKAVVFFAVLIISLLVARPLNYARGGLMAIFCTQSNDFAIGYPIVMALYKDVHPEYASYLYLMAPISLAILNPVGLVLMEISKIIKNKEDVTRNPPLCPETCPAEQMSKRNRCLGERSILVFNTLIALFFNPLLLMTLLGVAGGFLFPNGLPEMVSSTLRVLGQSFSATALFLLGLKIVGGTGS-ERKSIGFLLPGVLILVKILVLPLVIRQ-TVNIMQSGQNFNDTTELSTFGFLYGTFPAAPGAFVIATQYNMEVELVARSMVFCTFISAPLMFISAKMISLTNLKPLDYLHELDAFSFDISVAGAAACCIMLALLIVTKRFKRMPQRITFCLVLSQLMCCIGVIL--------WSKMEHVHRWPLYLQFLLFNIGTYSTRLWTGLLAISLLFLQCRSLCFVLKLWPYMLVFAWGVPAVLSALLIAFDSNVMSGEKHN-----PSFQYGNAQAAISV 560          

HSP 2 Score: 115.931 bits (289), Expect = 4.685e-26
Identity = 65/213 (30.52%), Postives = 112/213 (52.58%), Query Frame = 1
Query: 1762 TQMSNESDFC---QDREVCQLILRQYRXXXXXXXXXXXXXXXXXXFQLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVK 2391
             QM + S  C     R+ CQ I+ +Y ++              +E Q  +H VL + LL +M  G  + +W L+ E ++GIY+EL FLD   NFGQG I+ A+F  D   +++P  + + K +   + + +P   ++ PE   I  +F   HLE C+ +I KD R  ++ Y  VF G +F+ W+++  L + R+ A  + + L+  +V+ H+ 
Sbjct:  727 NQMCSSSFNCGPSTSRQSCQTIIERYEDQNRRGLEPLEHPSDADEHQTLKHTVLLITLLCSMFVGLAVSIWTLVMEGMSGIYLELSFLDAFLNFGQGLIVLAVFITDIGELLMPVVKLWRKLWYGANVVSLPHWSNVRPETKHICEQFRNHHLENCKKDIAKDRRWRIRVYRRVFYGTEFVSWLIEVGLSKDRMEAVHYARHLVDGRVLRHIN 939          
BLAST of Integral membrane protein GPR155 vs. Ensembl Fly
Match: anchor (gene:FBgn0036741 transcript:FBtr0075182)

HSP 1 Score: 296.59 bits (758), Expect = 2.608e-86
Identity = 177/529 (33.46%), Postives = 293/529 (55.39%), Query Frame = 1
Query:  118 LENLLPSLIQCFSVILIGYLAVKLSVIS-SEGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPINFGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEY--------------RAACLASSTSI-HISLTRRILLVLKNVI---LNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILV--FILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIF------GKKQNTVDIDPSFQYGKIQTICSI 1611
            + N  P+L+QCF +I+ GY+A +  +IS +E K LG +V  FALP+L F S+  +N++ VNW F+LA+ + K ++F   ++ +LL+ +P+N+   G++++F TQSND A+GYPI+++LY    PE A Y+YL AP  L  +NP+  +L+E  +                  C A   S  +  L  R +LV   +I    NPL+ MT++GV   F+  + LP ++  TL +   SFS  ALF LG+ +VG      RK I  L+   ++L K++ LP + R+  V+++Q   + N T   S  GFLYG  P AP  F+I+  + +  +++A  +V  TF+S PLMFI+ +++++       Y + L + +  IS      C  +L + I+++R +    R+T C  +  L+ C+G+++         +    V  W  Y+QF +F IG    RLWT L+A+S   ++ +S+ F++K   Y  +F + VP +++A ++ F      G+K N     PSFQYG  Q   S+
Sbjct:   47 MNNFYPALVQCFGIIICGYIAGRFKIISNAETKGLGTFVGTFALPSLIFLSLVELNWSAVNWSFLLAMLVSKAVVFFAVLIISLLVARPLNYARGGLMAIFCTQSNDFAIGYPIVMALYKDVHPEYASYLYLMAPISLAILNPVGLVLMEISKIIKNKEDVTRNPPLCPETCPAEQMSKRNRCLGERSILVFNTLIALFFNPLLLMTLLGVAGGFLFPNGLPEMVSSTLRVLGQSFSATALFLLGLKIVGGTGS-ERKSIGFLLPGVLILVKILVLPLVIRQ-TVNIMQSGQNFNDTTELSTFGFLYGTFPAAPGAFVIATQYNMEVELVARSMVFCTFISAPLMFISAKMISLTNLKPLDYLHELDAFSFDISVAGAAACCIMLALLIVTKRFKRMPQRITFCLVLSQLMCCIGVIL--------WSKMEHVHRWPLYLQFLLFNIGTYSTRLWTGLLAISLLFLQCRSLCFVLKLWPYMLVFAWGVPAVLSALLIAFDSNVMSGEKHN-----PSFQYGNAQAAISV 560          

HSP 2 Score: 115.931 bits (289), Expect = 4.684e-26
Identity = 65/213 (30.52%), Postives = 112/213 (52.58%), Query Frame = 1
Query: 1762 TQMSNESDFC---QDREVCQLILRQYRXXXXXXXXXXXXXXXXXXFQLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVK 2391
             QM + S  C     R+ CQ I+ +Y ++              +E Q  +H VL + LL +M  G  + +W L+ E ++GIY+EL FLD   NFGQG I+ A+F  D   +++P  + + K +   + + +P   ++ PE   I  +F   HLE C+ +I KD R  ++ Y  VF G +F+ W+++  L + R+ A  + + L+  +V+ H+ 
Sbjct:  719 NQMCSSSFNCGPSTSRQSCQTIIERYEDQNRRGLEPLEHPSDADEHQTLKHTVLLITLLCSMFVGLAVSIWTLVMEGMSGIYLELSFLDAFLNFGQGLIVLAVFITDIGELLMPVVKLWRKLWYGANVVSLPHWSNVRPETKHICEQFRNHHLENCKKDIAKDRRWRIRVYRRVFYGTEFVSWLIEVGLSKDRMEAVHYARHLVDGRVLRHIN 931          
BLAST of Integral membrane protein GPR155 vs. Ensembl Zebrafish
Match: gpr155b (G protein-coupled receptor 155b [Source:ZFIN;Acc:ZDB-GENE-110815-2])

HSP 1 Score: 313.153 bits (801), Expect = 4.838e-94
Identity = 220/733 (30.01%), Postives = 383/733 (52.25%), Query Frame = 1
Query:  118 LENLLPSLIQCFSVILIGYLAVKLSVISS-EGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPIN-FGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTIC-------SISVXXXXXXXXXXXXXXQIRFEFLSQIRLPTSSRKLXXXXXXXXXXXXXLITQMSNESDFCQDREVCQLILRQYR-----XXXXXXXXXXXXXXXXXXFQLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKF--FSSCHELYVPKEKDLSPEVI--EIR---NKFCTFHLETCRNEICKD 2241
            ++ L P+L++CF +IL GY A +  +IS+ +   LG +V+ FALPAL F++M  + F  V W F+ +V + K+ +F    V TLL+  P + +  AG+ ++F TQSND ALGYPI+ +LY     E  +YIYL AP  L+ +NP+ F L E   +R +   + + +H+     I  V   V+ NP+V+M +VG++ +F+    +P+++ + ++  ADSF G ALFYLG+NMVG+++ +TR     L+ ++  KL+ +P + R++V  L     SS    + S   FLYG  PTAP V + +  + +  +V+ +G+V+ TFLS P+M+++  ++T+           LQ  + +IS + +   +W L V +LS++ R   H       +  LL+C+ ++  +  L        SV  +G  + F + +       +WT L+A S  ++ R      +K +  F IFG+ +P L    +L+ G++ +   +DP+F YG  Q +        SI +   S++        +  ++ L Q  +  +S    +    +QNS +  + Q    +D C    +  +I              +   ++    +  E Q+ RH +L +LL+V+M      CLW L +     +Y+EL+F   V N+GQGF+ + IFGLD  LI++PF+++      FS        +E++L P  +  EIR    +F  +H + C  +I ++
Sbjct:   25 IDKLFPALLECFGIILCGYAAGRSGIISAAQVNGLGSFVSCFALPALLFKNMVQLQFQHVVWSFLWSVLIAKVCVFTLVCVLTLLVADPESKYSKAGLFAIFATQSNDFALGYPIVDALYRNSHSEYEQYIYLVAPVSLMLLNPVGFALCEIQRWRHSSDPNYSKLHV-----IFTVTLQVLKNPIVFMVMVGIVSHFVFGGRVPVLLGEFVDGLADSFGGAALFYLGLNMVGQMSKLTRSTGVSLILLITAKLLVMPLMCRDMVELLDAGNSSSANHSSLSDYAFLYGVFPTAPSVAIYAAQYNMELEVVTSGMVISTFLSAPIMYVSAWLLTIPWMEASFLVKELQDVSFNISIVCLIALVWTLAVMLLSKKFRRMPHMFATNLFLAQLLACMSMLFWKFVLKQG-----SV--FGQILTFTLLYGSLYSTYVWTGLLAFSLTLLGRNE-NLKVKPI-VFIIFGWGIPFLTVGGLLMIGQRMSD-SLDPAFFYGSGQIVSTVVVLGFSIVLGGLSLMGLSRGAQEEQSYQALDQNSITGASENSRHLQTENQNSSD--VDQTHTNTDVCCSEPMPDMIAGHLNDSPVPSAGIVLGESSSSLRVQEERQIARHVLLCLLLIVSMLANLSSCLWWLFSADPGRLYLELQFFCAVANYGQGFVSFGIFGLDEHLIILPFRKRLAALCGFS--------QEENLEPSAVPEEIRLTCTQFVRYHKDQCVQDIVRN 732          
BLAST of Integral membrane protein GPR155 vs. Ensembl Zebrafish
Match: gpr155a (G protein-coupled receptor 155a [Source:ZFIN;Acc:ZDB-GENE-100922-89])

HSP 1 Score: 272.707 bits (696), Expect = 8.454e-79
Identity = 162/503 (32.21%), Postives = 282/503 (56.06%), Query Frame = 1
Query:  118 LENLLPSLIQCFSVILIGYLAVKLSVI-SSEGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLI-TKPINFGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICS 1608
            ++ LLP+L++CF +IL GY+A + ++I +++ K LG +V+KFALPAL F++M  ++F DV W F  ++ + K+ +F    V TLL+  +   +  AG+  +F TQSND ALG+PI+ +LY    PE  +YIYL AP  L+ +NPL F+  E    +    +  + +H+     + LV+  V  NP+V+M ++G++ +F+L   +P  +++ ++  A+SF G ALFYLG++MVG++  +TR  +  L+ ++  KL+ +P I R +V  L     S+    + S   FLYG  PTAP V + +  + +  +V+ +G+V+ TFLS P+M+++  ++T+         + LQ+ +  IS +S+F  +W L V ILSR+     H  TI   +  LL C+G+++        +   + V      + F + +       +W  LI LS  +++ + + F         I G+ +P L  + +L+ G +     ID +F YG  Q +C+
Sbjct:   27 IDKLLPALLECFGIILCGYVAGRTNIILATQAKGLGSFVSKFALPALLFKNMVLLDFGDVIWPFFFSILVAKVTVFFFVCVLTLLVGNRESRYSKAGLFPIFATQSNDFALGFPIVEALYRSTHPEYLQYIYLVAPVSLMVLNPLGFMFCEVQRRKNGEPSQQSKLHV-----LGLVVLQVFKNPIVFMVMIGLVSHFLLCQKIPAFMEQFVDGLANSFGGAALFYLGLSMVGQLKKLTRTTVVALILLITAKLLMMPLICRGMVEVLDNTNRSTLNHTSLSNYAFLYGVFPTAPSVAIYAAHYNMELEVVTSGMVVSTFLSAPIMYVSAWLLTIPWMDSAPLASALQNVSFDISIISLFALVWSLTVMILSRKYHRIPHIFTINLFVAQLLVCVGMIVWNFV----VKQDSFV---AQVLSFTLLYGSLYSTYIWPGLIVLSLLLMRSEEVNF---RPGLTVITGWGLPFLAVSVLLLSGHRMPDT-IDSAFFYGTTQVMCT 513          

HSP 2 Score: 92.0485 bits (227), Expect = 1.302e-18
Identity = 56/182 (30.77%), Postives = 86/182 (47.25%), Query Frame = 1
Query: 1891 QLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDYFYRF 2436
            Q  RH ++ ++L VT       CLW L N+    +Y+EL+F   V N+GQG I +A FGLD  LI+ PFK++    +    +L    E  +S E+    N+F  +H + C  +I    R   K     F G   + W+    L   +  A  +G  LL   V++H+ +     D   + YRF
Sbjct:  606 QSTRHVLMCLILTVTSLANLCSCLWWLFNKDPGRLYLELQFFCVVANYGQGLISFAFFGLDKHLIISPFKKRLESVWQWWAQLVSGSE--VSEEIRLTCNQFLKYHKKQCIKDIVHKKRCGEKSSIQAFLGTDMVVWLQSVGLASDQGEAVLYGSRLLDGGVIQHITQQHAFEDQTLH-YRF 784          
BLAST of Integral membrane protein GPR155 vs. Ensembl Zebrafish
Match: gpr155a (G protein-coupled receptor 155a [Source:ZFIN;Acc:ZDB-GENE-100922-89])

HSP 1 Score: 272.707 bits (696), Expect = 1.322e-78
Identity = 162/503 (32.21%), Postives = 282/503 (56.06%), Query Frame = 1
Query:  118 LENLLPSLIQCFSVILIGYLAVKLSVI-SSEGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLI-TKPINFGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICS 1608
            ++ LLP+L++CF +IL GY+A + ++I +++ K LG +V+KFALPAL F++M  ++F DV W F  ++ + K+ +F    V TLL+  +   +  AG+  +F TQSND ALG+PI+ +LY    PE  +YIYL AP  L+ +NPL F+  E    +    +  + +H+     + LV+  V  NP+V+M ++G++ +F+L   +P  +++ ++  A+SF G ALFYLG++MVG++  +TR  +  L+ ++  KL+ +P I R +V  L     S+    + S   FLYG  PTAP V + +  + +  +V+ +G+V+ TFLS P+M+++  ++T+         + LQ+ +  IS +S+F  +W L V ILSR+     H  TI   +  LL C+G+++        +   + V      + F + +       +W  LI LS  +++ + + F         I G+ +P L  + +L+ G +     ID +F YG  Q +C+
Sbjct:   27 IDKLLPALLECFGIILCGYVAGRTNIILATQAKGLGSFVSKFALPALLFKNMVLLDFGDVIWPFFFSILVAKVTVFFFVCVLTLLVGNRESRYSKAGLFPIFATQSNDFALGFPIVEALYRSTHPEYLQYIYLVAPVSLMVLNPLGFMFCEVQRRKNGEPSQQSKLHV-----LGLVVLQVFKNPIVFMVMIGLVSHFLLCQKIPAFMEQFVDGLANSFGGAALFYLGLSMVGQLKKLTRTTVVALILLITAKLLMMPLICRGMVEVLDNTNRSTLNHTSLSNYAFLYGVFPTAPSVAIYAAHYNMELEVVTSGMVVSTFLSAPIMYVSAWLLTIPWMDSAPLASALQNVSFDISIISLFALVWSLTVMILSRKYHRIPHIFTINLFVAQLLVCVGMIVWNFV----VKQDSFV---AQVLSFTLLYGSLYSTYIWPGLIVLSLLLMRSEEVNF---RPGLTVITGWGLPFLAVSVLLLSGHRMPDT-IDSAFFYGTTQVMCT 513          

