SMED30021467

Overview
NameSMED30021467
Smed IDSMED30021467
Length (bp)939
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30021467 (SMED30021467) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30021467 (SMED30021467) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30021467 (SMED30021467) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30021467 (SMED30021467) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021467

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30021467SMESG000013722.1 dd_Smed_v4_1742_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30021467SMESG000013722.1 dd_Smed_v4_1742_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021467SMESG000013722.1 dd_Smed_v4_1742_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021467SMESG000013722.1 dd_Smed_v4_1742_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30021467SMESG000013722.1 dd_Smed_v4_1742_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021467SMESG000013722.1 dd_Smed_v4_1742_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30021467SMESG000013722.1 dd_Smed_v4_1742_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30021467SMESG000013722.1 dd_Smed_v6_1742_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30021467SMESG000013722.1 OX_Smed_1.0.12516ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30021467SMESG000013722.1 dd_Smed_v4_1742_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30021467 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000988:11756..12768 +4520
Homology
BLAST of SMED30021467 vs. Ensembl Human
Match: PGAM2 (phosphoglycerate mutase 2 [Source:HGNC Symbol;Acc:HGNC:8889])

HSP 1 Score: 263.077 bits (671), Expect = 3.323e-87
Identity = 128/229 (55.90%), Postives = 162/229 (70.74%), Query Frame = -2
Query:  159 VYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWP-----GLETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR 830
             +++V VRHGES +NQENRFCGW DA+LSE+G  EA+   K +KD    FDI YTSVLKRAI+TL  IL+  D  W+PVV+ WRLNER YG L  LNK+ETAAKHGE+QV+IWRR++ I PP +   D++ P       E +Y  L    +P  E LKDT+ RALPFW + IVP IK  K VLIAAHGNSLR ++K L+ + D  I+ LN+PTGIP+VYEL++ L P +
Sbjct:    3 THRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKMEFDICYTSVLKRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDIPPPPM---DEKHPYYNSISKERRYAGLKPGELPTCESLKDTIARALPFWNEEIVPQIKAGKRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELNKELKPTK 228          
BLAST of SMED30021467 vs. Ensembl Human
Match: PGAM1 (phosphoglycerate mutase 1 [Source:HGNC Symbol;Acc:HGNC:8888])

HSP 1 Score: 262.692 bits (670), Expect = 5.252e-87
Identity = 127/226 (56.19%), Postives = 165/226 (73.01%), Query Frame = -2
Query:  159 VYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLT--GIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR 830
             YK+V +RHGES +N ENRF GW+DADLS  G  EA+  G+ L+D GY FDI +TSV KRAI+TL  +L+ +D  W+PVV+ WRLNER YG L  LNK+ETAAKHGE QV+IWRR+Y + PP +E     +  +    ++ DLT   +P  E LKDT+ RALPFW + IVP IK+ K VLIAAHGNSLR ++K L+ + ++ I+ LN+PTGIP+VYELD+NL PI+
Sbjct:    3 AYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIK 228          
BLAST of SMED30021467 vs. Ensembl Human
Match: PGAM4 (phosphoglycerate mutase family member 4 [Source:HGNC Symbol;Acc:HGNC:21731])

HSP 1 Score: 248.44 bits (633), Expect = 2.309e-81
Identity = 122/226 (53.98%), Postives = 160/226 (70.80%), Query Frame = -2
Query:  159 VYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLT--GIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR 830
             YK+V +RHGES +N ENRF  W+DADLS  G  EA+  G+ L+D GY FDI  TSV KR I+TL  +L+ +D  W+PVV+ WRLNER YG L  LNK+ETAAKHGE QV+IWRR+Y + PP +E     +  +    ++ DLT   +P  E  KDT+ RALPFW + IVP IK+ K VLIAAHGNSL+ + K ++ + ++ I+ LN+PTGIP+VYELD+NL PI+
Sbjct:    3 AYKLVLIRHGESTWNLENRFSCWYDADLSPAGHEEAKRGGQALRDAGYEFDICLTSVQKRVIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSYESPKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLQGIAKHVEGLSEEAIMELNLPTGIPIVYELDKNLKPIK 228          
BLAST of SMED30021467 vs. Ensembl Human
Match: BPGM (bisphosphoglycerate mutase [Source:HGNC Symbol;Acc:HGNC:1093])

