intraflagellar transport protein 22 homolog

Overview
Nameintraflagellar transport protein 22 homolog
Smed IDSMED30021469
Length (bp)654
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of intraflagellar transport protein 22 homolog (SMED30021469) t-SNE clustered cells

Violin plots show distribution of expression levels for intraflagellar transport protein 22 homolog (SMED30021469) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of intraflagellar transport protein 22 homolog (SMED30021469) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for intraflagellar transport protein 22 homolog (SMED30021469) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021469

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30021469SMESG000052133.1 SmedASXL_006927SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30021469SMESG000052133.1 dd_Smed_v4_11176_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30021469SMESG000052133.1 dd_Smed_v6_11176_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30021469SMESG000052133.1 dd_Smed_v6_11176_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30021469SMESG000052133.1 dd_Smed_v6_11176_0_1dd_Smed_v6PMID:30399335
Ross et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30021469SMESG000052133.1 dd_Smed_v4_11176_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Human
Match: IFT22 (intraflagellar transport 22 [Source:HGNC Symbol;Acc:HGNC:21895])

HSP 1 Score: 157.918 bits (398), Expect = 2.772e-48
Identity = 70/187 (37.43%), Postives = 125/187 (66.84%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYE-ANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTA-DRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLL 615
            M K K+L VGP ++GKT L NFL+E+   S   +Y PT+GVRI+E+E  ++  ++K    + E WD  GD+K+E+CWP + K+A+G+V V+N D   H  +++ WYS FV++  ++D QC +IAH KP +  D+  + L+   ++++ + SN+++  +++R +F ++L  +I  ++E+ D+EE S++
Sbjct:    1 MLKAKILFVGPCESGKTVLANFLTES---SDITEYSPTQGVRILEFENPHVTSNNKGTGCEFELWDCGGDAKFESCWPALMKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLIAHHKPGSGDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREEMSIM 184          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Human
Match: IFT22 (intraflagellar transport 22 [Source:HGNC Symbol;Acc:HGNC:21895])

HSP 1 Score: 157.918 bits (398), Expect = 2.772e-48
Identity = 70/187 (37.43%), Postives = 125/187 (66.84%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYE-ANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTA-DRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLL 615
            M K K+L VGP ++GKT L NFL+E+   S   +Y PT+GVRI+E+E  ++  ++K    + E WD  GD+K+E+CWP + K+A+G+V V+N D   H  +++ WYS FV++  ++D QC +IAH KP +  D+  + L+   ++++ + SN+++  +++R +F ++L  +I  ++E+ D+EE S++
Sbjct:    1 MLKAKILFVGPCESGKTVLANFLTES---SDITEYSPTQGVRILEFENPHVTSNNKGTGCEFELWDCGGDAKFESCWPALMKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLIAHHKPGSGDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREEMSIM 184          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Human
Match: IFT22 (intraflagellar transport 22 [Source:HGNC Symbol;Acc:HGNC:21895])

HSP 1 Score: 123.635 bits (309), Expect = 3.064e-35
Identity = 60/187 (32.09%), Postives = 107/187 (57.22%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTA-DRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLLN 618
            M K K+L VGP ++GKT L NFL+E+   S   +Y PT+GVR                             +E+CWP + K+A+G+V V+N D   H  +++ WYS FV++  ++D QC +IAH KP +  D+  + L+   ++++ + SN+++  +++R +F ++L  +I  ++E+ D+EE S++ 
Sbjct:    1 MLKAKILFVGPCESGKTVLANFLTES---SDITEYSPTQGVR-----------------------------FESCWPALMKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLIAHHKPGSGDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREEMSIMT 155          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Human
Match: IFT22 (intraflagellar transport 22 [Source:HGNC Symbol;Acc:HGNC:21895])

HSP 1 Score: 81.6481 bits (200), Expect = 1.679e-19
Identity = 34/106 (32.08%), Postives = 71/106 (66.98%), Query Frame = 1
Query:  301 KNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTA-DRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLL 615
            K+A+G+V V+N D   H  +++ WYS FV++  ++D QC +IAH KP +  D+  + L+   ++++ + SN+++  +++R +F ++L  +I  ++E+ D+EE S++
Sbjct:    2 KDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLIAHHKPGSGDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREEMSIM 107          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Human
Match: IFT22 (intraflagellar transport 22 [Source:HGNC Symbol;Acc:HGNC:21895])

HSP 1 Score: 81.6481 bits (200), Expect = 1.679e-19
Identity = 34/106 (32.08%), Postives = 71/106 (66.98%), Query Frame = 1
Query:  301 KNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTA-DRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLL 615
            K+A+G+V V+N D   H  +++ WYS FV++  ++D QC +IAH KP +  D+  + L+   ++++ + SN+++  +++R +F ++L  +I  ++E+ D+EE S++
Sbjct:    2 KDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLIAHHKPGSGDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREEMSIM 107          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Celegans
Match: ifta-2 (Intraflagellar transport associated protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUC2])

HSP 1 Score: 101.679 bits (252), Expect = 3.401e-26
Identity = 62/202 (30.69%), Postives = 104/202 (51.49%), Query Frame = 1
Query:   73 KLLVVGPTKAGKTYLVNFLSEAIE-------------QSTKFD------YRPTKGVRIIEYEA---------NLVVHSKKLK-ADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVI-----AHKKPNTADRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKV 576
            K+LV+GP KAGKT L  FL++ +E             +  KF+      YRPTKGVRI E+E          N +  +++L+ ++++ WDVSGD KYE+CWP I +NA G++ V N ++    + L +W+  FV +  + DL C ++       KK N       ++      +  +  +      Q++ + N F+A ++K+
Sbjct:   30 KILVLGPPKAGKTTLCTFLADFMEDGDTLKKGEDSGERERKFEFEFTSVYRPTKGVRIQEFETHEFFTEQEQNELGGTRRLEDSEIQLWDVSGDKKYEDCWPAIKENAEGVILVVNPEEH-KGSDLQQWFYEFVEKENI-DLSCVMVILNEQGAKKTNHEQISGFEILPKLRGVHHVAHHFGSEAMQVKMEVNSFMASVLKM 229          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Fly
Match: Rab9Fb (gene:FBgn0052670 transcript:FBtr0073401)