HSP 2 Score: 92.0485 bits (227), Expect = 1.613e-18
Identity = 56/182 (30.77%), Postives = 86/182 (47.25%), Query Frame = 1
Query: 1891 QLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDYFYRF 2436
            Q  RH ++ ++L VT       CLW L N+    +Y+EL+F   V N+GQG I +A FGLD  LI+ PFK++    +    +L    E  +S E+    N+F  +H + C  +I    R   K     F G   + W+    L   +  A  +G  LL   V++H+ +     D   + YRF
Sbjct:  635 QSTRHVLMCLILTVTSLANLCSCLWWLFNKDPGRLYLELQFFCVVANYGQGLISFAFFGLDKHLIISPFKKRLESVWQWWAQLVSGSE--VSEEIRLTCNQFLKYHKKQCIKDIVHKKRCGEKSSIQAFLGTDMVVWLQSVGLASDQGEAVLYGSRLLDGGVIQHITQQHAFEDQTLH-YRF 813          
BLAST of Integral membrane protein GPR155 vs. Ensembl Zebrafish
Match: gpr155b (G protein-coupled receptor 155b [Source:ZFIN;Acc:ZDB-GENE-110815-2])

HSP 1 Score: 236.884 bits (603), Expect = 6.608e-69
Identity = 138/404 (34.16%), Postives = 235/404 (58.17%), Query Frame = 1
Query:  118 LENLLPSLIQCFSVILIGYLAVKLSVISS-EGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPIN-FGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFL 1311
            ++ L P+L++CF +IL GY A +  +IS+ +   LG +V+ FALPAL F++M  + F  V W F+ +V + K+ +F    V TLL+  P + +  AG+ ++F TQSND ALGYPI+ +LY     E  +YIYL AP  L+ +NP+ F L E   +R +   + + +H+     I  V   V+ NP+V+M +VG++ +F+    +P+++ + ++  ADSF G ALFYLG+NMVG+++ +TR     L+ ++  KL+ +P + R++V  L     SS    + S   FLYG  PTAP V + +  + +  +V+ +G+V+ TFLS P+M+++  ++T+           LQ  + +IS + +   +W L V +LS++ R   H       +  LL+C+ ++  +  L
Sbjct:   25 IDKLFPALLECFGIILCGYAAGRSGIISAAQVNGLGSFVSCFALPALLFKNMVQLQFQHVVWSFLWSVLIAKVCVFTLVCVLTLLVADPESKYSKAGLFAIFATQSNDFALGYPIVDALYRNSHSEYEQYIYLVAPVSLMLLNPVGFALCEIQRWRHSSDPNYSKLHV-----IFTVTLQVLKNPIVFMVMVGIVSHFVFGGRVPVLLGEFVDGLADSFGGAALFYLGLNMVGQMSKLTRSTGVSLILLITAKLLVMPLMCRDMVELLDAGNSSSANHSSLSDYAFLYGVFPTAPSVAIYAAQYNMELEVVTSGMVISTFLSAPIMYVSAWLLTIPWMEASFLVKELQDVSFNISIVCLIALVWTLAVMLLSKKFRRMPHMFATNLFLAQLLACMSMLFWKFVL 423          
BLAST of Integral membrane protein GPR155 vs. Ensembl Xenopus
Match: GPR155 (G protein-coupled receptor 155 [Source:NCBI gene;Acc:100497376])

HSP 1 Score: 349.747 bits (896), Expect = 1.294e-106
Identity = 261/814 (32.06%), Postives = 424/814 (52.09%), Query Frame = 1
Query:  118 LENLLPSLIQCFSVILIGYLAVKLSVISS-EGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKP-INFGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQT--LNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICSISVXXXXXXXXXXXXXXQIR------FEFLSQIRLPTSSRKLXXXXXXXXXXXXXLIT-QMSNESDFC----QDREVCQLILR------------QYRXXXXXXXXXXXXXXXXXXFQLN-------RHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIR-NKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDYFYRFAK 2442
            +  L P+L++CF +I+ GY+A + ++IS+ + K LG YV++FALPAL F++M  ++F+DVNW F+ ++ + K  +F+   V TLL+  P   F  AG+  +F TQSND ALGYPI+ +LY    P+  +YIYL AP  L+ +NPL F+L E  +++     S + + I     +   L  V  NP+V+M  +G+ FNF+L   +P+ ++  L+  A SFSG ALFYLG+ MVG+   + +     L+ ++  KL+ LP I RELV  L +     N T   NY+   FLYG  P AP V + +  F +  ++I  G+V+ TF+S P+M+++  ++T+           LQ+ +  IS LSI   +W L V +LS++ +   H +T    +  L++C+G+V     L N I    +V   G  + F I +     +  WT L++LS  ++K++        + +  + G+ VPVL+  CIL+   +++   ID +F YG  Q IC+  +L+ SI+ + + L+   R      +  L       S+R ++N  D+  +S     T  +S E DFC    ++ +VC  +              +   E               E Q+N       RH +L + L+V +      C W L N     +YVEL+F   VFNFGQG I +AIFGLD  LI++P K++  +F  +  E  V  E+   PE I +  ++F  +H + C   I K+ R   +    VF G   + W+++  L   R  A  +G+ LL   V++H+       D ++++YR  K
Sbjct:   40 INRLFPALLECFGIIMCGYIAGRANIISATQAKGLGNYVSRFALPALLFKNMVVLDFSDVNWSFLYSILIAKASVFVIVCVLTLLVANPQTRFSKAGLFPIFATQSNDFALGYPIVEALYQTTYPKYLQYIYLVAPVSLMMLNPLGFVLCEIQKWKDNPNTSHSKLKI-----LGFALLRVFQNPIVFMVFIGIAFNFVLGQKIPIYLENFLDGLASSFSGAALFYLGLTMVGQTGKLEKSSFVALLLLITAKLLVLPLICRELVELLDKTSDVVNHTSLTNYA---FLYGVFPVAPGVVIFAGQFNMELEIITPGMVISTFVSAPIMYVSAWLLTIPSMDPKPLVAALQNVSFDISILSILCLIWSLAVLLLSKKYKRLPHLLTSNLLLSQLITCVGMV-----LWNFIIQERNVV--GQILVFVILYSALYSSYFWTGLLSLSLVLLKKRDGKV---PVVFLVLAGWGVPVLVV-CILLSAGERDLDSIDSAFFYGTSQIICTAVILSCSILLSGISLMCMSRSGQDGNYHVLLHSSQNNSNRSVNNMEDSKPDSPTLASTSSLSTERDFCACNKENGDVCPSVESATALNINTPPSIEEAHECLTRCNTQRCLLSQEEQQINSGDGQMARHVLLCLFLVVGLLANVSSCFWWLFNREPGRLYVELQFFCAVFNFGQGLISFAIFGLDKHLIILPCKKRL-EFLWNSRESNVNAEEARLPEDIRMTCHQFVQYHKDLCIRNIVKERRCGARTSPGVFWGSDLVSWLVEVGLAPDRGEAVKYGERLLKGGVIQHITDEYEFRD-ENFYYRMLK 832          
BLAST of Integral membrane protein GPR155 vs. Ensembl Xenopus
Match: GPR155 (G protein-coupled receptor 155 [Source:NCBI gene;Acc:100497376])

HSP 1 Score: 339.732 bits (870), Expect = 7.527e-103
Identity = 257/814 (31.57%), Postives = 413/814 (50.74%), Query Frame = 1
Query:  118 LENLLPSLIQCFSVILIGYLAVKLSVISS-EGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKP-INFGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQT--LNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICSISVXXXXXXXXXXXXXXQIR------FEFLSQIRLPTSSRKLXXXXXXXXXXXXXLIT-QMSNESDFC----QDREVCQLILR------------QYRXXXXXXXXXXXXXXXXXXFQLN-------RHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIR-NKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDYFYRFAK 2442
            +  L P+L++CF +I+ GY+A + ++IS+ + K LG YV++FALPAL F++M  ++F+DVNW F+ ++ + K  +F+   V TLL+  P   F  AG+  +F TQSND ALGYPI+ +LY    P+  +YIYL AP  L+ +NPL F+L E  +++     S + + I     +   L  V  NP+V+M  +G+ FNF+L   +P+ ++  L+  A SFSG ALFYLG+ MVG+   + +     L+ ++  KL+ LP I RELV  L +     N T   NY+   FLYG  P AP V + +  F +  ++I  G+V+ TF+S P+M+++  ++T+           LQ+ +  IS LSI   +W L V +LS++ +   H +T    +  L++C+G+V     L N I    +V   G  + F I +     +  WT +            I  L+  LN F         ++  CIL+   +++   ID +F YG  Q IC+  +L+ SI+ + + L+   R      +  L       S+R ++N  D+  +S     T  +S E DFC    ++ +VC  +              +   E               E Q+N       RH +L + L+V +      C W L N     +YVEL+F   VFNFGQG I +AIFGLD  LI++P K++  +F  +  E  V  E+   PE I +  ++F  +H + C   I K+ R   +    VF G   + W+++  L   R  A  +G+ LL   V++H+       D ++++YR  K
Sbjct:   40 INRLFPALLECFGIIMCGYIAGRANIISATQAKGLGNYVSRFALPALLFKNMVVLDFSDVNWSFLYSILIAKASVFVIVCVLTLLVANPQTRFSKAGLFPIFATQSNDFALGYPIVEALYQTTYPKYLQYIYLVAPVSLMMLNPLGFVLCEIQKWKDNPNTSHSKLKI-----LGFALLRVFQNPIVFMVFIGIAFNFVLGQKIPIYLENFLDGLASSFSGAALFYLGLTMVGQTGKLEKSSFVALLLLITAKLLVLPLICRELVELLDKTSDVVNHTSLTNYA---FLYGVFPVAPGVVIFAGQFNMELEIITPGMVISTFVSAPIMYVSAWLLTIPSMDPKPLVAALQNVSFDISILSILCLIWSLAVLLLSKKYKRLPHLLTSNLLLSQLITCVGMV-----LWNFIIQERNVV--GQILVFVILYSALYSSYFWTGIC-----------IFVLLSLLNAFVP--PPSVPVLVVCILLSAGERDLDSIDSAFFYGTSQIICTAVILSCSILLSGISLMCMSRSGQDGNYHVLLHSSQNNSNRSVNNMEDSKPDSPTLASTSSLSTERDFCACNKENGDVCPSVESATALNINTPPSIEEAHECLTRCNTQRCLLSQEEQQINSGDGQMARHVLLCLFLVVGLLANVSSCFWWLFNREPGRLYVELQFFCAVFNFGQGLISFAIFGLDKHLIILPCKKRL-EFLWNSRESNVNAEEARLPEDIRMTCHQFVQYHKDLCIRNIVKERRCGARTSPGVFWGSDLVSWLVEVGLAPDRGEAVKYGERLLKGGVIQHITDEYEFRD-ENFYYRMLK 823          
BLAST of Integral membrane protein GPR155 vs. Ensembl Xenopus
Match: GPR155 (G protein-coupled receptor 155 [Source:NCBI gene;Acc:100497376])

HSP 1 Score: 339.732 bits (870), Expect = 8.803e-103
Identity = 257/814 (31.57%), Postives = 413/814 (50.74%), Query Frame = 1
Query:  118 LENLLPSLIQCFSVILIGYLAVKLSVISS-EGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKP-INFGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQT--LNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICSISVXXXXXXXXXXXXXXQIR------FEFLSQIRLPTSSRKLXXXXXXXXXXXXXLIT-QMSNESDFC----QDREVCQLILR------------QYRXXXXXXXXXXXXXXXXXXFQLN-------RHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIR-NKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDYFYRFAK 2442
            +  L P+L++CF +I+ GY+A + ++IS+ + K LG YV++FALPAL F++M  ++F+DVNW F+ ++ + K  +F+   V TLL+  P   F  AG+  +F TQSND ALGYPI+ +LY    P+  +YIYL AP  L+ +NPL F+L E  +++     S + + I     +   L  V  NP+V+M  +G+ FNF+L   +P+ ++  L+  A SFSG ALFYLG+ MVG+   + +     L+ ++  KL+ LP I RELV  L +     N T   NY+   FLYG  P AP V + +  F +  ++I  G+V+ TF+S P+M+++  ++T+           LQ+ +  IS LSI   +W L V +LS++ +   H +T    +  L++C+G+V     L N I    +V   G  + F I +     +  WT +            I  L+  LN F         ++  CIL+   +++   ID +F YG  Q IC+  +L+ SI+ + + L+   R      +  L       S+R ++N  D+  +S     T  +S E DFC    ++ +VC  +              +   E               E Q+N       RH +L + L+V +      C W L N     +YVEL+F   VFNFGQG I +AIFGLD  LI++P K++  +F  +  E  V  E+   PE I +  ++F  +H + C   I K+ R   +    VF G   + W+++  L   R  A  +G+ LL   V++H+       D ++++YR  K
Sbjct:   40 INRLFPALLECFGIIMCGYIAGRANIISATQAKGLGNYVSRFALPALLFKNMVVLDFSDVNWSFLYSILIAKASVFVIVCVLTLLVANPQTRFSKAGLFPIFATQSNDFALGYPIVEALYQTTYPKYLQYIYLVAPVSLMMLNPLGFVLCEIQKWKDNPNTSHSKLKI-----LGFALLRVFQNPIVFMVFIGIAFNFVLGQKIPIYLENFLDGLASSFSGAALFYLGLTMVGQTGKLEKSSFVALLLLITAKLLVLPLICRELVELLDKTSDVVNHTSLTNYA---FLYGVFPVAPGVVIFAGQFNMELEIITPGMVISTFVSAPIMYVSAWLLTIPSMDPKPLVAALQNVSFDISILSILCLIWSLAVLLLSKKYKRLPHLLTSNLLLSQLITCVGMV-----LWNFIIQERNVV--GQILVFVILYSALYSSYFWTGIC-----------IFVLLSLLNAFVP--PPSVPVLVVCILLSAGERDLDSIDSAFFYGTSQIICTAVILSCSILLSGISLMCMSRSGQDGNYHVLLHSSQNNSNRSVNNMEDSKPDSPTLASTSSLSTERDFCACNKENGDVCPSVESATALNINTPPSIEEAHECLTRCNTQRCLLSQEEQQINSGDGQMARHVLLCLFLVVGLLANVSSCFWWLFNREPGRLYVELQFFCAVFNFGQGLISFAIFGLDKHLIILPCKKRL-EFLWNSRESNVNAEEARLPEDIRMTCHQFVQYHKDLCIRNIVKERRCGARTSPGVFWGSDLVSWLVEVGLAPDRGEAVKYGERLLKGGVIQHITDEYEFRD-ENFYYRMLK 823          
BLAST of Integral membrane protein GPR155 vs. Ensembl Xenopus
Match: GPR155 (G protein-coupled receptor 155 [Source:NCBI gene;Acc:100497376])