HSP 1 Score: 226.098 bits (575), Expect = 1.598e-72
Identity = 106/226 (46.90%), Postives = 151/226 (66.81%), Query Frame = -2
Query:  162 YKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGL--ETKYKHLD--LTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPI 827
            YK++ +RHGE  +N+ENRFC W D  L+ +G  EAR  GK LK   + FD+ +TSVL R+I T   IL EL   W+PV   WRLNER YGAL  LN+ + A  HGE+QV++WRR+Y + PP +E +   +  +  + +YK  D  L  +PR+E LKD +ER LP+W + I P +   K +LI+AHGNS RA++K L+ I D++I+ + +PTG+P++ ELDENL  +
Sbjct:    4 YKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAV 229          
BLAST of SMED30021467 vs. Ensembl Human
Match: BPGM (bisphosphoglycerate mutase [Source:HGNC Symbol;Acc:HGNC:1093])

HSP 1 Score: 226.098 bits (575), Expect = 1.598e-72
Identity = 106/226 (46.90%), Postives = 151/226 (66.81%), Query Frame = -2
Query:  162 YKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGL--ETKYKHLD--LTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPI 827
            YK++ +RHGE  +N+ENRFC W D  L+ +G  EAR  GK LK   + FD+ +TSVL R+I T   IL EL   W+PV   WRLNER YGAL  LN+ + A  HGE+QV++WRR+Y + PP +E +   +  +  + +YK  D  L  +PR+E LKD +ER LP+W + I P +   K +LI+AHGNS RA++K L+ I D++I+ + +PTG+P++ ELDENL  +
Sbjct:    4 YKLIMLRHGEGAWNKENRFCSWVDQKLNSEGMEEARNCGKQLKALNFEFDLVFTSVLNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREQMALNHGEEQVRLWRRSYNVTPPPIEESHPYYQEIYNDRRYKVCDVPLDQLPRSESLKDVLERLLPYWNERIAPEVLRGKTILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAV 229          
BLAST of SMED30021467 vs. Ensembl Fly
Match: Pglym78 (gene:FBgn0014869 transcript:FBtr0100483)

HSP 1 Score: 238.424 bits (607), Expect = 7.706e-78
Identity = 121/229 (52.84%), Postives = 157/229 (68.56%), Query Frame = -2
Query:  162 MPKVYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLTG---IPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPI 839
            M   YK+V VRHGES +NQ+N+FCGW+DA+LSE+G  EA  AGK +KD G  FD+A+TSVL RA  TL +IL       IP+ K WRLNER YG L  LNK+ETAAK+GE QVQIWRR++   PP +E     +  +    ++ +       P+ E LK T+ER LP+W D I+P +K+ K +LIAAHGNSLR ++K LD + +D I+ LN+PTGIP VYELDEN  P+
Sbjct:    1 MGGKYKIVMVRHGESEWNQKNQFCGWYDANLSEKGQEEALAAGKAVKDAGLEFDVAHTSVLTRAQVTLASILKASGHKEIPIQKTWRLNERHYGGLTGLNKAETAAKYGEAQVQIWRRSFDTPPPPMEPGHPYYENIVKDPRYAEGPKPEEFPQFESLKLTIERTLPYWNDVIIPQMKEGKRILIAAHGNSLRGIVKHLDNLSEDAIMALNLPTGIPFVYELDENFKPV 229          
BLAST of SMED30021467 vs. Ensembl Fly
Match: Pglym78 (gene:FBgn0014869 transcript:FBtr0100482)