HSP 1 Score: 47.3654 bits (111), Expect = 2.562e-6
Identity = 32/138 (23.19%), Postives = 65/138 (47.10%), Query Frame = 1
Query:   64 FKIKLLVVGPTKAGKTYLV-----NFLSEAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTADRDI 462
            +  K+LV+G    GK+ L+     N  +E    +   D+R    VR +E    +V+        ++ WD +GD ++++  P   + A+GI+ VY+   S     +D W    +RR+  + +   ++ +K  +  +R +
Sbjct:    6 YLFKILVLGDIGVGKSCLLMRFSDNRFTEKHVCTVGMDFR----VRNVELAGRMVM--------LQIWDTAGDERFKSLLPSYYRGAHGILLVYDITSSKSFRNIDGWLKE-IRRMSSESVNVMLVGNKCDDLDNRQV 130          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Zebrafish
Match: ift22 (intraflagellar transport 22 homolog (Chlamydomonas) [Source:NCBI gene;Acc:550583])

HSP 1 Score: 163.696 bits (413), Expect = 9.237e-51
Identity = 75/187 (40.11%), Postives = 128/187 (68.45%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYEA-NLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNT-ADRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLL 615
            MFK+K+L++GP++ GKT L NFLS+  E S   DY PT+GVRI+E+E+ NL   +K    DVE WD +GD K+E+CWP + K++NG+  V+N D   H  +++ WYS F+    + + QC +IAH KP + AD +   L    +++  I SN++E  +++R++FN++L +++++++E+ ++EE S++
Sbjct:    1 MFKVKILLIGPSECGKTALANFLSDTTE-SIGADYSPTQGVRILEFESHNLHNGNKSSSCDVELWDCAGDFKFESCWPALMKDSNGVAVVFNPDVPSHLKEIETWYSAFISSQGLLEGQCLLIAHHKPGSGADTNRPSLAPQLNKLPLIHSNLEEEPEEVRQEFNKYLGKVMRMLSESQEREEMSII 186          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Zebrafish
Match: rab18a (RAB18A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-030131-3980])

HSP 1 Score: 45.8246 bits (107), Expect = 9.073e-6
Identity = 31/136 (22.79%), Postives = 61/136 (44.85%), Query Frame = 1
Query:   70 IKLLVVGPTKAGKTYLV-----NFLSEAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTADRDI 462
            +K+L++G +  GK+ L+     +     I  +   D++    V+ +  + N        +A +  WD +G  ++    P   + A G++ VY+  + +  AKLD W S         DL   ++ + K +  DR+I
Sbjct:    9 LKILIIGESGVGKSSLLLRFTDDTFDAEIGATIGVDFK----VKTLAVDGN--------RAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVSRRETFAKLDNWLSELETYCTRNDLVKMLVGN-KIDKDDREI 131          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Zebrafish
Match: rab18a (RAB18A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-030131-3980])

HSP 1 Score: 45.8246 bits (107), Expect = 9.073e-6
Identity = 31/136 (22.79%), Postives = 61/136 (44.85%), Query Frame = 1
Query:   70 IKLLVVGPTKAGKTYLV-----NFLSEAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTADRDI 462
            +K+L++G +  GK+ L+     +     I  +   D++    V+ +  + N        +A +  WD +G  ++    P   + A G++ VY+  + +  AKLD W S         DL   ++ + K +  DR+I
Sbjct:    9 LKILIIGESGVGKSSLLLRFTDDTFDAEIGATIGVDFK----VKTLAVDGN--------RAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVSRRETFAKLDNWLSELETYCTRNDLVKMLVGN-KIDKDDREI 131          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Xenopus
Match: ift22 (intraflagellar transport 22 [Source:NCBI gene;Acc:496722])

HSP 1 Score: 155.606 bits (392), Expect = 2.436e-47
Identity = 71/186 (38.17%), Postives = 127/186 (68.28%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTAD-RDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLL 615
            MFK K+LVVGPT++GKT L NF+S+A E +   +Y PT+GVRI+E+E      +K    +VE WD  GDSK+E+CWPVI K+++G++ V++ D   H  +++ W+ +F+++ R+++ +C +IAHKKP + D R+ + L+    ++  I SN+++  + +R +  ++L  ++  ++E+ D+EE S++
Sbjct:    1 MFKAKVLVVGPTESGKTILANFISDATE-TIGGEYNPTQGVRILEFECP--NGNKGSSCEVELWDCGGDSKFESCWPVIMKDSHGVIIVFSADIPSHLKEIEMWHLNFIQKQRLQENRCLLIAHKKPGSGDERERLNLSPALAKLTLIYSNLEDDPEDVRMELMKYLRGIVSSLSESRDREEMSII 183          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Xenopus
Match: ift22 (intraflagellar transport 22 [Source:NCBI gene;Acc:496722])

HSP 1 Score: 133.265 bits (334), Expect = 1.116e-38
Identity = 61/172 (35.47%), Postives = 114/172 (66.28%), Query Frame = 1
Query:  103 GKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTAD-RDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLL 615
            GKT L NF+S+A E +   +Y PT+GVRI+E+E      +K    +VE WD  GDSK+E+CWPVI K+++G++ V++ D   H  +++ W+ +F+++ R+++ +C +IAHKKP + D R+ + L+    ++  I SN+++  + +R +  ++L  ++  ++E+ D+EE S++
Sbjct:    9 GKTILANFISDATE-TIGGEYNPTQGVRILEFEC--PNGNKGSSCEVELWDCGGDSKFESCWPVIMKDSHGVIIVFSADIPSHLKEIEMWHLNFIQKQRLQENRCLLIAHKKPGSGDERERLNLSPALAKLTLIYSNLEDDPEDVRMELMKYLRGIVSSLSESRDREEMSII 177          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Xenopus
Match: ENSXETT00000002310.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460597.1:54375:62692:-1 gene:ENSXETG00000006403.1 transcript:ENSXETT00000002310.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 4.243e-26
Identity = 56/178 (31.46%), Postives = 98/178 (55.06%), Query Frame = 1
Query:  103 GKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCV------IAHKKPNTAD-RDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLL 615
            GK+ L NF+S+A E +   +Y PT+GVRI+E E      +K    +VE WD  GDSK+++CWPVI K ++G++ V+N D   H                +K+++ CV      I  ++P + D R+ + L      +  I SN+++  + +R +  ++L  ++  ++E+ DQEE S++
Sbjct:   11 GKSVLANFISDATE-TIAGEYNPTQGVRILECECP--NGNKGSSCEVELWDCGGDSKFKSCWPVIMKYSHGVIIVFNSDIPSH----------------LKEIEMCVTVPLNFIQKQRPGSGDERERLNLAPALATLTLIYSNLEDDPEDVRMELMKYLRGIVISLSESRDQEEMSII 169          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Mouse
Match: Ift22 (intraflagellar transport 22 [Source:MGI Symbol;Acc:MGI:1914536])