HSP 1 Score: 339.732 bits (870), Expect = 9.327e-103
Identity = 257/814 (31.57%), Postives = 413/814 (50.74%), Query Frame = 1
Query:  118 LENLLPSLIQCFSVILIGYLAVKLSVISS-EGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKP-INFGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQT--LNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICSISVXXXXXXXXXXXXXXQIR------FEFLSQIRLPTSSRKLXXXXXXXXXXXXXLIT-QMSNESDFC----QDREVCQLILR------------QYRXXXXXXXXXXXXXXXXXXFQLN-------RHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIR-NKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDYFYRFAK 2442
            +  L P+L++CF +I+ GY+A + ++IS+ + K LG YV++FALPAL F++M  ++F+DVNW F+ ++ + K  +F+   V TLL+  P   F  AG+  +F TQSND ALGYPI+ +LY    P+  +YIYL AP  L+ +NPL F+L E  +++     S + + I     +   L  V  NP+V+M  +G+ FNF+L   +P+ ++  L+  A SFSG ALFYLG+ MVG+   + +     L+ ++  KL+ LP I RELV  L +     N T   NY+   FLYG  P AP V + +  F +  ++I  G+V+ TF+S P+M+++  ++T+           LQ+ +  IS LSI   +W L V +LS++ +   H +T    +  L++C+G+V     L N I    +V   G  + F I +     +  WT +            I  L+  LN F         ++  CIL+   +++   ID +F YG  Q IC+  +L+ SI+ + + L+   R      +  L       S+R ++N  D+  +S     T  +S E DFC    ++ +VC  +              +   E               E Q+N       RH +L + L+V +      C W L N     +YVEL+F   VFNFGQG I +AIFGLD  LI++P K++  +F  +  E  V  E+   PE I +  ++F  +H + C   I K+ R   +    VF G   + W+++  L   R  A  +G+ LL   V++H+       D ++++YR  K
Sbjct:   40 INRLFPALLECFGIIMCGYIAGRANIISATQAKGLGNYVSRFALPALLFKNMVVLDFSDVNWSFLYSILIAKASVFVIVCVLTLLVANPQTRFSKAGLFPIFATQSNDFALGYPIVEALYQTTYPKYLQYIYLVAPVSLMMLNPLGFVLCEIQKWKDNPNTSHSKLKI-----LGFALLRVFQNPIVFMVFIGIAFNFVLGQKIPIYLENFLDGLASSFSGAALFYLGLTMVGQTGKLEKSSFVALLLLITAKLLVLPLICRELVELLDKTSDVVNHTSLTNYA---FLYGVFPVAPGVVIFAGQFNMELEIITPGMVISTFVSAPIMYVSAWLLTIPSMDPKPLVAALQNVSFDISILSILCLIWSLAVLLLSKKYKRLPHLLTSNLLLSQLITCVGMV-----LWNFIIQERNVV--GQILVFVILYSALYSSYFWTGIC-----------IFVLLSLLNAFVP--PPSVPVLVVCILLSAGERDLDSIDSAFFYGTSQIICTAVILSCSILLSGISLMCMSRSGQDGNYHVLLHSSQNNSNRSVNNMEDSKPDSPTLASTSSLSTERDFCACNKENGDVCPSVESATALNINTPPSIEEAHECLTRCNTQRCLLSQEEQQINSGDGQMARHVLLCLFLVVGLLANVSSCFWWLFNREPGRLYVELQFFCAVFNFGQGLISFAIFGLDKHLIILPCKKRL-EFLWNSRESNVNAEEARLPEDIRMTCHQFVQYHKDLCIRNIVKERRCGARTSPGVFWGSDLVSWLVEVGLAPDRGEAVKYGERLLKGGVIQHITDEYEFRD-ENFYYRMLK 823          
BLAST of Integral membrane protein GPR155 vs. Ensembl Xenopus
Match: GPR155 (G protein-coupled receptor 155 [Source:NCBI gene;Acc:100497376])

HSP 1 Score: 260.766 bits (665), Expect = 1.747e-74
Identity = 173/505 (34.26%), Postives = 276/505 (54.65%), Query Frame = 1
Query:  118 LENLLPSLIQCFSVILIGYLAVKLSVISS-EGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKP-INFGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQT--LNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICS 1608
            +  L P+L++CF +I+ GY+A + ++IS+ + K LG YV++FALPAL F++M  ++F+DVNW F+ ++ + K  +F+   V TLL+  P   F  AG+  +F TQSND ALGYPI+ +LY    P+  +YIYL AP  L+ +NPL F+L E  +++     S + + I     +   L  V  NP+V+M  +G+ FNF+L   +P+ ++  L+  A SFSG ALFYLG+ MVG+   + +     L+ ++  KL+ LP I RELV  L +     N T   NY+   FLYG  P AP V + +  F +  ++I  G+V+ TF+S P+M+++  ++T+           LQ+ +  IS LSI   +W L V +LS++ +   H +T    +  L++C+G+V     L N I    +V   G  + F I +     +  WT +            I  L+  LN F         ++  CIL+   +++   ID +F YG  Q IC+
Sbjct:   28 INRLFPALLECFGIIMCGYIAGRANIISATQAKGLGNYVSRFALPALLFKNMVVLDFSDVNWSFLYSILIAKASVFVIVCVLTLLVANPQTRFSKAGLFPIFATQSNDFALGYPIVEALYQTTYPKYLQYIYLVAPVSLMMLNPLGFVLCEIQKWKDNPNTSHSKLKI-----LGFALLRVFQNPIVFMVFIGIAFNFVLGQKIPIYLENFLDGLASSFSGAALFYLGLTMVGQTGKLEKSSFVALLLLITAKLLVLPLICRELVELLDKTSDVVNHTSLTNYA---FLYGVFPVAPGVVIFAGQFNMELEIITPGMVISTFVSAPIMYVSAWLLTIPSMDPKPLVAALQNVSFDISILSILCLIWSLAVLLLSKKYKRLPHLLTSNLLLSQLITCVGMV-----LWNFIIQERNVV--GQILVFVILYSALYSSYFWTGI-----------CIFVLLSLLNAFVPPP--SVPVLVVCILLSAGERDLDSIDSAFFYGTSQIICT 504          

HSP 2 Score: 80.1073 bits (196), Expect = 1.119e-14
Identity = 46/120 (38.33%), Postives = 67/120 (55.83%), Query Frame = 1
Query: 1891 QLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIR-NKFCTFHLETCRNEICKDMR 2247
            Q+ RH +L + L+V +      C W L N     +YVEL+F   VFNFGQG I +AIFGLD  LI++P K++  +F  +  E  V  E+   PE I +  ++F  +H + C   I K+ R
Sbjct:  619 QMARHVLLCLFLVVGLLANVSSCFWWLFNREPGRLYVELQFFCAVFNFGQGLISFAIFGLDKHLIILPCKKRL-EFLWNSRESNVNAEEARLPEDIRMTCHQFVQYHKDLCIRNIVKERR 737          
BLAST of Integral membrane protein GPR155 vs. Ensembl Mouse
Match: Gpr155 (G protein-coupled receptor 155 [Source:MGI Symbol;Acc:MGI:1915776])

HSP 1 Score: 265.003 bits (676), Expect = 1.958e-75
Identity = 175/501 (34.93%), Postives = 279/501 (55.69%), Query Frame = 1
Query:  127 LLPSLIQCFSVILIGYLAVKLSVISS-EGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPIN-FGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALS-FAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICS 1608
            L P+L++CF ++L GY+A + ++I+S + K LG +V++FALPAL F++M  +NF++V+W F+ +V +GK  +F    V TLL+  P + F  AG+  +F TQSND ALGYPI+ +LY    PE  +YIYL AP  L+ +NP+ FI  E  + +    AS     I     + L    V+ NP+V+M  VG+ FNFIL   +P+ ++  L+  A+SFSG ALFYLG+ MVGKI  + +    +L  ++  KL+ LP + RE+V  L +     N T + S   FLYG  P AP V + +  F +  ++I +G+V+ TF+S P+M+++  ++T            +Q+ +  IS +S+   +W L + +LS++ +   H +T    I   + C G++I      N +     V   G  + F + +       LWT L+A+S F + KR+S+   +  +         +P L+   +LI G K N   ID +F YGK Q I +
Sbjct:   40 LFPALLECFGIVLCGYIAGRANIITSTQAKGLGNFVSRFALPALLFKNMVVLNFSNVDWAFLYSVLIGKASVFFIVCVLTLLVASPESRFSKAGLFPIFATQSNDFALGYPIVEALYQSTYPEYLQYIYLVAPISLMMLNPIGFIFCEIQKSKDTQNASQNKAKI-----VGLGFLRVLQNPIVFMVFVGIAFNFILDKKIPVYMENFLDGLANSFSGSALFYLGLTMVGKIRRLKKSAFVVLTLLITAKLLVLPLLCREMVELLDKGDSVVNHT-SLSNYAFLYGVFPVAPGVAIFATQFNMEVEIITSGMVISTFVSAPIMYVSAWLLTFPTMDAKPLAYAIQNVSFDISIISLVSLIWSLSILLLSKKYKQLPHMLTANLLIAQTIVCAGMMIW-----NFVKEKNFV---GQILVFVLLYSSLYSTYLWTGLLAVSLFLLKKRESVQLPVGIIIISGWG---IPALLVGVLLITG-KHNGDSIDSAFFYGKEQMITT 522          

HSP 2 Score: 108.227 bits (269), Expect = 1.696e-23
Identity = 64/183 (34.97%), Postives = 96/183 (52.46%), Query Frame = 1
Query: 1891 QLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDY-FYRF 2436
            QL RH +L +LL++ +      CLW L N     +YVEL+F   VFNFGQGFI + IFGLD  LI++PFKR+  +F  +  E    +E  +S E+     +F  +H + C   I ++ R   K     F G   ++W+++  L   R  A  +G  L+   V++H+         D+Y FYRF
Sbjct:  652 QLTRHVLLCLLLIIGLFANLSSCLWWLFNHETGRLYVELQFFCAVFNFGQGFISFGIFGLDKHLIILPFKRRL-EFLWNNKEAAADRESPVSEEIKMTCQQFVHYHRDLCIRNIVRERRCGAKTSAGTFCGCDLVNWLIEVGLASDRGEAVIYGDRLVQGGVIQHITNEYEF--RDEYLFYRF 831          
BLAST of Integral membrane protein GPR155 vs. Ensembl Mouse
Match: Gpr155 (G protein-coupled receptor 155 [Source:MGI Symbol;Acc:MGI:1915776])

HSP 1 Score: 265.003 bits (676), Expect = 1.958e-75
Identity = 175/501 (34.93%), Postives = 279/501 (55.69%), Query Frame = 1
Query:  127 LLPSLIQCFSVILIGYLAVKLSVISS-EGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPIN-FGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALS-FAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICS 1608
            L P+L++CF ++L GY+A + ++I+S + K LG +V++FALPAL F++M  +NF++V+W F+ +V +GK  +F    V TLL+  P + F  AG+  +F TQSND ALGYPI+ +LY    PE  +YIYL AP  L+ +NP+ FI  E  + +    AS     I     + L    V+ NP+V+M  VG+ FNFIL   +P+ ++  L+  A+SFSG ALFYLG+ MVGKI  + +    +L  ++  KL+ LP + RE+V  L +     N T + S   FLYG  P AP V + +  F +  ++I +G+V+ TF+S P+M+++  ++T            +Q+ +  IS +S+   +W L + +LS++ +   H +T    I   + C G++I      N +     V   G  + F + +       LWT L+A+S F + KR+S+   +  +         +P L+   +LI G K N   ID +F YGK Q I +
Sbjct:   40 LFPALLECFGIVLCGYIAGRANIITSTQAKGLGNFVSRFALPALLFKNMVVLNFSNVDWAFLYSVLIGKASVFFIVCVLTLLVASPESRFSKAGLFPIFATQSNDFALGYPIVEALYQSTYPEYLQYIYLVAPISLMMLNPIGFIFCEIQKSKDTQNASQNKAKI-----VGLGFLRVLQNPIVFMVFVGIAFNFILDKKIPVYMENFLDGLANSFSGSALFYLGLTMVGKIRRLKKSAFVVLTLLITAKLLVLPLLCREMVELLDKGDSVVNHT-SLSNYAFLYGVFPVAPGVAIFATQFNMEVEIITSGMVISTFVSAPIMYVSAWLLTFPTMDAKPLAYAIQNVSFDISIISLVSLIWSLSILLLSKKYKQLPHMLTANLLIAQTIVCAGMMIW-----NFVKEKNFV---GQILVFVLLYSSLYSTYLWTGLLAVSLFLLKKRESVQLPVGIIIISGWG---IPALLVGVLLITG-KHNGDSIDSAFFYGKEQMITT 522          

HSP 2 Score: 108.227 bits (269), Expect = 1.696e-23
Identity = 64/183 (34.97%), Postives = 96/183 (52.46%), Query Frame = 1
Query: 1891 QLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDY-FYRF 2436
            QL RH +L +LL++ +      CLW L N     +YVEL+F   VFNFGQGFI + IFGLD  LI++PFKR+  +F  +  E    +E  +S E+     +F  +H + C   I ++ R   K     F G   ++W+++  L   R  A  +G  L+   V++H+         D+Y FYRF
Sbjct:  652 QLTRHVLLCLLLIIGLFANLSSCLWWLFNHETGRLYVELQFFCAVFNFGQGFISFGIFGLDKHLIILPFKRRL-EFLWNNKEAAADRESPVSEEIKMTCQQFVHYHRDLCIRNIVRERRCGAKTSAGTFCGCDLVNWLIEVGLASDRGEAVIYGDRLVQGGVIQHITNEYEF--RDEYLFYRF 831          
BLAST of Integral membrane protein GPR155 vs. Ensembl Mouse
Match: Gpr155 (G protein-coupled receptor 155 [Source:MGI Symbol;Acc:MGI:1915776])