HSP 1 Score: 238.424 bits (607), Expect = 7.706e-78
Identity = 121/229 (52.84%), Postives = 157/229 (68.56%), Query Frame = -2
Query:  162 MPKVYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLTG---IPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPI 839
            M   YK+V VRHGES +NQ+N+FCGW+DA+LSE+G  EA  AGK +KD G  FD+A+TSVL RA  TL +IL       IP+ K WRLNER YG L  LNK+ETAAK+GE QVQIWRR++   PP +E     +  +    ++ +       P+ E LK T+ER LP+W D I+P +K+ K +LIAAHGNSLR ++K LD + +D I+ LN+PTGIP VYELDEN  P+
Sbjct:    1 MGGKYKIVMVRHGESEWNQKNQFCGWYDANLSEKGQEEALAAGKAVKDAGLEFDVAHTSVLTRAQVTLASILKASGHKEIPIQKTWRLNERHYGGLTGLNKAETAAKYGEAQVQIWRRSFDTPPPPMEPGHPYYENIVKDPRYAEGPKPEEFPQFESLKLTIERTLPYWNDVIIPQMKEGKRILIAAHGNSLRGIVKHLDNLSEDAIMALNLPTGIPFVYELDENFKPV 229          
BLAST of SMED30021467 vs. Ensembl Fly
Match: Pglym78 (gene:FBgn0014869 transcript:FBtr0085384)

HSP 1 Score: 238.424 bits (607), Expect = 7.706e-78
Identity = 121/229 (52.84%), Postives = 157/229 (68.56%), Query Frame = -2
Query:  162 MPKVYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLTG---IPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPI 839
            M   YK+V VRHGES +NQ+N+FCGW+DA+LSE+G  EA  AGK +KD G  FD+A+TSVL RA  TL +IL       IP+ K WRLNER YG L  LNK+ETAAK+GE QVQIWRR++   PP +E     +  +    ++ +       P+ E LK T+ER LP+W D I+P +K+ K +LIAAHGNSLR ++K LD + +D I+ LN+PTGIP VYELDEN  P+
Sbjct:    1 MGGKYKIVMVRHGESEWNQKNQFCGWYDANLSEKGQEEALAAGKAVKDAGLEFDVAHTSVLTRAQVTLASILKASGHKEIPIQKTWRLNERHYGGLTGLNKAETAAKYGEAQVQIWRRSFDTPPPPMEPGHPYYENIVKDPRYAEGPKPEEFPQFESLKLTIERTLPYWNDVIIPQMKEGKRILIAAHGNSLRGIVKHLDNLSEDAIMALNLPTGIPFVYELDENFKPV 229          
BLAST of SMED30021467 vs. Ensembl Fly
Match: Pglym87 (gene:FBgn0011270 transcript:FBtr0082620)

HSP 1 Score: 239.58 bits (610), Expect = 9.572e-78
Identity = 121/225 (53.78%), Postives = 154/225 (68.44%), Query Frame = -2
Query:  162 YKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGL--ETKYK-HLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPI 827
            Y++V VRHGES +NQ+N FCGW DA LSE+G  EA  AGK LKD    FD+A+TSVL RA +TL   L   +   IPV   WRLNER YG L  LNK+ETA K GE++V+IWRR++   PP +E   + +  +  + +YK  L     P++E LK T+ER LP+W + IVP IKD   VLIAAHGNSLR V+K L+ I D +I+ LN+PTGIP VYELDE+L P+
Sbjct:   42 YRIVMVRHGESEWNQKNLFCGWFDAKLSEKGQQEACAAGKALKDAKIEFDVAHTSVLTRAQETLRAALKSSEHKKIPVCTTWRLNERHYGGLTGLNKAETAKKFGEEKVKIWRRSFDTPPPPMEKDHEYYACIVEDPRYKDQLKPEEFPKSESLKLTIERTLPYWNEVIVPQIKDGMRVLIAAHGNSLRGVVKHLECISDKDIMSLNLPTGIPFVYELDESLKPL 266          
BLAST of SMED30021467 vs. Ensembl Fly
Match: CG7059 (gene:FBgn0038957 transcript:FBtr0084221)