HSP 1 Score: 151.754 bits (382), Expect = 5.677e-46
Identity = 69/183 (37.70%), Postives = 121/183 (66.12%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYE-ANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNT-ADRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEE 603
            M K K+L VGP ++GKT L NFL+E+   S   +Y PT+GVRI+E+E  ++  ++K    + E WD  GDSK+E+CWP + K+A+G+V V+N D   H  +++ WYS FV++  ++D  C ++AH KP +  +R  + L+   ++++ + SN++E  +++R +F ++L  +I  ++E+ D+EE
Sbjct:    1 MLKAKILFVGPCESGKTVLANFLTES---SDITEYNPTQGVRILEFENPHVTSNNKGTGCEFELWDCGGDSKFESCWPALMKDAHGVVIVFNADIPSHLKEIEMWYSCFVQQQFLQDSHCMLVAHHKPGSGGERGSLALSPPLNKLKLVHSNLEEDPEEVRVEFIKYLKSIINSMSESRDREE 180          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Mouse
Match: Ift22 (intraflagellar transport 22 [Source:MGI Symbol;Acc:MGI:1914536])

HSP 1 Score: 125.561 bits (314), Expect = 6.531e-36
Identity = 56/133 (42.11%), Postives = 87/133 (65.41%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYE-ANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTADR 456
            M K K+L VGP ++GKT L NFL+E+   S   +Y PT+GVRI+E+E  ++  ++K    + E WD  GDSK+E+CWP + K+A+G+V V+N D   H  +++ WYS FV++  ++D  C ++AH KP +   
Sbjct:    1 MLKAKILFVGPCESGKTVLANFLTES---SDITEYNPTQGVRILEFENPHVTSNNKGTGCEFELWDCGGDSKFESCWPALMKDAHGVVIVFNADIPSHLKEIEMWYSCFVQQQFLQDSHCMLVAHHKPGSGGE 130          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Mouse
Match: Ift22 (intraflagellar transport 22 [Source:MGI Symbol;Acc:MGI:1914536])

HSP 1 Score: 116.316 bits (290), Expect = 1.639e-32
Identity = 58/182 (31.87%), Postives = 103/182 (56.59%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNT-ADRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEE 603
            M K K+L VGP ++GKT L NFL+E+   S   +Y PT+GVR                             +E+CWP + K+A+G+V V+N D   H  +++ WYS FV++  ++D  C ++AH KP +  +R  + L+   ++++ + SN++E  +++R +F ++L  +I  ++E+ D+EE
Sbjct:    1 MLKAKILFVGPCESGKTVLANFLTES---SDITEYNPTQGVR-----------------------------FESCWPALMKDAHGVVIVFNADIPSHLKEIEMWYSCFVQQQFLQDSHCMLVAHHKPGSGGERGSLALSPPLNKLKLVHSNLEEDPEEVRVEFIKYLKSIINSMSESRDREE 150          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Mouse
Match: Ift22 (intraflagellar transport 22 [Source:MGI Symbol;Acc:MGI:1914536])