HSP 1 Score: 252.677 bits (644), Expect = 3.217e-71
Identity = 168/501 (33.53%), Postives = 267/501 (53.29%), Query Frame = 1
Query:  127 LLPSLIQCFSVILIGYLAVKLSVISS-EGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPIN-FGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALS-FAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICS 1608
            L P+L++CF ++L GY+A + ++I+S + K LG +V++FALPAL F++M  +NF++V+W F+ +V +GK  +F    V TLL+  P + F  AG+  +F TQSND ALGYPI+ +LY    PE  +YIYL AP  L+ +NP+ FI  E  + +    AS     I     + L    V+ NP+V+M  VG+ FNFIL   +P+ ++  L+  A+SFSG ALFYLG+ MVGKI  + +    +L  ++  KL+ LP + RE+V  L +     N T + S   FLYG  P AP V + +  F +  ++I +G+V+ TF+S P+M+++  ++T            +Q+ +  IS +S+                            + + + C G++I      N +     V   G  + F + +       LWT L+A+S F + KR+S+   +  +         +P L+   +LI G K N   ID +F YGK Q I +
Sbjct:   40 LFPALLECFGIVLCGYIAGRANIITSTQAKGLGNFVSRFALPALLFKNMVVLNFSNVDWAFLYSVLIGKASVFFIVCVLTLLVASPESRFSKAGLFPIFATQSNDFALGYPIVEALYQSTYPEYLQYIYLVAPISLMMLNPIGFIFCEIQKSKDTQNASQNKAKI-----VGLGFLRVLQNPIVFMVFVGIAFNFILDKKIPVYMENFLDGLANSFSGSALFYLGLTMVGKIRRLKKSAFVVLTLLITAKLLVLPLLCREMVELLDKGDSVVNHT-SLSNYAFLYGVFPVAPGVAIFATQFNMEVEIITSGMVISTFVSAPIMYVSAWLLTFPTMDAKPLAYAIQNVSFDISIISL----------------------------VSLTIVCAGMMIW-----NFVKEKNFV---GQILVFVLLYSSLYSTYLWTGLLAVSLFLLKKRESVQLPVGIIIISGWG---IPALLVGVLLITG-KHNGDSIDSAFFYGKEQMITT 494          

HSP 2 Score: 108.227 bits (269), Expect = 1.460e-23
Identity = 64/183 (34.97%), Postives = 96/183 (52.46%), Query Frame = 1
Query: 1891 QLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDY-FYRF 2436
            QL RH +L +LL++ +      CLW L N     +YVEL+F   VFNFGQGFI + IFGLD  LI++PFKR+  +F  +  E    +E  +S E+     +F  +H + C   I ++ R   K     F G   ++W+++  L   R  A  +G  L+   V++H+         D+Y FYRF
Sbjct:  624 QLTRHVLLCLLLIIGLFANLSSCLWWLFNHETGRLYVELQFFCAVFNFGQGFISFGIFGLDKHLIILPFKRRL-EFLWNNKEAAADRESPVSEEIKMTCQQFVHYHRDLCIRNIVRERRCGAKTSAGTFCGCDLVNWLIEVGLASDRGEAVIYGDRLVQGGVIQHITNEYEF--RDEYLFYRF 803          
BLAST of Integral membrane protein GPR155 vs. Ensembl Mouse
Match: Gpr155 (G protein-coupled receptor 155 [Source:MGI Symbol;Acc:MGI:1915776])

HSP 1 Score: 78.1814 bits (191), Expect = 1.029e-15
Identity = 48/124 (38.71%), Postives = 70/124 (56.45%), Query Frame = 1
Query: 1891 QLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKC 2262
            QL RH +L +LL++ +      CLW L N     +YVEL+F   VFNFGQGFI + IFGLD  LI++PFKR+  +F  +  E    +E  +S E+     +F  +H + C   I ++ R  + C
Sbjct:   93 QLTRHVLLCLLLIIGLFANLSSCLWWLFNHETGRLYVELQFFCAVFNFGQGFISFGIFGLDKHLIILPFKRRL-EFLWNNKEAAADRESPVSEEIKMTCQQFVHYHRDLCIRNIVRERRYRICC 215          
BLAST of Integral membrane protein GPR155 vs. UniProt/SwissProt
Match: sp|Q7Z3F1|GP155_HUMAN (Integral membrane protein GPR155 OS=Homo sapiens OX=9606 GN=GPR155 PE=2 SV=2)

HSP 1 Score: 278.87 bits (712), Expect = 1.600e-79
Identity = 173/500 (34.60%), Postives = 282/500 (56.40%), Query Frame = 1
Query:  127 LLPSLIQCFSVILIGYLAVKLSVISS-EGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPIN-FGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICS 1608
            L P+L++CF ++L GY+A + +VI+S + K LG +V++FALPAL F++M  +NF++V+W F+ ++ + K  +F    V TLL+  P + F  AG+  +F TQSND ALGYPI+ +LY    PE  +YIYL AP  L+ +NP+ FI  E  +++    AS   I I     + L L  V+ NP+V+M  +G+ FNFIL   +P+ ++  L+   +SFSG ALFYLG+ MVGKI  + +    +L+ ++  KL+ LP + RE+V  L +     N T + S   FLYG  P AP V + +  F +  ++I +G+V+ TF+S P+M+++  ++T            +Q+ +  IS +S+   +W L + +LS++ +   H +T    I   + C G++I      N +     V   G  + F + +       LWT L+A+S  ++K++    +   +    I G+ +P L+   +LI G K N   ID +F YGK Q I +
Sbjct:   42 LFPALLECFGIVLCGYIAGRANVITSTQAKGLGNFVSRFALPALLFKNMVVLNFSNVDWSFLYSILIAKASVFFIVCVLTLLVASPDSRFSKAGLFPIFATQSNDFALGYPIVEALYQTTYPEYLQYIYLVAPISLMMLNPIGFIFCEIQKWKDTQNASQNKIKI-----VGLGLLRVLQNPIVFMVFIGIAFNFILDRKVPVYVENFLDGLGNSFSGSALFYLGLTMVGKIKRLKKSAFVVLILLITAKLLVLPLLCREMVELLDKGDSVVNHT-SLSNYAFLYGVFPVAPGVAIFATQFNMEVEIITSGMVISTFVSAPIMYVSAWLLTFPTMDPKPLAYAIQNVSFDISIVSLISLIWSLAILLLSKKYKQLPHMLTTNLLIAQSIVCAGMMIW-----NFVKEKNFV---GQILVFVLLYSSLYSTYLWTGLLAISLFLLKKRE--RVQIPVGIIIISGWGIPALLVGVLLITG-KHNGDSIDSAFFYGKEQMITT 524          

HSP 2 Score: 104.76 bits (260), Expect = 1.177e-21
Identity = 63/183 (34.43%), Postives = 96/183 (52.46%), Query Frame = 1
Query: 1891 QLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDY-FYRF 2436
            QL RH +L +LL++ +      CLW L N+    +YVEL+F   VFNFGQGFI + IFGLD  LI++PFKR+  +F  +  +    ++  +S E+     +F  +H + C   I K+ R   K     F G   + W+++  L   R  A  +G  L+   V++H+         D+Y FYRF
Sbjct:  654 QLTRHVLLCLLLIIGLFANLSSCLWWLFNQEPGRLYVELQFFCAVFNFGQGFISFGIFGLDKHLIILPFKRRL-EFLWNNKDTAENRDSPVSEEIKMTCQQFIHYHRDLCIRNIVKERRCGAKTSAGTFCGCDLVSWLIEVGLASDRGEAVIYGDRLVQGGVIQHITNEYEF--RDEYLFYRF 833          
BLAST of Integral membrane protein GPR155 vs. UniProt/SwissProt
Match: sp|Q5R9A7|GP155_PONAB (Integral membrane protein GPR155 OS=Pongo abelii OX=9601 GN=GPR155 PE=2 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 3.803e-78
Identity = 171/500 (34.20%), Postives = 280/500 (56.00%), Query Frame = 1
Query:  127 LLPSLIQCFSVILIGYLAVKLSVISS-EGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPIN-FGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICS 1608
            L P+L++CF ++L GY+A + +VI+S + K LG +V++FALPAL F++M  +NF++V+W F+ ++ + K  +F    V TLL+  P + F  AG+  +F TQSND ALGYPI+ +LY    PE  +YIYL AP  L+ +NP+ FI  E  +++    AS   I I     + L L  V+ NP+V+M  +G+ FNFIL   +P+ ++  L+   +SFSG ALFYLG+ MVGKI  + +    +L+ ++  KL+ LP + RE+V  L +     N T + S   FLYG  P AP V + +  F +  ++I +G+V+ TF+S P+M+++  ++T            +Q+ +  IS +S+   +W   + +LS++ +   H +T    I   + C G++I      N +     V   G  + F + +       LWT L+A+S  ++K++    +   +    I G+ +P L+   +LI GK      ID +F YGK Q I +
Sbjct:   44 LFPALLECFGIVLCGYIAGRANVITSTQAKGLGNFVSRFALPALLFKNMVVLNFSNVDWSFLYSILIAKASVFFIVCVLTLLVASPDSRFSKAGLFPIFATQSNDFALGYPIVEALYQTTYPEYLQYIYLVAPISLMMLNPIGFIFCEIQKWKDTQNASQNKIKI-----VGLGLLRVLQNPIVFMVFIGIAFNFILDRKVPVYVENFLDGLGNSFSGSALFYLGLTMVGKIKRLKKSAFVVLILLITAKLLVLPLLCREMVELLDKGDSVVNHT-SLSNYAFLYGVFPVAPGVAIFATQFNMEVEIITSGMVISTFVSAPIMYVSAWLLTFPTMDPKPLAYAIQNVSFDISIVSLISLIWSQAILLLSKKYKQLPHMLTTNLLIAQSIVCAGMMIW-----NFVKEKNFV---GQILVFVLLYSSLYSTYLWTGLLAISLFLLKKRE--RVQIPVGIIIISGWGIPALLVGVLLITGKHSGD-SIDSAFFYGKEQMITT 526          

HSP 2 Score: 106.686 bits (265), Expect = 2.998e-22
Identity = 64/183 (34.97%), Postives = 97/183 (53.01%), Query Frame = 1
Query: 1891 QLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDY-FYRF 2436
            QL RH +L +LL++ +      CLW L N+    +YVEL+F   VFNFGQGFI + IFGLD  LI++PFKR+  +F  +  E    ++  +S E+     +F  +H + C   I K+ R   K     F G   ++W+++  L   R  A  +G  L+   V++H+         D+Y FYRF
Sbjct:  656 QLTRHVLLCLLLIIGLFANLSSCLWWLFNQEPGRLYVELQFFCAVFNFGQGFISFGIFGLDKHLIILPFKRRL-EFLWNNKETAENRDSPVSEEIKMTCQQFIHYHRDLCIRNIVKERRCGAKTSAGTFCGCDLVNWLIEVGLASDRGEAVIYGDRLVQGGVIQHITNEYEF--RDEYLFYRF 835          
BLAST of Integral membrane protein GPR155 vs. UniProt/SwissProt
Match: sp|Q9LFP6|PIN8_ARATH (Auxin efflux carrier component 8 OS=Arabidopsis thaliana OX=3702 GN=PIN8 PE=2 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 5.045e-7
Identity = 43/158 (27.22%), Postives = 84/158 (53.16%), Query Frame = 1
Query:  610 TRRILL-VLKNVILNPLVYMTVVGVIF---NFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGP 1071
            T +ILL   + +I+NP  Y T++G+I+   +F L  +LP +IDK++ + +D   G+A+F LG+ M  + + I   G  + +  +L K +  P +   ++     I+L S        +  L   LP     F+ + ++ + P++I+TG++ G  ++ P
Sbjct:  207 TMKILLKAWRKLIINPNTYATLIGIIWATLHFRLGWNLPEMIDKSIHLLSDGGLGMAMFSLGLFMASQ-SSIIACGTKMAIITMLLKFVLGPAL---MIASAYCIRLKS----TLFKVAILQAALPQGVVPFVFAKEYNLHPEIISTGVIFGMLIALP 356          
BLAST of Integral membrane protein GPR155 vs. TrEMBL
Match: A0A1S3HMU2 (integral membrane protein GPR155 isoform X4 OS=Lingula unguis OX=7574 GN=LOC106156598 PE=4 SV=1)

HSP 1 Score: 538.11 bits (1385), Expect = 4.287e-175
Identity = 329/831 (39.59%), Postives = 486/831 (58.48%), Query Frame = 1
Query:  109 QDPLENLLPSLIQCFSVILIGYLAVKLSVISS-EGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPINFGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQT------------ICSISVXXXXXXXXXXXXXXQIRFEFLSQIR--LPTSSRKLXXXXXXXXXXXXXLITQMSNES-------DFCQD------------REVCQLILRQYRXXXXXXXXXXXXX--XXXXXFQLNRHKVLTVLLLVTMGFGFFLCLWRLINE----LITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRK---------FNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDYFYRFAK 2442
            +DP  NL P+++QCF +IL GY+A + ++I   +GK +G YV+ FALPAL F+SMAT+NF++VNW F+ ++ + K  LF+  +VFTL++ +P+++G AG+ ++F TQSND ALGYPI+ +LY    P   +YIYL AP  LV +NP+ F ++E  E R        S ++ L    L V K V+LNPLV+MT++G+I NF+ +H LP VID  L +   SFS VALFYLG++MVGKI  I  K +   + +++ KL+ LP +TRE+V+ L Q  ++ N TL YS  GFLYG +PTAP VFL ++ + + P+ IA G V+GTFLS PLMF++ RV+T+ +     Y +IL  T+  +S L I   +W + V IL R+ R   H+  +   I   L CLG++I  + +P+++       GW +YIQF I  +G   +R  T ++AL+   +K +SI F+++        GF VP+L T  +LIF   Q T D DPSFQYG  Q             I S  +L  S I TI+ L+LQ R++        LP +  +          S + + +Q S +S       DF +D            R  C   +RQY ++ T  E   L +  E D+E+Q+ RH V+ ++LL++M  G FLCLWRL  E    + +G+Y+E+EFLD VFNFGQ FI++AIFGLDT+LI+IPF +K         + K       +++P   +L PEV     +F  +H E C+ E+ KD R  ++ Y  VFTG   + W+L+  L    + A A+GQ L++ +V+ HVK   N  +   YFY+F  
Sbjct:   30 EDPFNNLYPAIVQCFVIILCGYIAGRFNLIGKLQGKGIGTYVSTFALPALLFKSMATLNFSEVNWKFLASILIAKAGLFLVVLVFTLILVRPMSYGKAGLYAIFTTQSNDFALGYPIISALYQGTHPNFIEYIYLAAPISLVILNPIGFTMMEL-EKRKESGEHEKSSNLKLA---LHVCKGVLLNPLVFMTIIGIIGNFVFNHKLPAVIDDILTVLGQSFSAVALFYLGLSMVGKIQHIGGKALITPILLIVAKLLILPLVTREIVIGL-QPSVNRNDTLAYSSYGFLYGTIPTAPSVFLYASTYNLAPETIAAGTVIGTFLSAPLMFVSARVITLPVLDPDMYKDILTITSFDVSILGIVCSVWTMTVMILGRKWRKVPHQFVMMLVIAQSLGCLGMIIWHL-IPSNL-------GWAHYIQFVILLVGVFSSRCMTAMVALALCFLKVRSICFVLRNRICLLFGGFGVPILSTGLLLIFTAGQRTTDNDPSFQYGNPQVEEALTELFNKQFILSAVILFISTILTIVCLVLQHRWDRHHHNYHLLPQNDVEDIVPDAPKSKSSKAVGSQSSRDSMNSAPERDFREDTCLLSASCSQAQRRECLERVRQYHKDNTAIEEVTLHSDPEADDEYQITRHVVMLLVLLLSMLIGIFLCLWRLFGEYRENISSGVYIEIEFLDSVFNFGQPFIVFAIFGLDTQLIIIPFVKKLKYKQRSYRWRKLIYGVETIHMPSWDELDPEVKHTCEQFNHYHKERCKKELVKDRRFRMRVYRSVFTGEDLVKWLLEVGLAIDTLDAVAYGQKLVLGRVIVHVKAEHNFYNL-PYFYKFTD 846          
BLAST of Integral membrane protein GPR155 vs. TrEMBL
Match: A0A4S2KZP5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010269 PE=4 SV=1)