HSP 1 Score: 152.91 bits (385), Expect = 2.322e-44
Identity = 82/223 (36.77%), Postives = 123/223 (55.16%), Query Frame = -2
Query:  180 MPKVYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEARE-AGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETK--YKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELD 839
            M K  ++V +RHGES +N EN+FCGWHDA LSE G  EA   A   L      FD+ Y+SVL R+ +T   IL++L+  ++P+ + WRL ER YG L    K   A ++GE+QVQ WRR Y   PP ++  ++ +  + +   +  +     P  E L   V+R  P W   +   +     VL+  HG   RA+++ ++ I ++ I  +NIP  +P VYE D
Sbjct:   10 MTKTNRLVILRHGESDFNIENKFCGWHDAPLSEFGVQEALTVAIPALVQSELEFDVVYSSVLSRSRQTAELILSKLNCAYVPIKEDWRLCERHYGNLTGCRKRVVADRYGEEQVQAWRRGYDCVPPPIDEKNRYFYTICSNPIFDDVPRGEFPLAESLHMCVDRVKPVW-KEVRREVFQGTRVLMCVHGTVARALVQHIEGISNEAIEKVNIPNCVPRVYEFD 231          
BLAST of SMED30021467 vs. Ensembl Zebrafish
Match: pgam1a (phosphoglycerate mutase 1a [Source:ZFIN;Acc:ZDB-GENE-030131-1827])

HSP 1 Score: 277.33 bits (708), Expect = 5.962e-93
Identity = 131/226 (57.96%), Postives = 168/226 (74.34%), Query Frame = -2
Query:  159 VYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLT--GIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR 830
             YK+V +RHGES +NQENRFCGW DADLSE G  EA+  G+ LKD G+ FDI YTSVLKRAI+TL  +L+ +D  W+PV + WRLNER YG L  LNK+ETAAKHGE QV+IWRR+Y I PP+++     +  +    ++ DLT   +P  E LKDT+ RALPFW D IVP IK+ K VLIAAHGNSLR ++K L+ + ++ I+ LN+PTGIP++YELD+NL PI+
Sbjct:    3 AYKLVLIRHGESCWNQENRFCGWFDADLSETGAQEAKRGGQALKDAGFEFDICYTSVLKRAIRTLWIVLDSIDQMWLPVHRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDIPPPSMDEDHDFYSIISKDRRYGDLTEDQLPSCESLKDTIARALPFWNDEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGMSEEAIMELNLPTGIPILYELDKNLKPIK 228          
BLAST of SMED30021467 vs. Ensembl Zebrafish
Match: pgam1b (phosphoglycerate mutase 1b [Source:ZFIN;Acc:ZDB-GENE-030131-5376])

HSP 1 Score: 275.018 bits (702), Expect = 4.626e-92
Identity = 130/226 (57.52%), Postives = 168/226 (74.34%), Query Frame = -2
Query:  159 VYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLT--GIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR 830
             YK+V +RHGESV+NQENRFCGW DADLS+ G  EA+  G+ LKD GY FDI YTSVLKRAI+TL  +L+ +D  W+PV + WRLNER YG L  LNK+ETAAKHGE QV+IWRR+Y I PP ++     +  +    ++ DLT   +P  E LKDT+ RALPFW + IVP IK+ K VLIAAHGNSLR ++K L+ + ++ I+ LN+PTGIP++YELD+NL P++
Sbjct:    3 AYKLVLIRHGESVWNQENRFCGWFDADLSDTGEAEAKRGGQALKDAGYEFDICYTSVLKRAIRTLWLVLDGIDQMWLPVHRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDIPPPPMDPEHDFYTAISKDRRYGDLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGMSEEAIMELNLPTGIPILYELDKNLKPVK 228          
BLAST of SMED30021467 vs. Ensembl Zebrafish
Match: pgam2 (phosphoglycerate mutase 2 (muscle) [Source:ZFIN;Acc:ZDB-GENE-040116-6])