HSP 1 Score: 60.8474 bits (146), Expect = 5.220e-12
Identity = 29/67 (43.28%), Postives = 45/67 (67.16%), Query Frame = 1
Query:   73 KLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYE-ANLVVHSKKLKADVEFWDVSGDS 270
            K+L VGP ++GKT L NFL+E+ + +   +Y PT+GVRI+E+E  ++  ++K    + E WD  GDS
Sbjct:    2 KILFVGPCESGKTVLANFLTESSDIT---EYNPTQGVRILEFENPHVTSNNKGTGCEFELWDCGGDS 65          
BLAST of intraflagellar transport protein 22 homolog vs. UniProt/SwissProt
Match: sp|Q567Y6|IFT22_DANRE (Intraflagellar transport protein 22 homolog OS=Danio rerio OX=7955 GN=ift22 PE=2 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 6.973e-50
Identity = 75/187 (40.11%), Postives = 128/187 (68.45%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYEA-NLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNT-ADRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLL 615
            MFK+K+L++GP++ GKT L NFLS+  E S   DY PT+GVRI+E+E+ NL   +K    DVE WD +GD K+E+CWP + K++NG+  V+N D   H  +++ WYS F+    + + QC +IAH KP + AD +   L    +++  I SN++E  +++R++FN++L +++++++E+ ++EE S++
Sbjct:    1 MFKVKILLIGPSECGKTALANFLSDTTE-SIGADYSPTQGVRILEFESHNLHNGNKSSSCDVELWDCAGDFKFESCWPALMKDSNGVAVVFNPDVPSHLKEIETWYSAFISSQGLLEGQCLLIAHHKPGSGADTNRPSLAPQLNKLPLIHSNLEEEPEEVRQEFNKYLGKVMRMLSESQEREEMSII 186          
BLAST of intraflagellar transport protein 22 homolog vs. UniProt/SwissProt
Match: sp|Q9H7X7|IFT22_HUMAN (Intraflagellar transport protein 22 homolog OS=Homo sapiens OX=9606 GN=IFT22 PE=1 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 1.331e-47
Identity = 70/187 (37.43%), Postives = 125/187 (66.84%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYE-ANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTA-DRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLL 615
            M K K+L VGP ++GKT L NFL+E+   S   +Y PT+GVRI+E+E  ++  ++K    + E WD  GD+K+E+CWP + K+A+G+V V+N D   H  +++ WYS FV++  ++D QC +IAH KP +  D+  + L+   ++++ + SN+++  +++R +F ++L  +I  ++E+ D+EE S++
Sbjct:    1 MLKAKILFVGPCESGKTVLANFLTES---SDITEYSPTQGVRILEFENPHVTSNNKGTGCEFELWDCGGDAKFESCWPALMKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQPSLQDTQCMLIAHHKPGSGDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREEMSIM 184          
BLAST of intraflagellar transport protein 22 homolog vs. UniProt/SwissProt
Match: sp|Q4R4K5|IFT22_MACFA (Intraflagellar transport protein 22 homolog OS=Macaca fascicularis OX=9541 GN=IFT22 PE=2 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 1.709e-47
Identity = 70/187 (37.43%), Postives = 125/187 (66.84%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYE-ANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTA-DRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLL 615
            M K K+L VGP ++GKT L NFL+E+   S   +Y PT+GVRI+E+E  ++  ++K    + E WD  GD+K+E+CWP + K+A+G+V V+N D   H  +++ WYS FV++  ++D QC +IAH KP +  D+  + L+   ++++ + SN+++  +++R +F ++L  +I  ++E+ D+EE S++
Sbjct:    1 MLKAKILFVGPCESGKTVLANFLTES---SDITEYSPTQGVRILEFENPHVTSNNKGTGCEFELWDCGGDAKFESCWPALMKDAHGVVIVFNADIPSHRKEMEMWYSCFVQQQSLQDTQCMLIAHHKPGSGDDKGSLSLSPPLNKLKLVHSNLEDDPEEIRMEFIKYLKSIINSMSESRDREEMSIM 184          
BLAST of intraflagellar transport protein 22 homolog vs. UniProt/SwissProt
Match: sp|Q5M8K8|IFT22_XENTR (Intraflagellar transport protein 22 homolog OS=Xenopus tropicalis OX=8364 GN=ift22 PE=2 SV=1)

HSP 1 Score: 155.606 bits (392), Expect = 1.290e-46
Identity = 71/186 (38.17%), Postives = 127/186 (68.28%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTAD-RDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLL 615
            MFK K+LVVGPT++GKT L NF+S+A E +   +Y PT+GVRI+E+E      +K    +VE WD  GDSK+E+CWPVI K+++G++ V++ D   H  +++ W+ +F+++ R+++ +C +IAHKKP + D R+ + L+    ++  I SN+++  + +R +  ++L  ++  ++E+ D+EE S++
Sbjct:    1 MFKAKVLVVGPTESGKTILANFISDATE-TIGGEYNPTQGVRILEFECP--NGNKGSSCEVELWDCGGDSKFESCWPVIMKDSHGVIIVFSADIPSHLKEIEMWHLNFIQKQRLQENRCLLIAHKKPGSGDERERLNLSPALAKLTLIYSNLEDDPEDVRMELMKYLRGIVSSLSESRDREEMSII 183          
BLAST of intraflagellar transport protein 22 homolog vs. UniProt/SwissProt
Match: sp|Q5E9J4|IFT22_BOVIN (Intraflagellar transport protein 22 homolog OS=Bos taurus OX=9913 GN=IFT22 PE=2 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 1.012e-45
Identity = 70/187 (37.43%), Postives = 124/187 (66.31%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYE-ANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNT-ADRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLL 615
            M K K+L VGP ++GKT L NFL+E+   S   +Y PT+GVRI+E+E  ++  ++K    + E WD  GD K+E+CWP + K+++G+V V+N D   H  +++ WYS FV++  +++ QC +IAH KP + +D+D   L    ++++ + SN+++  +++R +F ++L  +I  V+E+ D+EE S++
Sbjct:    1 MLKAKILFVGPCESGKTVLANFLTES---SDITEYNPTQGVRILEFENPHVTSNNKGTGCEFELWDCGGDPKFESCWPALMKDSHGVVIVFNADIPSHLKEIETWYSCFVQQQFLQNTQCLLIAHHKPGSGSDKDNPALAPPLNKLKLVHSNLEDDPEEIRMEFIKYLRSIINSVSESRDREEMSII 184          
BLAST of intraflagellar transport protein 22 homolog vs. TrEMBL
Match: A0A1I8JN57 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig025724g1 PE=4 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 8.242e-67
Identity = 96/186 (51.61%), Postives = 131/186 (70.43%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTADRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLLN 618
            M ++KLLVVGP   GKTYL NFLSEAIEQS+  +YRPT+  RI+EYE  +    K    +V+ WD+SGD K+ +CWP +  + NG+VFVYNQDQ     +LD+ Y  FV+   +KD QCCVI+HKKPNTAD D +QL+  F+ +R++ S+I  AGDQLR+DFN FL    + +NE ++Q+E ++L 
Sbjct:    1 MNRLKLLVVGPVACGKTYLTNFLSEAIEQSSG-EYRPTQACRIVEYETEVKSKGKAANIEVQLWDISGDKKFASCWPALVSSVNGVVFVYNQDQPQQSEELDQLYQFFVQNHGIKDTQCCVISHKKPNTADMDSLQLSDKFENVRTVASDIPSAGDQLRDDFNNFLLHAYQSMNENAEQDELNILG 185          
BLAST of intraflagellar transport protein 22 homolog vs. TrEMBL
Match: A0A074Z204 (GTP-binding domain protein OS=Opisthorchis viverrini OX=6198 GN=T265_10564 PE=4 SV=1)