HSP 1 Score: 473.396 bits (1217), Expect = 1.913e-154
Identity = 246/515 (47.77%), Postives = 344/515 (66.80%), Query Frame = 1
Query:  112 DPLENLLPSLIQCFSVILIGYLAVKLSVIS-SEGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPINFGMAGILSMFITQSNDVALGYPIMLSLYPELAKYIYLFAPTQLVFINPLCFILLEWHEYRAAC-------LASSTSI----HISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSI--NNSTSVPGWG---------NYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYG 1587
            D ++ L+P+LIQCF VIL+GYLA +  ++S +E + L  YVTKFALPA+FF+ M T++   ++W  + A+SLGK  +F      TLL+ +   FGMA ILSMF++QSNDVALGYP++ +LYPELA Y+YLFAP QL+ +NP+ ++ LEWH+ +          LA    I     ++  RR+L V+  V LNPL +MTV+GVIFNFIL+H++P  ++  L I A+SF+  ALF LG  MVGK+  IT++ + +LV IL+ KL+ LPFI RELVV LV      N+TL YS  GFLYG +PTAPPV+L +  + V+P VI  GLVLGTFL  P++FI  R+VTM +A + +YD +L ST + IS +SI GC+W L + +LSR+     HR T CY +C++LSC G+V+G  FL  ++   N   +P  G         +Y+QF++FFIGCTGAR+WT LIALS  + + +S  F+++   + Y+ GF  PVL+T+ +L    +Q   DIDP FQYG
Sbjct:    8 DAIDELIPALIQCFGVILLGYLAGRYKILSEAEIRGLNSYVTKFALPAVFFKGMVTVDLTGMSWALVGAISLGKATVFFLAFATTLLLNRTSPFGMAAILSMFVSQSNDVALGYPVLKALYPELAIYVYLFAPAQLIILNPIAYLFLEWHQLKQESIDADLKRLADGADITPPASVNKYRRLLQVVWRVALNPLFFMTVIGVIFNFILNHNIPTYVEGLLRIIAESFAATALFTLGFGMVGKMGRITQREVLVLVIILMMKLVILPFINRELVVLLVP-SPDVNETLRYSTFGFLYGAIPTAPPVYLFAAQYHVLPVVIGVGLVLGTFLCAPMIFILARMVTMYMADRSKYDQLLDSTVVGISWISIAGCIWTLFILLLSRKAFRVPHRFTCCYLLCIVLSCFGVVLGH-FLNRTMFDVNGRLIPNDGFLNQPANVLHYLQFSVFFIGCTGARVWTALIALSMFLERLRSTCFVLRKQGWIYLVGFATPVLVTSILLCTSSRQRIKDIDPVFQYG 520          
BLAST of Integral membrane protein GPR155 vs. TrEMBL
Match: A0A4E0RTM1 (Integral membrane protein OS=Fasciola hepatica OX=6192 GN=D915_005185 PE=4 SV=1)

HSP 1 Score: 464.537 bits (1194), Expect = 7.463e-146
Identity = 244/532 (45.86%), Postives = 350/532 (65.79%), Query Frame = 1
Query:   94 NTMTYQDPLENLLPSLIQCFSVILIGYLAVKLSVISSEGKALGI--YVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPINFGMAGILSMFITQSNDVALGYPIMLSLYPELAKYIYLFAPTQLVFINPLCFILLEW-------HEYRAACLASST---SIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIG---------RIFLPNSINNS--TSVPG-WGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICSISV 1617
             ++  +D ++ L+P+LIQCF VI++GYL  + +++S E +ALG+  YVTKFALPA+FFR M +I+F+ V W  + A+S+ KL+ F+   V T+L+++    G+A IL+MF++QSNDVALGYP++ +LYPELA YIYLFAP QLV +NP  +  LEW        E     L S+T      +   RR L     V+LNPL +MTV+GV+FNFIL H +P  +D  L+I A+SF+  ALF LG  MVGK++ IT+  ++IL  ILL KL+ LPFI+RE+VV ++  +   N+TL YS  GFLYG +PTAPPV+L +  + V+P VI  GLVLGTFL  P+MFI  R VTM +A   +YD++L ST   +S +SI GC+W  +V +LSR+     HR  +C  ICVLLSC+G+VIG         +  L   +      S+P  W +YI F++FFIGC+GAR WT L+ALS  + + + + F+++   +FY+ GF  P+L T+ +L+  +++   D+ P+FQYGK Q I S+ V
Sbjct:    2 TSLESKDAVDELIPALIQCFGVIVLGYLTGRWNLLS-ESQALGLNAYVTKFALPAVFFRVMVSIDFSGVCWYMVSAISVSKLIAFVLAFVITVLLSRSSQLGLAAILAMFVSQSNDVALGYPVLKALYPELASYIYLFAPAQLVVLNPFAYFALEWSQAKRVERELSDESLESATRPVPTSVCRYRRALQACWRVVLNPLFFMTVIGVVFNFILHHQIPYYVDGLLKIVAESFAATALFTLGFGMVGKMSTITKHELHILASILLAKLVLLPFISREMVVLMLPSE-HVNETLRYSTFGFLYGAIPTAPPVYLFAAQYGVMPAVIGVGLVLGTFLCAPMMFILSRTVTMYLAEPSEYDHLLGSTVADVSWISIVGCIWTFIVLLLSRKAFRIPHRFVLCQMICVLLSCVGVVIGSFLHQLEHRKYALQTHVTREHLQSMPADWFHYIHFSVFFIGCSGARFWTTLLALSLFLQRLRGVCFILRHQTWFYLVGFVTPLLATSLLLLTSRRERVKDVSPAFQYGKNQLITSLIV 531          

HSP 2 Score: 95.1301 bits (235), Expect = 3.758e-16
Identity = 56/149 (37.58%), Postives = 80/149 (53.69%), Query Frame = 1
Query: 1888 FQLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSS-CHELYVPKEKD---LSPEVIEIRNK---FCTFHLETCRNEICKDMRLSVKCYH---DVFTGRQFIDWI 2304
            F   RH +L ++L  TM FG  LC WRL+ E  +G+Y+ LEFLD VFNFGQG +L+ IFGLD  LI++P +R   +   S C  +      D    +P+   ++ +   F TFH+ +C   I K    SV   H    +FT    + W+
Sbjct:  724 FHHQRHLILILVLSTTMFFGICLCTWRLVQEPASGVYLVLEFLDGVFNFGQGIVLFVIFGLDADLIILPIRRFVGRHVRSWCGTVLDMTALDSIVEAPDPATLKERCVQFVTFHMTSCCTSIAKTSS-SVSPVHPTDTLFTEEALVKWL 871          
BLAST of Integral membrane protein GPR155 vs. TrEMBL
Match: A0A4Z2DIM3 (Integral membrane protein OS=Schistosoma japonicum OX=6182 GN=EWB00_000575 PE=4 SV=1)

HSP 1 Score: 461.84 bits (1187), Expect = 2.216e-145
Identity = 247/540 (45.74%), Postives = 344/540 (63.70%), Query Frame = 1
Query:   91 NNTMTYQDPLENLLPSLIQCFSVILIGYLAVKLSVIS-SEGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPINFGMAGILSMFITQSNDVALGYPIMLSLYPELAKYIYLFAPTQLVFINPLCFILLEWHEYRA-----------------------ACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIF------LPNSINNSTSVPG-WGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICSISV 1617
            N+    +D  + L+P L+QCF VIL+GY+A +L V S S+ K L  YVTKFALP +FFR+M TIN + V W F++A+S+ KL+ F+  ++FT LI++  + G+A I++MF++QSNDVAL YPI+ +L+P+LA Y+YLFAP QLV +NP  + LLE    ++                          +S+++      R++ LVL NV+ NPL +MTV+GVIFNFIL H LPL +D  L++ ADSFS  ALF LG  MVGK+  IT++ +YIL  ILL KL+ +PFITRELVV ++   +  N+TL YS  GFLYG  PTAPPV+L + ++QVIP  I  GLVLGTFL  P+MFI  R++T+  A+   Y  IL  TA  IS +SI  C+W + V    R++    +R T+C+ ICVL SC G+++GR          +SI +  S P  W NY+QFAIFF GCTG R WT L+AL   + + +S+ F+++   + Y+ GF  P+++T  +L+    Q   DIDP FQYG  Q I SI V
Sbjct:   17 NSATNSRDAFDELIPVLVQCFGVILLGYIAGRLKVFSESQAKGLNFYVTKFALPTVFFRAMVTINLSGVCWFFVMAISVSKLIGFLMAIMFTFLISRRFHLGIAAIVAMFVSQSNDVALAYPILYALFPDLASYVYLFAPAQLVILNPFSYFLLELERVKSFNSELKPLIDDDDDDGSDKKQLINDKSSNSAPSSHKYRQLALVLFNVLKNPLFFMTVIGVIFNFILKHQLPLYVDGLLKVIADSFSATALFSLGYGMVGKMATITQREVYILTAILLTKLLVVPFITRELVVQMMPAAMQ-NETLRYSTFGFLYGSTPTAPPVYLFAAEYQVIPVAIGVGLVLGTFLCAPIMFIFARIITVYNAAPSDYAIILGKTAEDISWISIGCCIWTIGVLCFCRKITRVPNRFTLCHLICVLFSCSGVLLGRFVNQYYRTYEDSIGDKLSQPAHWLNYVQFAIFFFGCTGTRCWTTLVALVLVMERARSLCFVLRYQLHIYLVGFLTPIVVTFILLLTSSGQMVKDIDPVFQYGTNQLIMSIIV 555          

HSP 2 Score: 107.457 bits (267), Expect = 5.583e-20
Identity = 60/187 (32.09%), Postives = 98/187 (52.41%), Query Frame = 1
Query: 1897 NRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNK---------FFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVK---RNRNLIDSDD 2421
            ++H +  +L+LVTM FG  LC WRL++E  TGIY+ LEFLD  FNFGQG +L+ +FGLDT L ++P KR F++         F  S  E  +    D + ++  I N+F  FHL++C + I     +    Y  VF       W+  + + ++     ++ + L +  ++  +     N + I+ D 
Sbjct:  683 HKHVIFLILILVTMFFGICLCTWRLVHEAPTGIYIVLEFLDGSFNFGQGVVLFVLFGLDTDLFIMPTKRFFSRWLNRFTGKHFIGSLGETPLQATIDNNIKIDRIVNQFVKFHLKSCSSNIGHAKVIDSIHYEQVFHQYALEKWLTDAGITDSNDETISYIECLELGNIITCISPFVTNESFINKDS 869          
BLAST of Integral membrane protein GPR155 vs. TrEMBL
Match: D7GXJ5 (DEP domain-containing protein OS=Tribolium castaneum OX=7070 GN=TcasGA2_TC015971 PE=4 SV=1)

HSP 1 Score: 455.292 bits (1170), Expect = 1.806e-143
Identity = 282/830 (33.98%), Postives = 460/830 (55.42%), Query Frame = 1
Query:  118 LENLLPSLIQCFSVILIGYLAVKLSVIS-SEGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPINFGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAA------CLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIF-GKKQNTVDI-DPSFQYGKIQTICSISVXXXXXXXXXXXXXXQIRF----------------------EFLSQIRLP---TSSRKLXXXXXXXXXXXXXLITQ---------------MSNESDFCQDR--------EVCQLILRQYRXXXXXXXXXXXXXXXXXXFQLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKR-----NRNLI 2409
            +ENL P+L +CF++IL GY A ++++IS +E K +  +V  F+LP+L F S+A ++ + VNWLF+LA+ + K ++F   +V TLL+ +P+NFG AGI ++F TQSND A+GYPI+ +LY    PE A Y+YL AP  L  +NP+ F+ +E                   S ++   + ++ V K++ LNP+V MT++G++ N++  HH+P  +   L++   +FS  ALF LG+ MVGK++ +    + +   +++ KLI LP +TRE VV ++ +  + ++T++ S  GFLYG  P+AP VF+ +  + +  D+IA+ +V  TF+S PLMF++ +++T+      +Y   L S  + IS ++I  C WV++VFIL++++    H++T C  I  L+SCLG V+    LP   N       W  YI  +IF +G    RLWT ++A++   ++ +S+ +++K    F+  G+ +P ++T  +L+F GK    +D  +P+F YG  Q I +I++L    I T   LILQ R+                      E  + I  P   TSS    +   + +      I +               ++ ++  C  R        E CQ I+RQY+E I  +     E    +E Q  RH VL +LLL +M  G  + +W L+ E I+GIY+EL FLD   NFGQ  I++ IFGL+ K +V+P  +     +   + L +P   +LSPE   I ++F T HL++CRN I  D R  +K Y  VFTG +F+DW++   L   R  A  + + L+  +V++H+       +RNL+
Sbjct:   15 IENLYPALTECFAIILCGYAAGRMNMISETEAKGINTFVGTFSLPSLIFMSLAQLDLSSVNWLFLLAILIAKSIVFFSVIVVTLLVGRPVNFGRAGIFAIFCTQSNDFAIGYPIVAALYKNSHPEYASYLYLMAPISLAILNPISFVFMEIGRRNGGGNTDFLLDGDLVSRNMYRFKMVVSVTKSIFLNPIVLMTILGILGNWVFRHHIPCYLGGVLDVLGSAFSASALFLLGLRMVGKVHKLRGATLVVPGILIMVKLIALPLVTRE-VVSIIHVGYNKSETVDLSTYGFLYGTFPSAPTVFVFATQYFIDVDLIASAMVACTFISAPLMFVSAKMITITKTDPSEYIKQLDSFTLDISIVAIIACGWVILVFILTKKIARLPHKITACLIISQLISCLGAVLYNT-LPQKDN-------WSGYIP-SIFIMGVYSTRLWTTILAVTLLFLQCRSLCYVLKLQPIFFTVGWGIPAILTVVLLLFDGKNHRPLDKRNPNFVYGTYQAIVAIALLVLCFIVTAGCLILQQRYHRRFTRYLDLAQDISDSPSTSSEIETNIESPNPGTSSDSGISPGKSTKCGGLPTINEGCCEESPVDIEDLFPVNGDTGLCPSRFGCQGPKREQCQGIVRQYQETIDDDLEFIEEEPELHEPQFLRHTVLLILLLCSMFVGLAISIWTLVMEQISGIYIELSFLDATLNFGQSIIVFGIFGLEVKEVVLPLLKLKRLLWYGSNSLVLPSWHELSPETRHICDQFITHHLQSCRNAIATDKRWRIKVYKSVFTGIEFVDWLITVGLARDRGEAVNYARHLIEGKVLKHINGVYHFYDRNLL 834          
BLAST of Integral membrane protein GPR155 vs. Ensembl Cavefish
Match: gpr155a (G protein-coupled receptor 155 [Source:NCBI gene;Acc:103030501])