HSP 1 Score: 271.937 bits (694), Expect = 8.400e-91
Identity = 132/232 (56.90%), Postives = 165/232 (71.12%), Query Frame = -2
Query:  159 MPKVYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWP-----GLETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR 839
            M   +++V VRHGES +NQENRFCGW DADLSE+G  EA+   + +KD G  FD+ YTSVLKRAIKTL  I+   D  W+PVV+ WRLNER YG L  LNK+ETAAKHGE+QV+IWRR++ I PP +   DK  P         +YK L    +P  E LKDT+ RALPFW + IVP IK  KNV+IAAHGNSLR ++K L+ + D  I+ LN+PTGIP+VYELD++L PI+
Sbjct:    1 MAAAHRLVIVRHGESSWNQENRFCGWFDADLSEKGLEEAKRGAQAIKDAGMKFDVCYTSVLKRAIKTLWTIMEGTDQMWVPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDIPPPPM---DKDHPYHKIISESRRYKGLKEGELPICESLKDTIARALPFWNEVIVPEIKAGKNVIIAAHGNSLRGIVKHLESMSDAAIMELNLPTGIPIVYELDKDLKPIK 229          
BLAST of SMED30021467 vs. Ensembl Zebrafish
Match: bpgm (2,3-bisphosphoglycerate mutase [Source:ZFIN;Acc:ZDB-GENE-040718-375])

HSP 1 Score: 228.024 bits (580), Expect = 1.715e-73
Identity = 106/227 (46.70%), Postives = 154/227 (67.84%), Query Frame = -2
Query:  159 YKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGL--ETKYKHLDLTG--IPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR 827
            YK+  +RHGE  +N+ENRFC W D  LSE G  EA+E G++LK+ GY  D  +TS+L R+I T   +L  +   W+PV K WRLNER YGAL  LN++E A  HGE+QV++WRR+Y I PP +  +   +  +  + +Y   D+    +P+TE LK+ ++R LP+W D IVP IK  + VLI+AHGNS RA++K L+ I + +IV + +PTG+P++ ELDE+L P++
Sbjct:    4 YKLFLLRHGEGAWNKENRFCSWVDQKLSENGVVEAQECGRLLKENGYQLDQVFTSILSRSIHTAWLVLEAMGHEWVPVTKSWRLNERHYGALIGLNRAEMALNHGEEQVKLWRRSYDITPPPIHESHPYYAEIYNDRRYSTCDVPKEELPKTESLKEVLDRLLPYWNDVIVPVIKSGQTVLISAHGNSCRALLKHLEAISETDIVNVTLPTGVPVLLELDEDLRPVK 230          
BLAST of SMED30021467 vs. Ensembl Zebrafish
Match: bpgm (2,3-bisphosphoglycerate mutase [Source:ZFIN;Acc:ZDB-GENE-040718-375])

HSP 1 Score: 228.024 bits (580), Expect = 1.715e-73
Identity = 106/227 (46.70%), Postives = 154/227 (67.84%), Query Frame = -2
Query:  159 YKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGL--ETKYKHLDLTG--IPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR 827
            YK+  +RHGE  +N+ENRFC W D  LSE G  EA+E G++LK+ GY  D  +TS+L R+I T   +L  +   W+PV K WRLNER YGAL  LN++E A  HGE+QV++WRR+Y I PP +  +   +  +  + +Y   D+    +P+TE LK+ ++R LP+W D IVP IK  + VLI+AHGNS RA++K L+ I + +IV + +PTG+P++ ELDE+L P++
Sbjct:    4 YKLFLLRHGEGAWNKENRFCSWVDQKLSENGVVEAQECGRLLKENGYQLDQVFTSILSRSIHTAWLVLEAMGHEWVPVTKSWRLNERHYGALIGLNRAEMALNHGEEQVKLWRRSYDITPPPIHESHPYYAEIYNDRRYSTCDVPKEELPKTESLKEVLDRLLPYWNDVIVPVIKSGQTVLISAHGNSCRALLKHLEAISETDIVNVTLPTGVPVLLELDEDLRPVK 230          
BLAST of SMED30021467 vs. Ensembl Xenopus
Match: tdrd6 (tudor domain containing 6 [Source:Xenbase;Acc:XB-GENE-5969988])