HSP 1 Score: 201.445 bits (511), Expect = 3.097e-62
Identity = 92/187 (49.20%), Postives = 134/187 (71.66%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTADRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLLNA 621
            M +IK++VVGP+  GKTYL NFLSEAIEQ T  +YRPT GVRIIEYE N+ V +K +K +VE WD+SGD KYENCWP + K ++G++FVY+ D S+H  +L++W++   R   +KD  CCVI++ +    +RDIV L   F + + IK+NI + G++LRE F +F+ Q++    E ++QEE +++NA
Sbjct:    1 MNRIKVVVVGPSDCGKTYLCNFLSEAIEQVTG-EYRPTVGVRIIEYEVNVNVKTKPVKVEVELWDLSGDVKYENCWPAVFKGSHGVMFVYSPDHSEHSRELEDWHTRTHRNFPLKDTCCCVISNNRCAKVERDIVVLPLAFSKFKHIKNNIADDGEKLREQFGKFITQILSSRQEATEQEELNIMNA 186          
BLAST of intraflagellar transport protein 22 homolog vs. TrEMBL
Match: A0A1S3H1D7 (intraflagellar transport protein 22 homolog OS=Lingula unguis OX=7574 GN=LOC106151233 PE=4 SV=1)

HSP 1 Score: 194.897 bits (494), Expect = 1.448e-59
Identity = 90/192 (46.88%), Postives = 137/192 (71.35%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYEAN-LVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTAD----RDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLLNA 621
            MFK K+LV+GP ++GK+ + N+L++A E +   +YRPT+GVRI+EYEAN L V SKK+ A+VE WDVSGD K+E+CWP IAK+ANGIVFVYN DQ++HD  L+ WY+HFV    ++D QC + AHKK +++              F +I  + +N+D+ G+ +R +F +FL+ L+  ++++ D+EE S++N+
Sbjct:    1 MFKSKVLVLGPCESGKSAIANYLADATE-NIGGEYRPTQGVRILEYEANNLTVGSKKVSAEVELWDVSGDKKFESCWPAIAKDANGIVFVYNPDQANHDKDLEMWYTHFVSVPGLRDTQCLLFAHKKGSSSGFLGQSGGTGPPQAFSKISVVNTNLDDDGENVRTEFEKFLSGLLNAMHDSRDKEELSIMNS 191          
BLAST of intraflagellar transport protein 22 homolog vs. TrEMBL
Match: A0A2H1CII5 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_05392 PE=4 SV=1)

HSP 1 Score: 187.963 bits (476), Expect = 7.123e-57
Identity = 87/187 (46.52%), Postives = 123/187 (65.78%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTADRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLLNA 621
            M  +KL+VVGP++ GK+YL NFLS+A+EQ T  DY+PTKGVRIIEYE ++    K  K +VE WD SG   YENCWP + +  NG+VFVYN + + H   L+EW S   +   ++D QCCVI H K +  DRD V L   F +    K +I E G++ RE+F +F++QL+    E ++QEE +++N+
Sbjct:    1 MNHLKLVVVGPSECGKSYLCNFLSDAVEQVT-VDYKPTKGVRIIEYEQSVSCKGKMHKVEVELWDTSGSKSYENCWPAVFRGLNGVVFVYNPNDTGHGKVLEEWQSILAQIQTLRDTQCCVIGHCKSSKTDRD-VSLPLTFSRYLQFKGSISEEGEKFREEFAKFISQLVSTRMEANEQEELNIINS 185          
BLAST of intraflagellar transport protein 22 homolog vs. TrEMBL
Match: A0A087UQT1 (Rab-like protein 5 (Fragment) OS=Stegodyphus mimosarum OX=407821 GN=X975_05904 PE=4 SV=1)

HSP 1 Score: 186.808 bits (473), Expect = 2.066e-56
Identity = 86/187 (45.99%), Postives = 132/187 (70.59%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYEAN-LVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTADRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLLN 618
            M+K+KLLV+GP + GKT + NFL++A E  +  DY PT+GVRI+E+E++ L +  +  KA+VE WD SGD+K+ENCWP + K+ NG++FVY+ D  +   ++D WY++FV+   +KD QC V  H+KPN  +    +L++ F +I  I++NI+E G+ LR +FN FL +L+  ++E  DQEE S+LN
Sbjct:    1 MYKVKLLVIGPCECGKTVISNFLADATETISN-DYHPTQGVRILEFESDSLNIGGRIAKAEVELWDCSGDTKFENCWPALMKDGNGVIFVYSADIVNIRKEMDMWYANFVQAQGLKDSQCIVFCHRKPNLPETRSSELSSLFSRITWIQTNIEENGNALRREFNSFLQRLLSNISERRDQEELSILN 186          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Cavefish
Match: ift22 (intraflagellar transport 22 [Source:NCBI gene;Acc:103034751])