HSP 1 Score: 267.314 bits (682), Expect = 9.396e-77
Identity = 171/503 (34.00%), Postives = 287/503 (57.06%), Query Frame = 1
Query:  118 LENLLPSLIQCFSVILIGYLAVKLSVISS-EGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLIT-KPINFGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICS 1608
            ++ L P+L++CF +IL GY A ++++I+S + K LG +V+KFALPAL F++M  ++F++V W F+ ++ + KL +F    V TLL+T K   F  AG+ S+F TQSND ALGYPI+ +LY    PE  +YIYL AP  L+ +NP+ F   E  + R     S      S    + +VL  V+ NP+V+M VVG+  +FIL   +P  +++ ++  A+SF G ALFYLG+ MVG++  +TR  +  L+ ++  KL+ +P I R +V  L    +SS    + S   FLYG  PTAP V + +  + +   V+ +G+V+ TFLS P+M+++  ++T+         + LQ+ + +IS +S+F  +W + V I+S++    +HR+   +T  + ++ LG+ +G I     +     +   G  + F + +       +W  LI LS  +++R     L     +  I G+ +PVL  + +L+ G+K     ID +F +G  Q +C+
Sbjct:   29 IDKLFPALLECFGIILCGYAAGRMNIITSTQAKGLGNFVSKFALPALLFKNMVLLDFHNVIWPFLWSILVAKLCVFFIVCVLTLLVTNKESRFSKAGLYSIFATQSNDFALGYPIVEALYRNNHPEYMQYIYLVAPVSLMVLNPIGFAFCEVQKRR-----SEQGPQQSKLHVVGVVLLQVLRNPIVFMVVVGIASHFILGQKIPGFMEEFVDGLANSFGGAALFYLGLTMVGQLRKLTRSTVVALILLITAKLLVMPLICRGMVEVLDTGNISSLNHSSLSNYAFLYGVFPTAPSVAIYAAHYNMELQVVTSGMVISTFLSAPIMYVSAWLLTIPWMDPKPLASALQNISFNISIVSLFALVWCVAVNIMSKK----IHRLPHMFTFNLFMAQLGVCVGMIAWNFVVVKDNFL---GQVLTFTLLYGSLYSTYIWPGLIVLSLYLLRRDE--ELKVQPGFIMIVGWGLPVLAMSILLMVGEKMPDT-IDSAFFFGTSQIVCT 516          

HSP 2 Score: 96.2857 bits (238), Expect = 6.516e-20
Identity = 55/182 (30.22%), Postives = 90/182 (49.45%), Query Frame = 1
Query: 1891 QLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDYFYRF 2436
            Q+ RH +L +LL V++      CLW L++ +   +Y+EL+F     NFGQGF+ + IFGLD   I++PFK++        H      + D+S E+    N+F  +H E C  +I    +   +   + F G + + W+    L   +  A  +G  LL   V+ H+  +   +D D   YRF
Sbjct:  635 QVARHVLLCLLLTVSLLANLSSCLWWLLSTVPGRLYLELQFFCAAVNFGQGFLCFGIFGLDKHFIILPFKKRLAN-LRRAHGREAAGQADVSDEIRLTCNQFLKYHKEQCVQDIVHKKKCGKRSVAETFLGSEMVQWLQTVGLASDQGEALLYGSRLLEGGVIHHITHDFGFLD-DILHYRF 814          
BLAST of Integral membrane protein GPR155 vs. Ensembl Cavefish
Match: gpr155b (G protein-coupled receptor 155b [Source:ZFIN;Acc:ZDB-GENE-110815-2])

HSP 1 Score: 208.764 bits (530), Expect = 1.927e-59
Identity = 132/372 (35.48%), Postives = 220/372 (59.14%), Query Frame = 1
Query:   91 NNTMTYQDP----LENLLPSLIQCFSVILIGYLAVKLSVIS-SEGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPIN-FGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSI 1176
            N T   Q P    +  L P+L++CF ++L GY+A    V+   + K LG +V+ FALPAL F++M  + F DV W F+ +V + K+ +F+   V TLL+  P + +  AG+ S+F TQSND ALGYPI+ +LY    P+  +Y+YL AP  L+ +NP+ F L E   +R +   S + +HI     I  V+  VI NP+V+M  VG++ +F+    +P++I + ++  ADSF G ALFYLG+ MVG+++ +TR     L+ ++  KL+ +P + ++++  L     SS    + S   FLYG  PTAP V + ++ + +  +V+ +G+V+ T LS P+M+++  ++T+         + LQ  + +IS +S+
Sbjct:   12 NITHNPQSPPAMSIGRLFPALLECFGIMLCGYVAGCTGVVGPGQVKGLGSFVSCFALPALLFKNMVQLQFEDVVWSFLWSVLIAKVCVFVLVCVLTLLVADPESRYSKAGLFSIFTTQSNDFALGYPIVEALYRSSHPDYGQYLYLVAPVSLMLLNPVGFALCELQRWRQSPDHSLSKLHI-----ISTVVLRVIKNPIVFMVAVGIVCHFLFGGRVPVLIAEFVDGLADSFGGAALFYLGLTMVGQMHKLTRTTGVTLIMLITAKLLVMPLMCKDMLELLDAGNSSSANHSSLSDYAFLYGVFPTAPSVAIYASQYNMQLEVVTSGMVISTLLSAPIMYLSAWLLTIPWMEATHLISELQEVSFNISIISL 378          
BLAST of Integral membrane protein GPR155 vs. Ensembl Cavefish
Match: ENSAMXT00000039765.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000157.1:319944:327585:-1 gene:ENSAMXG00000033114.1 transcript:ENSAMXT00000039765.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 8.808e-12
Identity = 43/124 (34.68%), Postives = 67/124 (54.03%), Query Frame = 1
Query: 1891 QLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVI--EIR---NKFCTFHLETCRNEICKDMR 2247
            Q+ RH +L +LL+V++      CLW L+N     +Y+EL+F   V N+GQGFI + IFGLD  LI++PFK++    +         +E++  P  +  EIR    +F  +H   C  +I    R
Sbjct:   38 QVARHVLLCLLLIVSLLANLSSCLWWLLNTDPGRLYLELQFFCAVANYGQGFISFGIFGLDEHLIILPFKKRLAALWGG------GQEENGGPAAVPEEIRLTCTQFVRYHKNQCVQDIVHKRR 155          
BLAST of Integral membrane protein GPR155 vs. Ensembl Sea Lamprey
Match: gpr155b (G protein-coupled receptor 155b [Source:ZFIN;Acc:ZDB-GENE-110815-2])

HSP 1 Score: 224.557 bits (571), Expect = 2.131e-62
Identity = 149/504 (29.56%), Postives = 255/504 (50.60%), Query Frame = 1
Query:  118 LENLLPSLIQCFSVILIGYLAVKLSVISSEG-KALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPIN-FGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICSI 1611
            ++ L P+L++CF  +L GY A +  ++   G + LG +V+ FALPAL FR+M  ++F  V+W F+LAV   K+ +F+   V TLL   P + F  AG+  +F TQSND ALGYPI+ +LY    PE  +YIYL AP  LV +NP+ F+  E    R   +                + K  +     +    G   NF+L+  +P ++ + L+    +F   A FYLG++MVGK+   TR  +  ++ ++  K++  P + RE+ V L++ +   N T +    GFLYG  PTAP V + ++ + +  + ++TG+V+ TFLS PLM+++  ++ M     +    +L S +  I  + +   +WVL + +LSRR R   H  +I      LL+C+G+V   +         T        + F + +     + LWT L+ +    +K++        +     +G  +P      ++         +IDP+F +G+ Q + ++
Sbjct:    8 VDRLFPALLECFGTVLCGYAAGRSGLVPPSGARGLGGFVSSFALPALLFRNMVVLDFAVVSWGFLLAVLATKVAVFVLVCVVTLLTAAPASRFAKAGLFPIFATQSNDFALGYPIVQALYQATNPEYVQYIYLVAPISLVLLNPVGFVFCELQRRRNVEVEGPVEEEEEEVEVERALQKVRLFYEWRFGGGAG---NFLLARKVPELVSRFLDSLGAAFGASAQFYLGLSMVGKMQSHTRGTVVSIILLITAKVLVFPLLCREM-VELLETRGEKNHT-SLRDFGFLYGVFPTAPSVIIYASRYAMEIETLSTGMVVCTFLSAPLMYVSSWLLAMPRLDDHVTRAVLDSVSFDIGIVGLIFLVWVLGLAVLSRRYRQLPHFFSINLFAAQLLTCVGMVFWHVL-------GTGAGTLARVLAFILLYAPMCSSYLWTELLLVMLYSLKQQQQHSGHPGMMTVVAWG--LPAFAVGILVALSGDMRKYEIDPAFFWGRSQVVMTV 497          

HSP 2 Score: 85.1149 bits (209), Expect = 3.378e-17
Identity = 55/172 (31.98%), Postives = 83/172 (48.26%), Query Frame = 1
Query: 1891 QLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSP------EVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHV 2388
            Q  RH +L +LLL+ M       LW L++  I G Y+E +F   V NFGQGF+ + +FGLD  LI+IPFKR+  + + S      P+     P      EV     +F  FH E C  +I  + R   +       G + + W++ + L E R  A  + + LL   V+  +
Sbjct:  620 QAGRHVLLCLLLLIAMFLSMCTGLWWLLSSTIGGPYLEFKFTCAVCNFGQGFLSFVLFGLDKHLIIIPFKRRLQRLWGSAALSPSPRGPTSGPLRGPNKEVAMTCRQFLHFHRERCCGDIVHERRCGRRRVRVCL-GSELVGWLVAAGLSEDRDGATRYAERLLCGGVIARL 790          
BLAST of Integral membrane protein GPR155 vs. Ensembl Nematostella
Match: EDO43618 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY20])

HSP 1 Score: 274.633 bits (701), Expect = 1.716e-79
Identity = 158/458 (34.50%), Postives = 258/458 (56.33%), Query Frame = 1
Query:  118 LENLLPSLIQCFSVILIGYLAVKLSVISS-EGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPINFGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQ--YDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMK 1470
            + NL P+L++CF +I++GY + ++  +SS + K +G +V+  ALPAL F+SM  ++F  VNW F+ A+ L K  +F    +FT+L+T+   +G AGI ++F TQSND ALGYP++ +LY    PE  +YIYL AP  LV +NP+ F+LLE        L  +  +  S +  +   +K V+ NP+V MT +G++ NFIL   +P +    L++   SF   ALF+LG+ MVG +      G+ +   ++  K++ LP + RE  V ++ +    N T ++S+ GFLYG  PTAP V + ++ + V  DV+A+ +V+GTFLS PLM+I+ R+  M    +    Y  +L +T    SS+ +   +WV+++F+L RR     H+ T+   I  ++ C+ +++  I   NS N          Y    +F +  T  +   C +A+    +     GF MK
Sbjct:   29 INNLFPALVECFVIIILGYGSGRMGFVSSTQSKGIGWFVSHIALPALLFKSMVVLDFQAVNWRFLAAILLAKGTVFASVAMFTVLVTRSNKYGKAGIFAIFATQSNDFALGYPLLKALYQHSMPEYLQYIYLLAPVSLVCLNPIGFVLLE--------LGRNKKMQQSKSHLVFATIKGVLTNPIVVMTFIGILGNFILKQEVPSLFVGLLDVLGQSFFASALFFLGLKMVGNMKKQLGYGLIVPFLLIFAKMLLLPLLAREF-VQVLHVSNVRNGTDSWSMFGFLYGTFPTAPTVVIFASKYGVETDVMASSMVIGTFLSAPLMYISARMAAMKYTHQVSSAYYKLLNNTVSDASSVGLPCGVWVILMFVLGRRYGVFPHKFTLYLVISQVVLCISVLLAEI---NSTN---------EYWHMIVFLLHTTALQCCKCWVAVVAVCLCVVRCGFEMK 465          

HSP 2 Score: 139.428 bits (350), Expect = 6.799e-34
Identity = 69/185 (37.30%), Postives = 108/185 (58.38%), Query Frame = 1
Query: 1891 QLNRHKVLTVLLLVTMGFGFFLCLWRLINE-LITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDYFYRFAK 2442
            QL  H V+ ++ L++M    FL LW L+ E   +GIY+ L  LD +  FGQ FI++A FGL+ +LI+IPF +++ +F+    +L +P   +L P+VI +  +F   H   CR  +  D R  ++ Y +VF G Q +DW+L   L E R  A  +G +LL+ +++EHV +     D   YFY+F K
Sbjct:  666 QLGGHVVMLLIFLISMCLTIFLNLWCLLGESRESGIYIALRELDTILTFGQSFIVFACFGLEKQLIIIPFVKRWRRFWYGAEDLALPPPGELDPDVIHLCEQFRKHHKLKCRRALVSDKRYRLRTYKNVFRGDQMVDWLLDCGLVEDRPAAVHYGNSLLLGRIIEHVTKEHAFYDR-PYFYKFVK 849          
BLAST of Integral membrane protein GPR155 vs. Ensembl Medaka
Match: gpr155a (G protein-coupled receptor 155 [Source:NCBI gene;Acc:101161592])