HSP 1 Score: 166.392 bits (420), Expect = 9.198e-52
Identity = 75/187 (40.11%), Postives = 125/187 (66.84%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYEA-NLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNT-ADRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLL 615
            M K+K+L++GP++ GKT L NFLS+ +E + + DY PT+GVRI+E+E+ +L   SK    +VE WD +GD KYE CWP + K++NG+V V+N D   H  +++ WYS F+    +   QC +IAH KP + AD    QL +  +++  I SN++E  + +R++F R+L  +++ ++E+ ++EE S++
Sbjct:    1 MLKVKILLIGPSECGKTVLANFLSDTVE-TIEADYSPTQGVRILEFESQHLGSGSKDSACEVELWDCAGDFKYEACWPALMKDSNGVVIVFNPDIPSHLKEVETWYSTFISSQGLAVGQCLLIAHHKPGSGADTSRPQLASQLNKLSLIHSNLEEDAEDVRQEFRRYLGNVVQTLSESREREEMSII 186          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009567.1 (pep scaffold:Pmarinus_7.0:GL478108:281:3891:1 gene:ENSPMAG00000008650.1 transcript:ENSPMAT00000009567.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.548 bits (423), Expect = 5.836e-53
Identity = 74/192 (38.54%), Postives = 127/192 (66.15%), Query Frame = 1
Query:   49 KLSKMFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYEANLV-VHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNT-ADRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLLN 618
            K S MFK K+LVVGP K+GKT + NFL +A E +   +Y PT+GVRI+E+E+  V V  + +  +VE WD SGD K+E CWP + ++ +G++ V++ +Q+ H  +L+ W++ FV + R+++ QC ++AH KP + A R +  L     ++  + S+++EA + L E+F  FL +L+  ++++ D+EE S++ 
Sbjct:    2 KQSVMFKAKILVVGPVKSGKTTMANFLGDATE-AVGGEYSPTQGVRILEFESGTVDVSGRAVTCEVELWDCSGDMKFEACWPALQRDVSGVMLVFDAEQASHARELEAWHTAFVLQPRLQESQCLLVAHHKPGSDASRPLPGLGVALSKLPLVISDLEEAPESLSEEFRAFLGRLVSSMSDSRDREELSIVG 192          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001552.1 (pep scaffold:Pmarinus_7.0:GL476520:43153:47504:1 gene:ENSPMAG00000001403.1 transcript:ENSPMAT00000001552.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.4394 bits (106), Expect = 2.366e-6
Identity = 29/109 (26.61%), Postives = 49/109 (44.95%), Query Frame = 1
Query:   64 FKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRP----TKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYS 378
             ++KL+++G +  GKT L+  L+       +  + P    T GV    Y    VVH ++    +E WD +G  ++    P+  +NA   V  Y+    +   KL  W S
Sbjct:   11 LRVKLVLIGESNVGKTSLLRRLA-------RNQFIPNEVATVGVAFQSY----VVHLEEAPVRLEIWDTAGQERHRMLTPIFFRNAEAAVLTYDISSQESFNKLQFWIS 108          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Yeast
Match: YPT52 (Endosomal Rab family GTPase; required for vacuolar protein sorting, endocytosis and multivesicular body (MVB) biogenesis and sorting; required for localization of the CORVET complex to endosomes; involved in autophagy and ionic stress tolerance; similar to Vps21p and Ypt53p; mammalian Rab5 homolog; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001722])

HSP 1 Score: 44.2838 bits (103), Expect = 4.103e-6
Identity = 29/126 (23.02%), Postives = 58/126 (46.03%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVN-FLSEAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHK 435
            M + KL+++G +  GK+ +V+ F+ +  ++  +         + I    N    +K +    E WD +G  +Y++  P+  +NAN  + VY+  Q D   K   W      ++   DL   ++ +K
Sbjct:    1 MLQFKLVLLGDSSVGKSSIVHRFVKDTFDELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLLGNK 126          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Nematostella
Match: EDO39919 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8S6])

HSP 1 Score: 180.644 bits (457), Expect = 8.243e-58
Identity = 81/188 (43.09%), Postives = 120/188 (63.83%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYEANLV--VHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTADRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLLN 618
            MFK K+LV+GP ++GKT + NFLS+A E S   DY PT+GVRI+E+E N +     +    +VE WD SG+ ++  CWP   K+ANG++ VYN DQ + D  L+ WY+ FV+   +KD QC V AH KP   +R   Q+  +  ++  + +N+DE  D +REDF  FLA+++  + +  DQEE S++N
Sbjct:    1 MFKSKILVLGPCESGKTVIANFLSDATETSGG-DYHPTQGVRILEFECNSIEITPGRTANCEVELWDCSGNHRFSTCWPAFQKDANGVIIVYNPDQPNQDKDLETWYTQFVQTQMLKDSQCIVFAHHKPMGTERTRTQIPPSLSKVTCVHTNLDEDPDSVREDFKNFLAKVLSNLTDKRDQEELSIMN 187          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Nematostella
Match: EDO42495 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1E6])

HSP 1 Score: 45.4394 bits (106), Expect = 3.436e-6
Identity = 29/127 (22.83%), Postives = 57/127 (44.88%), Query Frame = 1
Query:   70 IKLLVVGPTKAGKTYLV-----NFLSEAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHK 435
            +K+L+VG +  GK+ L+     +     I  +   D++    V+ +  E N        KA +  WD +G  ++    P   + A G++ VY+ +  +   KL+EW +        KD+   ++ +K
Sbjct:    9 LKILIVGESGVGKSSLLLRFTDDTFDPDIGATIGVDFK----VKTLTVEGN--------KAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDTNSRETFDKLEEWLNEVEMYSTKKDIVKMLVGNK 123          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Medaka
Match: ift22 (intraflagellar transport 22 [Source:NCBI gene;Acc:101158389])

HSP 1 Score: 156.762 bits (395), Expect = 4.903e-48
Identity = 71/187 (37.97%), Postives = 122/187 (65.24%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNT-ADRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLLN 618
            MFK K+L++GP ++GKT L NFLS   E +   +YRPT+GVRI+E+E+ L     K   +VE WD SGD ++E+CWP + K+ +G+V  +N D   H  +++ W+S FV    ++D Q  +IAH KP + A++  + L +N  +++ I SN++E  + +R  F R+L  +++ ++E+ ++EE S+++
Sbjct:    1 MFKAKILIIGPKESGKTTLANFLSNTTE-NLYGEYRPTQGVRILEFESQLESRGDK-TCEVELWDCSGDFRFESCWPALMKDCSGVVITFNPDVPSHLKEIETWHSVFVSSQGLQDAQSLLIAHHKPGSEAEKGRLPLASNLGKLQLIHSNLEEEPEDVRAAFCRYLGDVVRAISESREREEMSIIS 185          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Medaka
Match: rabl2 (RAB, member of RAS oncogene family like 2B [Source:NCBI gene;Acc:101159434])

HSP 1 Score: 50.8322 bits (120), Expect = 1.672e-7
Identity = 46/173 (26.59%), Postives = 78/173 (45.09%), Query Frame = 1
Query:   70 IKLLVVGPTKAGKTYLVN-FLSEAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKL---KADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTADRDIVQLTTNFDQIRSIKSNIDEAGD------QLREDFNRFL 558
            +K++ +G +  GK+ L+  FL +        +YRP    ++  Y   L  H+  L   K  V+FWD +G  ++++  P    NA+  + V++  +      L  W+   +R  R  ++ CCV+A+K    AD  I Q + NF +   +      A D        RE  NR L
Sbjct:   27 VKIICLGDSAVGKSKLMERFLMD--------EYRPQ---QMSTYALTLYKHTTTLGNKKVLVDFWDTAGQERFQSMHPSYYHNAHACIMVFDVQRKITYKNLSNWFKE-LREYR-PEIPCCVVANKI--DADLKITQRSFNFAKKHGLPFYFVSAADGTNVVKMFREMINRAL 184          
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Medaka
Match: rab18b (ras-related protein Rab-18-B [Source:NCBI gene;Acc:101171031])