HSP 1 Score: 285.034 bits (728), Expect = 3.628e-83
Identity = 180/516 (34.88%), Postives = 294/516 (56.98%), Query Frame = 1
Query:  112 DPL------ENLLPSLIQCFSVILIGYLAVKLSVISS-EGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPIN-FGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYI-QFAIFFIGCT---GARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKK-QNTVDIDPSFQYGKIQTICS 1608
            DPL      + LLP+L++CF +IL GY+A + ++I+S + K LG +V+KFALPAL F++M  ++FNDV W F+ ++ + K+ +F    V TL++  P + +  AG+ S+F TQSND ALGYPI+ +LY    PE  +YIYL AP  L+ +NP+ F L E  +++      +   H  L    L+VL+ V+ NP+V+M V+G+I +F+L   +P  + + ++  A+SF G ALFYLG+ MVG++  +TR  +  L+ +   KL+ +P I +++V  L      +    + S   FLYG  PTAP V + +  +     V+ +G+V+ TFLS P+M+++  ++T+         N LQ+ + ++S +S+F  +W + V  LS++ +   H  T+   +  LL+C+G++     +             GN+I Q   F + CT      +W  LIALS  + K+     L  +     I G+ +P ++TA +L  G+K  NT  IDP + YGK Q IC+
Sbjct:   19 DPLPSTMSIDKLLPALLECFGIILCGYIAGRTNIITSTQAKGLGNFVSKFALPALLFKNMVLLDFNDVIWPFLWSILIAKVSVFCLVCVLTLIVANPDSRYSKAGLFSIFATQSNDFALGYPIVEALYQTTHPEYLQYIYLVAPVSLMLLNPIGFALCEVQKWKNH---ENHEQHNKLCILGLVVLQ-VLKNPIVFMVVIGIIAHFVLHQTIPPFMAEFVDGLANSFGGAALFYLGLTMVGQLRKLTRSTVVTLILLTTAKLLLMPLICKDMVDLLDNNSTDAANQSSLSDFAFLYGVFPTAPSVAIYAVYYNAELQVVTSGMVISTFLSAPIMYLSAWLLTVRKMDPQLLMNSLQTVSFNMSIVSLFALVWTIAVMFLSKKYKRLPHMFTVNLFLAQLLTCIGMIQWNFVVKE-----------GNFIGQILTFTLLCTSLYSTYMWPGLIALSVLLTKKHDD--LKGSSGLLVIAGWGIPCIVTAALLCSGQKLPNT--IDPLYFYGKEQIICT 515          

HSP 2 Score: 105.531 bits (262), Expect = 7.895e-23
Identity = 61/180 (33.89%), Postives = 97/180 (53.89%), Query Frame = 1
Query: 1891 QLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDYFY 2430
            Q+ RH +L +LL V +      C+W L N     +Y+EL F   + N+GQGF+ +A+FGLD  LI++PFKR F ++F    +    ++ DL  ++     +F  +H + C  +I K+ R   K     F G +F+DW+L+  L + R  A  +G  L    V++H+K   +  DS  YFY
Sbjct:  634 QVVRHVLLCLLLTVNLLANLSTCIWLLCNHAPGRLYLELLFFCAIVNYGQGFLSFALFGLDKHLILLPFKRFFTRWFRRKQK----QQPDLPDDIRMTCTQFTKYHKQQCCCDIVKNQRCGRKTVMKCFLGCEFVDWLLQVGLAQDRGEAVLYGTQLQQGGVLQHIKDEFSFQDSPLYFY 809          
BLAST of Integral membrane protein GPR155 vs. Ensembl Medaka
Match: gpr155b (integral membrane protein GPR155 [Source:NCBI gene;Acc:101175018])

HSP 1 Score: 272.322 bits (695), Expect = 9.960e-79
Identity = 169/512 (33.01%), Postives = 287/512 (56.05%), Query Frame = 1
Query:  118 LENLLPSLIQCFSVILIGYLAVKLSVIS-SEGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPIN-FGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVIL----NPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELV--VHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICSISV 1617
            ++ L P+L++CF +IL GY+A +  +I+ S+ K LG +V+KFALPAL F++M  ++F DV W F+ +V + K+ +F+   V TL++  P + +  AG+ ++  TQSND ALGYPI+ +LY    PE  +YIYL AP  L+ +NP+ F L E   ++           +   R  LL+L  V+L    NP+V+M +VG+I +F L   +P V+ + ++  A+SF G ALFYLG+ MVG++  +TR     L+ ++  KL+ +P + ++LV  + +   + S+N T + S   FLYG  PTAP V + +  + +  +V+ +G+V+ TFLS P+M+++  ++T+ +         L++ + + S +S+   +W + V +LSR+     H   +   +   L C+G++     L N +     V   G  + F + +       +WT LI L  A+  R  +  L      F + G+ +P L+   +L+ G++ NT  ID +F YG+ Q I S  V
Sbjct:   31 IDKLFPALLECFGIILCGYVAGRADIITESQAKGLGNFVSKFALPALLFKNMVLLDFGDVIWAFLWSVLVAKVAVFLLVCVLTLMVASPDSRYSKAGLYAILATQSNDFALGYPIVDALYRSTYPEYLQYIYLVAPVSLMLLNPIGFALCEVQRWKQT---------LQPQRSRLLILGVVVLQLMKNPIVFMVMVGIISHFALGQRIPAVLSEFIDGLANSFGGAALFYLGLTMVGQLRKLTRDTGVALILLITAKLLVMPLVCKDLVDILDVGANKTSANHT-SLSNFAFLYGAFPTAPSVAIYAGHYNMELEVVTSGMVISTFLSAPIMYVSAWLLTIPLMDPAPLMAELENVSFNSSVVSLVALVWTIGVMLLSRKFTRLPHIFALNLFLAQFLVCIGMI-----LWNFLVKQEDVL-LGQILTFTLLYGSLYSTYIWTGLIPLCMALTNRDDL--LRLRPGVFMVLGWGIPFLMAGILLLLGERTNT--IDSAFFYGRAQIITSAVV 522          

HSP 2 Score: 66.6254 bits (161), Expect = 8.820e-11
Identity = 34/97 (35.05%), Postives = 55/97 (56.70%), Query Frame = 1
Query: 1957 CLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVI--EIR---NKFCTFHLETCRNEI 2232
            CLW L NE    +Y+EL+F   V N+ QGF+ + IFGLD  L+++PFK++    +         +++DLSP  +  E+R    +F  +H + C  +I
Sbjct:  667 CLWWLFNEDPGRLYLELQFFCAVANYAQGFLSFGIFGLDRNLVLLPFKKRLLSMWRGR------EDEDLSPAGVPEEVRLTCTQFVRYHKDQCVQDI 757          
BLAST of Integral membrane protein GPR155 vs. Ensembl Medaka
Match: gpr155b (integral membrane protein GPR155 [Source:NCBI gene;Acc:101175018])

HSP 1 Score: 272.322 bits (695), Expect = 6.451e-78
Identity = 166/512 (32.42%), Postives = 286/512 (55.86%), Query Frame = 1
Query:  118 LENLLPSLIQCFSVILIGYLAVKLSVIS-SEGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPIN-FGMAGILSMFITQSNDVALGYPIMLSLY----PELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVIL----NPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELV--VHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICSISV 1617
            ++ L P+L++CF +IL GY+A +  +I+ S+ K LG +V+KFALPAL F++M  ++F DV W F+ +V + K+ +F+   V TL++  P + +  AG+ ++  TQSND ALGYPI+ +LY    PE  +YIYL AP  L+ +NP+ F L E   ++           +   R  LL+L  V+L    NP+V+M +VG+I +F L   +P V+ + ++  A+SF G ALFYLG+ MVG++  +TR     L+ ++  KL+ +P + ++LV  + +   + S+N T + S   FLYG  PTAP V + +  + +  +V+ +G+V+ TFLS P+M+++  ++T+ +         L++ + + S +S+   +W + V +LSR+     H   +   +   L C+G+++        +     +   G  + F + +       +WT LI L  A+  R  +  L      F + G+ +P L+   +L+ G++ NT  ID +F YG+ Q I S  V
Sbjct:   31 IDKLFPALLECFGIILCGYVAGRADIITESQAKGLGNFVSKFALPALLFKNMVLLDFGDVIWAFLWSVLVAKVAVFLLVCVLTLMVASPDSRYSKAGLYAILATQSNDFALGYPIVDALYRSTYPEYLQYIYLVAPVSLMLLNPIGFALCEVQRWKQT---------LQPQRSRLLILGVVVLQLMKNPIVFMVMVGIISHFALGQRIPAVLSEFIDGLANSFGGAALFYLGLTMVGQLRKLTRDTGVALILLITAKLLVMPLVCKDLVDILDVGANKTSANHT-SLSNFAFLYGAFPTAPSVAIYAGHYNMELEVVTSGMVISTFLSAPIMYVSAWLLTIPLMDPAPLMAELENVSFNSSVVSLVALVWTIGVMLLSRKFTRLPHIFALNLFLAQFLVCIGMILWNFL----VKQEDVL--LGQILTFTLLYGSLYSTYIWTGLIPLCMALTNRDDL--LRLRPGVFMVLGWGIPFLMAGILLLLGERTNT--IDSAFFYGRAQIITSAVV 522          

HSP 2 Score: 66.6254 bits (161), Expect = 9.725e-11
Identity = 36/114 (31.58%), Postives = 58/114 (50.88%), Query Frame = 1
Query: 1957 CLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVI--EIR---NKFCTFHLETCRNEICKDMRLSVKCYHDVFTG 2283
            CLW L NE    +Y+EL+F   V N+ QGF+ + IFGLD  L+++PFK++    +         +++DLSP  +  E+R    +F  +H + C  +I    R       +   G
Sbjct:  667 CLWWLFNEDPGRLYLELQFFCAVANYAQGFLSFGIFGLDRNLVLLPFKKRLLSMWRGR------EDEDLSPAGVPEEVRLTCTQFVRYHKDQCVQDIVLTRRFEGGPQQEDAAG 774          
BLAST of Integral membrane protein GPR155 vs. Planmine SMEST
Match: SMESG000041494.1 (SMESG000041494.1)

HSP 1 Score: 1522.68 bits (3941), Expect = 0.000e+0
Identity = 812/814 (99.75%), Postives = 812/814 (99.75%), Query Frame = 1
Query:   82 MIKNNTMTYQDPLENLLPSLIQCFSVILIGYLAVKLSVISSEGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPINFGMAGILSMFITQSNDVALGYPIMLSLYPELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICSISVXXXXXXXXXXXXXXQIRFEFLSQIRLPTSSRKLXXXXXXXXXXXXXLITQMSNESDFCQDREVCQLILRQYRXXXXXXXXXXXXXXXXXXFQLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDYFYRFAKPTCVDIKDLGSSDXXXXXXXXSITQHR 2523
            MIKNNTMTYQDPLENLLPSLIQCFSVILIGYLAVKLSVISSEGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGK LLFICTVVFTLLITKPINFGMAGILSMFITQSNDVALGYPIMLSLYPELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICSISVLAFSIISTILFLILQIRFEFLSQIRLPTSSRKLSNSSDNDQNSEENLITQMSNESDFCQDREVCQLILRQYREEITLEERAALEAELDNEFQLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDYFYRF KPTCVDIKDLGSSDLTETEELESITQHR
Sbjct:    1 MIKNNTMTYQDPLENLLPSLIQCFSVILIGYLAVKLSVISSEGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKFLLFICTVVFTLLITKPINFGMAGILSMFITQSNDVALGYPIMLSLYPELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICSISVLAFSIISTILFLILQIRFEFLSQIRLPTSSRKLSNSSDNDQNSEENLITQMSNESDFCQDREVCQLILRQYREEITLEERAALEAELDNEFQLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDYFYRFVKPTCVDIKDLGSSDLTETEELESITQHR 814          
BLAST of Integral membrane protein GPR155 vs. Planmine SMEST
Match: SMESG000041494.1 (SMESG000041494.1)

HSP 1 Score: 1509.58 bits (3907), Expect = 0.000e+0
Identity = 806/808 (99.75%), Postives = 806/808 (99.75%), Query Frame = 1
Query:  100 MTYQDPLENLLPSLIQCFSVILIGYLAVKLSVISSEGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPINFGMAGILSMFITQSNDVALGYPIMLSLYPELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICSISVXXXXXXXXXXXXXXQIRFEFLSQIRLPTSSRKLXXXXXXXXXXXXXLITQMSNESDFCQDREVCQLILRQYRXXXXXXXXXXXXXXXXXXFQLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDYFYRFAKPTCVDIKDLGSSDXXXXXXXXSITQHR 2523
            MTYQDPLENLLPSLIQCFSVILIGYLAVKLSVISSEGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGK LLFICTVVFTLLITKPINFGMAGILSMFITQSNDVALGYPIMLSLYPELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICSISVLAFSIISTILFLILQIRFEFLSQIRLPTSSRKLSNSSDNDQNSEENLITQMSNESDFCQDREVCQLILRQYREEITLEERAALEAELDNEFQLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDYFYRF KPTCVDIKDLGSSDLTETEELESITQHR
Sbjct:    1 MTYQDPLENLLPSLIQCFSVILIGYLAVKLSVISSEGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKFLLFICTVVFTLLITKPINFGMAGILSMFITQSNDVALGYPIMLSLYPELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICSISVLAFSIISTILFLILQIRFEFLSQIRLPTSSRKLSNSSDNDQNSEENLITQMSNESDFCQDREVCQLILRQYREEITLEERAALEAELDNEFQLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETRIRAHAFGQALLISQVVEHVKRNRNLIDSDDYFYRFVKPTCVDIKDLGSSDLTETEELESITQHR 808          
BLAST of Integral membrane protein GPR155 vs. Planmine SMEST
Match: SMESG000041494.1 (SMESG000041494.1)