HSP 1 Score: 46.2098 bits (108), Expect = 6.193e-6
Identity = 31/127 (24.41%), Postives = 57/127 (44.88%), Query Frame = 1
Query:   70 IKLLVVGPTKAGKTYLVNFLSEAI---EQSTKF--DYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHK 435
            +KLL++G +  GK+ L+   +E     EQS     D++    V+ +  E N        KA +  WD +G  ++    P   + A G++ VY+  + D   KL+ W +         D+   ++ +K
Sbjct:    9 LKLLIIGESGVGKSSLLLRFTEDTFDPEQSATIGVDFK----VKTLAIEGN--------KAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVSRRDSFTKLENWLNELETYTTRNDIVKMLVGNK 123          
BLAST of intraflagellar transport protein 22 homolog vs. Planmine SMEST
Match: SMESG000052133.1 (SMESG000052133.1)

HSP 1 Score: 389.808 bits (1000), Expect = 3.737e-140
Identity = 187/187 (100.00%), Postives = 187/187 (100.00%), Query Frame = 1
Query:   61 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTADRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLLNA 621
            MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTADRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLLNA
Sbjct:    1 MFKIKLLVVGPTKAGKTYLVNFLSEAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTADRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQEEQSLLNA 187          
BLAST of intraflagellar transport protein 22 homolog vs. Planmine SMEST
Match: SMESG000018562.1 (SMESG000018562.1)

HSP 1 Score: 52.373 bits (124), Expect = 4.637e-8
Identity = 31/124 (25.00%), Postives = 57/124 (45.97%), Query Frame = 1
Query:   52 LSKMFKIKLLVVGPTKAGKTYLVNFLS-EAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCC 420
            +S   K+K++V G +  GKT LVN L  + +  +  +       +++ +Y+A     +      VE WD+ G   + N   V     +GI+ VY+      +  L+EW +  +RR    + + C
Sbjct:    1 MSNYQKVKIIVAGDSGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYC---VELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQEGC 121          
BLAST of intraflagellar transport protein 22 homolog vs. Planmine SMEST
Match: SMESG000030620.1 (SMESG000030620.1)

HSP 1 Score: 46.595 bits (109), Expect = 1.664e-6
Identity = 30/128 (23.44%), Postives = 57/128 (44.53%), Query Frame = 1
Query:   64 FKIKLLVVGPTKAGKT-YLVNFLSEAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPN 444
            + +KL+++G +K GK+  LV F+ +    S    Y  T GV        LV    + K  ++ WD SG  +++       + ++G + VY+    +   +L EW +   +     ++  C  + K  N
Sbjct:    7 YLLKLVLIGDSKVGKSSLLVRFVDDIFSDS----YISTIGVDF----KTLVTEINEEKVKLQMWDTSGQKRFDTITTSYYRGSSGFLLVYDVTDRNSFTRLSEWMTRINKFAATNEIMFCETSAKSAN 126          
BLAST of intraflagellar transport protein 22 homolog vs. Planmine SMEST
Match: SMESG000018562.1 (SMESG000018562.1)

HSP 1 Score: 46.2098 bits (108), Expect = 6.043e-6
Identity = 31/129 (24.03%), Postives = 57/129 (44.19%), Query Frame = 1
Query:   52 LSKMFKIKLLVVGPT-----KAGKTYLVNFLS-EAIEQSTKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCC 420
            +S   K+K++V G +       GKT LVN L  + +  +  +       +++ +Y+A     +      VE WD+ G   + N   V     +GI+ VY+      +  L+EW +  +RR    + + C
Sbjct:    1 MSNYQKVKIIVAGDSVINSLGVGKTALVNMLCYDTVVTNPNWTIGAQVEIKLHDYQAGTPSQANYC---VELWDIGGYKNHTNSRSVFYSGTDGIILVYDVTNKKSENNLNEWLAEILRRNPDMNQEGC 126          
BLAST of intraflagellar transport protein 22 homolog vs. Planmine SMEST
Match: SMESG000031968.1 (SMESG000031968.1)