HSP 1 Score: 1331.24 bits (3444), Expect = 0.000e+0
Identity = 714/715 (99.86%), Postives = 714/715 (99.86%), Query Frame = 1
Query:  100 MTYQDPLENLLPSLIQCFSVILIGYLAVKLSVISSEGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKPINFGMAGILSMFITQSNDVALGYPIMLSLYPELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICSISVXXXXXXXXXXXXXXQIRFEFLSQIRLPTSSRKLXXXXXXXXXXXXXLITQMSNESDFCQDREVCQLILRQYRXXXXXXXXXXXXXXXXXXFQLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDM 2244
            MTYQDPLENLLPSLIQCFSVILIGYLAVKLSVISSEGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGK LLFICTVVFTLLITKPINFGMAGILSMFITQSNDVALGYPIMLSLYPELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICSISVLAFSIISTILFLILQIRFEFLSQIRLPTSSRKLSNSSDNDQNSEENLITQMSNESDFCQDREVCQLILRQYREEITLEERAALEAELDNEFQLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDM
Sbjct:    1 MTYQDPLENLLPSLIQCFSVILIGYLAVKLSVISSEGKALGIYVTKFALPALFFRSMATINFNDVNWLFILAVSLGKFLLFICTVVFTLLITKPINFGMAGILSMFITQSNDVALGYPIMLSLYPELAKYIYLFAPTQLVFINPLCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGVIFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIYILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTAPPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYDNILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSCLGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSFAIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQYGKIQTICSISVLAFSIISTILFLILQIRFEFLSQIRLPTSSRKLSNSSDNDQNSEENLITQMSNESDFCQDREVCQLILRQYREEITLEERAALEAELDNEFQLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFNFGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIEIRNKFCTFHLETCRNEICKDM 715          
The following BLAST results are available for this feature:
BLAST of Integral membrane protein GPR155 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GPR1553.331e-8034.60G protein-coupled receptor 155 [Source:HGNC Symbol... [more]
GPR1553.331e-8034.60G protein-coupled receptor 155 [Source:HGNC Symbol... [more]
GPR1553.331e-8034.60G protein-coupled receptor 155 [Source:HGNC Symbol... [more]
GPR1556.232e-7133.40G protein-coupled receptor 155 [Source:HGNC Symbol... [more]
back to top
BLAST of Integral membrane protein GPR155 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integral membrane protein GPR155 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
anchor2.037e-8633.46gene:FBgn0036741 transcript:FBtr0333121[more]
anchor2.608e-8633.46gene:FBgn0036741 transcript:FBtr0075182[more]
back to top
BLAST of Integral membrane protein GPR155 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gpr155b4.838e-9430.01G protein-coupled receptor 155b [Source:ZFIN;Acc:Z... [more]
gpr155a8.454e-7932.21G protein-coupled receptor 155a [Source:ZFIN;Acc:Z... [more]
gpr155a1.322e-7832.21G protein-coupled receptor 155a [Source:ZFIN;Acc:Z... [more]
gpr155b6.608e-6934.16G protein-coupled receptor 155b [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Integral membrane protein GPR155 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GPR1551.294e-10632.06G protein-coupled receptor 155 [Source:NCBI gene;A... [more]
GPR1557.527e-10331.57G protein-coupled receptor 155 [Source:NCBI gene;A... [more]
GPR1558.803e-10331.57G protein-coupled receptor 155 [Source:NCBI gene;A... [more]
GPR1559.327e-10331.57G protein-coupled receptor 155 [Source:NCBI gene;A... [more]
GPR1551.747e-7434.26G protein-coupled receptor 155 [Source:NCBI gene;A... [more]
back to top
BLAST of Integral membrane protein GPR155 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Gpr1551.958e-7534.93G protein-coupled receptor 155 [Source:MGI Symbol;... [more]
Gpr1551.958e-7534.93G protein-coupled receptor 155 [Source:MGI Symbol;... [more]
Gpr1553.217e-7133.53G protein-coupled receptor 155 [Source:MGI Symbol;... [more]
Gpr1551.029e-1538.71G protein-coupled receptor 155 [Source:MGI Symbol;... [more]
back to top
BLAST of Integral membrane protein GPR155 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q7Z3F1|GP155_HUMAN1.600e-7934.60Integral membrane protein GPR155 OS=Homo sapiens O... [more]
sp|Q5R9A7|GP155_PONAB3.803e-7834.20Integral membrane protein GPR155 OS=Pongo abelii O... [more]
sp|Q9LFP6|PIN8_ARATH5.045e-727.22Auxin efflux carrier component 8 OS=Arabidopsis th... [more]
back to top
BLAST of Integral membrane protein GPR155 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HMU24.287e-17539.59integral membrane protein GPR155 isoform X4 OS=Lin... [more]
A0A4S2KZP51.913e-15447.77Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4E0RTM17.463e-14645.86Integral membrane protein OS=Fasciola hepatica OX=... [more]
A0A4Z2DIM32.216e-14545.74Integral membrane protein OS=Schistosoma japonicum... [more]
D7GXJ51.806e-14333.98DEP domain-containing protein OS=Tribolium castane... [more]
back to top
BLAST of Integral membrane protein GPR155 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gpr155a9.396e-7734.00G protein-coupled receptor 155 [Source:NCBI gene;A... [more]
gpr155b1.927e-5935.48G protein-coupled receptor 155b [Source:ZFIN;Acc:Z... [more]
ENSAMXT00000039765.18.808e-1234.68pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Integral membrane protein GPR155 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gpr155b2.131e-6229.56G protein-coupled receptor 155b [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Integral membrane protein GPR155 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Integral membrane protein GPR155 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO436181.716e-7934.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Integral membrane protein GPR155 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gpr155a3.628e-8334.88G protein-coupled receptor 155 [Source:NCBI gene;A... [more]
gpr155b9.960e-7933.01integral membrane protein GPR155 [Source:NCBI gene... [more]
gpr155b6.451e-7832.42integral membrane protein GPR155 [Source:NCBI gene... [more]
back to top
BLAST of Integral membrane protein GPR155 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000041494.10.000e+099.75SMESG000041494.1[more]
SMESG000041494.10.000e+099.75SMESG000041494.1[more]
SMESG000041494.10.000e+099.86SMESG000041494.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021477 ID=SMED30021477|Name=Integral membrane protein GPR155|organism=Schmidtea mediterranea sexual|type=transcript|length=2630bp
TTGTATAAATTTGAAACTTGTAAAGATGTACATTTTGTAATATTGTATTT
CTTTTATAGAGGTATAGAAAGATTTTGAAAAATGATAAAAAATAATACCA
TGACATATCAAGATCCATTGGAAAATCTTTTACCCTCACTTATTCAATGC
TTCAGTGTTATATTAATCGGTTATTTGGCCGTTAAACTGTCGGTAATCTC
TTCAGAAGGTAAAGCCCTGGGAATTTATGTCACAAAATTCGCTTTGCCGG
CTCTTTTTTTTAGGTCAATGGCCACAATCAACTTCAATGACGTTAATTGG
CTTTTTATTCTTGCTGTTTCACTTGGCAAATTGTTACTCTTTATTTGCAC
CGTTGTATTTACATTGCTTATAACAAAACCGATAAATTTCGGTATGGCGG
GAATATTGTCCATGTTTATTACCCAATCAAATGATGTGGCCTTGGGTTAT
CCAATCATGTTAAGCTTGTATCCAGAATTAGCAAAATACATCTATTTGTT
TGCTCCAACACAATTAGTGTTCATCAATCCGCTCTGTTTCATTTTGCTGG
AATGGCATGAATATCGTGCTGCCTGTTTAGCCTCCTCTACTAGCATACAC
ATCTCACTGACGAGACGCATTCTATTGGTATTGAAAAATGTCATCTTGAA
TCCATTAGTATACATGACAGTAGTTGGAGTTATTTTCAACTTTATTTTAT
CTCATCATCTTCCTTTGGTTATTGACAAAACCTTGGAAATATTCGCTGAT
TCATTTTCGGGGGTGGCATTATTTTATTTGGGAATGAATATGGTGGGGAA
AATAAATTGTATTACAAGAAAAGGAATTTATATTCTCGTTTTCATTTTAC
TAGGAAAATTAATATTTCTACCGTTCATTACACGAGAATTGGTTGTTCAC
CTAGTTCAAATTCAGTTATCTTCCAATCAAACGCTTAATTATAGTTTAAT
GGGGTTTCTCTATGGAGGCCTACCGACGGCTCCTCCTGTATTTTTAATCT
CGAATGACTTTCAAGTTATACCAGATGTGATTGCTACTGGTCTAGTCCTT
GGCACGTTTCTATCTGGACCATTGATGTTTATTACTGGTAGGGTAGTGAC
GATGGTAATTGCTTCCAAATACCAATACGACAATATTCTGCAATCTACTG
CTATCAGTATTTCAAGTCTCAGTATTTTTGGATGTTTATGGGTGTTAGTC
GTATTTATTCTTTCCCGACGATTAAGGAGCCCAGTTCACCGAGTAACAAT
ATGTTACACGATTTGTGTTTTACTATCTTGTCTTGGACTTGTTATAGGTC
GGATATTCTTGCCTAATTCAATAAACAATTCCACTTCTGTTCCTGGCTGG
GGCAATTATATTCAGTTTGCTATATTTTTTATCGGCTGTACTGGTGCTAG
ACTATGGACTTGTCTAATTGCATTGTCTTTCGCAATTGTCAAAAGAAAAA
GCATCGGTTTCCTAATGAAAACTCTAAATTATTTCTATATTTTTGGATTC
TGTGTGCCAGTCCTGATTACTGCCTGCATTTTAATTTTTGGAAAGAAACA
AAATACCGTTGATATAGATCCCTCTTTTCAGTATGGGAAAATTCAAACTA
TTTGCTCGATTTCTGTCCTAGCATTTAGTATCATATCGACAATTCTCTTT
CTCATTCTACAAATTCGGTTTGAATTCCTTTCTCAAATTCGGTTACCAAC
TTCATCGAGGAAATTATCAAATTCTTCTGACAATGATCAAAACAGTGAAG
AAAATCTAATCACGCAAATGTCTAATGAATCTGATTTCTGTCAGGATCGG
GAGGTCTGTCAATTAATACTGCGTCAATATAGAGAGGAAATAACGCTAGA
GGAAAGAGCAGCTTTAGAAGCAGAACTTGATAATGAATTCCAGTTAAATC
GTCATAAGGTGCTGACGGTTTTACTTCTTGTGACAATGGGATTTGGGTTC
TTTTTGTGTTTGTGGAGATTGATTAATGAATTGATTACTGGAATATATGT
GGAATTAGAATTTTTGGATTGTGTTTTCAATTTCGGTCAGGGATTTATTT
TGTGGGCTATTTTTGGGCTGGACACAAAATTGATTGTTATTCCATTTAAA
AGAAAATTTAATAAATTCTTCAGTAGTTGTCATGAATTATATGTTCCAAA
AGAAAAGGATCTATCTCCAGAAGTAATTGAAATAAGAAATAAATTTTGTA
CATTTCATTTGGAAACTTGCCGTAACGAAATTTGTAAAGATATGAGACTC
TCCGTTAAATGTTATCACGACGTGTTCACAGGTCGCCAGTTCATTGACTG
GATTTTAAAGTCTGATTTGGAAGAGACTCGAATCAGAGCGCATGCGTTTG
GTCAAGCGCTCCTGATTAGCCAAGTCGTAGAGCACGTGAAAAGAAATCGG
AATCTAATCGACTCTGACGACTATTTCTATAGATTTGCTAAGCCGACATG
TGTTGATATTAAAGATTTGGGAAGTAGCGACCTTACAGAAACGGAAGAAC
TGGAATCCATAACGCAACATCGCTAAGAATTATTTAATATAAATAGATTT
TGTTGTTAAATTGCTAATAATTTCACAATTTATGCATGTTTTTTTATTTA
TTTCTTTTTTGTTTCAATTCGCGTTTCCCC
back to top

protein sequence of SMED30021477-orf-1

>SMED30021477-orf-1 ID=SMED30021477-orf-1|Name=SMED30021477-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=815bp
MIKNNTMTYQDPLENLLPSLIQCFSVILIGYLAVKLSVISSEGKALGIYV
TKFALPALFFRSMATINFNDVNWLFILAVSLGKLLLFICTVVFTLLITKP
INFGMAGILSMFITQSNDVALGYPIMLSLYPELAKYIYLFAPTQLVFINP
LCFILLEWHEYRAACLASSTSIHISLTRRILLVLKNVILNPLVYMTVVGV
IFNFILSHHLPLVIDKTLEIFADSFSGVALFYLGMNMVGKINCITRKGIY
ILVFILLGKLIFLPFITRELVVHLVQIQLSSNQTLNYSLMGFLYGGLPTA
PPVFLISNDFQVIPDVIATGLVLGTFLSGPLMFITGRVVTMVIASKYQYD
NILQSTAISISSLSIFGCLWVLVVFILSRRLRSPVHRVTICYTICVLLSC
LGLVIGRIFLPNSINNSTSVPGWGNYIQFAIFFIGCTGARLWTCLIALSF
AIVKRKSIGFLMKTLNYFYIFGFCVPVLITACILIFGKKQNTVDIDPSFQ
YGKIQTICSISVLAFSIISTILFLILQIRFEFLSQIRLPTSSRKLSNSSD
NDQNSEENLITQMSNESDFCQDREVCQLILRQYREEITLEERAALEAELD
NEFQLNRHKVLTVLLLVTMGFGFFLCLWRLINELITGIYVELEFLDCVFN
FGQGFILWAIFGLDTKLIVIPFKRKFNKFFSSCHELYVPKEKDLSPEVIE
IRNKFCTFHLETCRNEICKDMRLSVKCYHDVFTGRQFIDWILKSDLEETR
IRAHAFGQALLISQVVEHVKRNRNLIDSDDYFYRFAKPTCVDIKDLGSSD
LTETEELESITQHR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR000591DEP_dom
IPR011991WHTH_DNA-bd_dom
IPR004776Mem_trans
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0055085transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 580..600
NoneNo IPR availablePANTHERPTHR22829DEP DOMAIN PROTEINcoord: 12..787
NoneNo IPR availablePANTHERPTHR22829:SF5INTEGRAL MEMBRANE PROTEIN GPR155coord: 12..787
NoneNo IPR availableCDDcd149407tmE_cAMP_R_Slime_moldcoord: 360..492
e-value: 4.82555E-5
score: 43.4941
NoneNo IPR availableTMHMMTMhelixcoord: 20..39
NoneNo IPR availableTMHMMTMhelixcoord: 507..526
NoneNo IPR availableTMHMMTMhelixcoord: 183..205
NoneNo IPR availableTMHMMTMhelixcoord: 465..487
NoneNo IPR availableTMHMMTMhelixcoord: 46..65
NoneNo IPR availableTMHMMTMhelixcoord: 136..158
NoneNo IPR availableTMHMMTMhelixcoord: 104..126
NoneNo IPR availableTMHMMTMhelixcoord: 430..452
NoneNo IPR availableTMHMMTMhelixcoord: 286..308
NoneNo IPR availableTMHMMTMhelixcoord: 75..97
NoneNo IPR availableTMHMMTMhelixcoord: 610..632
NoneNo IPR availableTMHMMTMhelixcoord: 220..242
NoneNo IPR availableTMHMMTMhelixcoord: 353..375
NoneNo IPR availableTMHMMTMhelixcoord: 321..343
NoneNo IPR availableTMHMMTMhelixcoord: 647..669
NoneNo IPR availableTMHMMTMhelixcoord: 249..271
NoneNo IPR availableTMHMMTMhelixcoord: 388..410
IPR000591DEP domainSMARTSM00049DEP_3coord: 713..787
e-value: 5.4E-7
score: 39.2
IPR000591DEP domainPFAMPF00610DEPcoord: 719..785
e-value: 1.1E-11
score: 44.6
IPR000591DEP domainPROSITEPS50186DEPcoord: 730..787
score: 11.038
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 698..813
e-value: 3.7E-14
score: 54.9
IPR004776Membrane transport proteinPFAMPF03547Mem_transcoord: 175..332
e-value: 1.8E-9
score: 36.5
coord: 19..155
e-value: 4.8E-7
score: 28.5
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 705..791