HSP 1 Score: 45.4394 bits (106), Expect = 8.924e-6
Identity = 34/128 (26.56%), Postives = 60/128 (46.88%), Query Frame = 1
Query:   67 KIKLLVVGPTKAGKTYLVN-FLSEAIEQSTKFDYRP----TKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIAKNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHK 435
            ++K++ +G +  GK+ LV  FL +         Y+P    T  + + +Y+ NL    KKL   V+FWD +G  +Y++        A+  + V++  +      LD WY     R    D+ C  +A+K
Sbjct:   17 RVKIICLGDSAVGKSKLVERFLMDG--------YQPQQLSTYALTLFKYQTNL--DGKKLT--VDFWDTAGQERYQSMHTSYYYQAHACILVFDVTRKITYKNLDNWYKEL--REHRPDIPCICVANK 130          
The following BLAST results are available for this feature:
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IFT222.772e-4837.43intraflagellar transport 22 [Source:HGNC Symbol;Ac... [more]
IFT222.772e-4837.43intraflagellar transport 22 [Source:HGNC Symbol;Ac... [more]
IFT223.064e-3532.09intraflagellar transport 22 [Source:HGNC Symbol;Ac... [more]
IFT221.679e-1932.08intraflagellar transport 22 [Source:HGNC Symbol;Ac... [more]
IFT221.679e-1932.08intraflagellar transport 22 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ifta-23.401e-2630.69Intraflagellar transport associated protein 2 [So... [more]
back to top
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Rab9Fb2.562e-623.19gene:FBgn0052670 transcript:FBtr0073401[more]
back to top
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ift229.237e-5140.11intraflagellar transport 22 homolog (Chlamydomonas... [more]
rab18a9.073e-622.79RAB18A, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab18a9.073e-622.79RAB18A, member RAS oncogene family [Source:ZFIN;Ac... [more]
back to top
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ift222.436e-4738.17intraflagellar transport 22 [Source:NCBI gene;Acc:... [more]
ift221.116e-3835.47intraflagellar transport 22 [Source:NCBI gene;Acc:... [more]
ENSXETT00000002310.14.243e-2631.46pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
back to top
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ift225.677e-4637.70intraflagellar transport 22 [Source:MGI Symbol;Acc... [more]
Ift226.531e-3642.11intraflagellar transport 22 [Source:MGI Symbol;Acc... [more]
Ift221.639e-3231.87intraflagellar transport 22 [Source:MGI Symbol;Acc... [more]
Ift225.220e-1243.28intraflagellar transport 22 [Source:MGI Symbol;Acc... [more]
back to top
BLAST of intraflagellar transport protein 22 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q567Y6|IFT22_DANRE6.973e-5040.11Intraflagellar transport protein 22 homolog OS=Dan... [more]
sp|Q9H7X7|IFT22_HUMAN1.331e-4737.43Intraflagellar transport protein 22 homolog OS=Hom... [more]
sp|Q4R4K5|IFT22_MACFA1.709e-4737.43Intraflagellar transport protein 22 homolog OS=Mac... [more]
sp|Q5M8K8|IFT22_XENTR1.290e-4638.17Intraflagellar transport protein 22 homolog OS=Xen... [more]
sp|Q5E9J4|IFT22_BOVIN1.012e-4537.43Intraflagellar transport protein 22 homolog OS=Bos... [more]
back to top
BLAST of intraflagellar transport protein 22 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8JN578.242e-6751.61Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A074Z2043.097e-6249.20GTP-binding domain protein OS=Opisthorchis viverri... [more]
A0A1S3H1D71.448e-5946.88intraflagellar transport protein 22 homolog OS=Lin... [more]
A0A2H1CII57.123e-5746.52Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A087UQT12.066e-5645.99Rab-like protein 5 (Fragment) OS=Stegodyphus mimos... [more]
back to top
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ift229.198e-5240.11intraflagellar transport 22 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000009567.15.836e-5338.54pep scaffold:Pmarinus_7.0:GL478108:281:3891:1 gene... [more]
ENSPMAT00000001552.12.366e-626.61pep scaffold:Pmarinus_7.0:GL476520:43153:47504:1 g... [more]
back to top
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YPT524.103e-623.02Endosomal Rab family GTPase; required for vacuolar... [more]
back to top
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO399198.243e-5843.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO424953.436e-622.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of intraflagellar transport protein 22 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ift224.903e-4837.97intraflagellar transport 22 [Source:NCBI gene;Acc:... [more]
rabl21.672e-726.59RAB, member of RAS oncogene family like 2B [Source... [more]
rab18b6.193e-624.41ras-related protein Rab-18-B [Source:NCBI gene;Acc... [more]
back to top
BLAST of intraflagellar transport protein 22 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052133.13.737e-140100.00SMESG000052133.1[more]
SMESG000018562.14.637e-825.00SMESG000018562.1[more]
SMESG000030620.11.664e-623.44SMESG000030620.1[more]
SMESG000018562.16.043e-624.03SMESG000018562.1[more]
SMESG000031968.18.924e-626.56SMESG000031968.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021469 ID=SMED30021469|Name=intraflagellar transport protein 22 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=654bp
ATTTGTTTAATTATATTAATTAAAAGATTTACCTTAGTGACAAAATTTAA
ACTATCAAAAATGTTTAAAATTAAACTTTTAGTTGTCGGCCCAACAAAGG
CTGGTAAAACATATCTTGTCAACTTTTTATCAGAAGCAATAGAACAATCC
ACTAAATTTGATTATCGTCCAACAAAAGGTGTCAGGATAATTGAATATGA
GGCTAATCTAGTTGTGCATTCCAAAAAGTTAAAAGCCGACGTGGAGTTTT
GGGATGTAAGTGGAGATTCAAAATACGAAAATTGTTGGCCTGTCATTGCT
AAAAATGCAAATGGAATTGTTTTTGTCTACAATCAAGACCAATCGGATCA
TGATGCAAAATTAGATGAATGGTATTCACATTTCGTGAGACGATTGCGCA
TGAAAGATCTCCAGTGTTGCGTGATTGCTCATAAAAAACCCAATACTGCC
GACCGTGACATTGTCCAATTAACAACGAATTTTGATCAGATTAGAAGCAT
TAAATCCAACATTGACGAGGCAGGAGATCAGTTAAGGGAGGATTTCAACA
GATTTCTAGCCCAGCTTATTAAAGTAGTGAATGAAACGAGTGATCAAGAG
GAACAAAGTTTATTGAATGCTTGATTTATTGTTATTTATGCTCTGGTAAT
GTCT
back to top

protein sequence of SMED30021469-orf-1

>SMED30021469-orf-1 ID=SMED30021469-orf-1|Name=SMED30021469-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=208bp
ICLIILIKRFTLVTKFKLSKMFKIKLLVVGPTKAGKTYLVNFLSEAIEQS
TKFDYRPTKGVRIIEYEANLVVHSKKLKADVEFWDVSGDSKYENCWPVIA
KNANGIVFVYNQDQSDHDAKLDEWYSHFVRRLRMKDLQCCVIAHKKPNTA
DRDIVQLTTNFDQIRSIKSNIDEAGDQLREDFNRFLAQLIKVVNETSDQE
EQSLLNA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium
GO:0005622intracellular
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
IPR013684MIRO-like
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePFAMPF08477Roccoord: 25..145
e-value: 1.1E-13
score: 51.4
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 23..206
e-value: 7.1E-21
score: 76.4
NoneNo IPR availablePANTHERPTHR24073:SF528INTRAFLAGELLAR TRANSPORT PROTEIN 22 HOMOLOGcoord: 25..156
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 25..156
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 19..152