HSP 1 Score: 278.1 bits (710), Expect = 4.004e-93
Identity = 129/226 (57.08%), Postives = 168/226 (74.34%), Query Frame = -2
Query:  159 VYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLT--GIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR 830
             YK+V +RHGES +NQENRFCGW DADLSE G  EA+  G+ LKD GY FDI +TSVLKRAI+TL  +L  +D  W+PVV+ WRLNER YG L  LNK+ETAAKHGE+QV+IWRR++ I PP+++     +  +    ++ DLT   +P  E LKDT+ RALPFW + IVP IK  K VLIAAHGNSLR ++K ++ + D+ I+ LN+PTG+P++YELD+NL PI+
Sbjct:    3 AYKIVLIRHGESSWNQENRFCGWFDADLSETGQQEAKSGGQALKDAGYEFDICFTSVLKRAIRTLWIVLEGIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDIPPPSMDPDHDYYSIISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPLIKQGKRVLIAAHGNSLRGIVKHIEGMSDEAIMALNLPTGVPIIYELDKNLKPIK 228          
BLAST of SMED30021467 vs. Ensembl Xenopus
Match: pgam2 (phosphoglycerate mutase 2 [Source:NCBI gene;Acc:448157])

HSP 1 Score: 263.848 bits (673), Expect = 1.602e-87
Identity = 131/230 (56.96%), Postives = 165/230 (71.74%), Query Frame = -2
Query:  159 MPKVYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETK---YKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR 839
            MP  +++V VRHGES +NQENRFCGW DADLSE+G  EAR   + +K+ G  FDI YTSVLKRA++TL  IL+ +D  W+PVV+ WRLNER YG L  LNK+ETA KHGE+QV+IWRR++ I PP +   D  +  L +K   YK L    +P  E LKDT+ RALPFW + I P I   K V+IAAHGNSLR ++K LD + D  I+ LN+PTGIP+VYELD+NL PI+
Sbjct:    1 MP--HRLVIVRHGESSWNQENRFCGWFDADLSEKGAEEARRGAQAIKEAGMEFDICYTSVLKRAVRTLWYILDGIDQMWLPVVRTWRLNERHYGGLTGLNKAETAEKHGEEQVKIWRRSFDIPPPVMG-EDHSYYKLISKDRRYKDLTQKELPSCESLKDTIARALPFWNEVIAPQILAGKRVMIAAHGNSLRGIVKHLDGMSDAAIMELNLPTGIPIVYELDDNLKPIK 227          
BLAST of SMED30021467 vs. Ensembl Xenopus
Match: pabpn1l (poly(A) binding protein, nuclear 1-like (cytoplasmic) [Source:Xenbase;Acc:XB-GENE-1000600])

HSP 1 Score: 239.58 bits (610), Expect = 6.035e-78
Identity = 113/232 (48.71%), Postives = 160/232 (68.97%), Query Frame = -2
Query:  147 YKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLET--KYKHLDL--TGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR-HYYL 827
            YK+V +RHGE  +N ENRFC W D  LS  G  EA E GK LK  G+ FD+ +TS+L R+I+T   +L ELD  W+P+   WRLNER YGAL  LN++E A  HGE+QV+IWRR+Y ++PP ++ +   +  + T  +Y   D+    +P++E LK  +ER LP+W + I P IK+ K VLI+AHGNS RA++K L+ I D +IV +++PTG+P++ ELDENLHP++ H +L
Sbjct:    4 YKLVMLRHGEGAWNIENRFCSWVDQKLSADGLREAEECGKKLKSLGFEFDLVFTSILSRSIQTAWLVLRELDQEWVPIQSSWRLNERHYGALIGLNRAELALNHGEEQVKIWRRSYDVSPPPIDASHPYYQEIHTDRRYTTCDIPKEKLPKSESLKQVLERLLPYWNEVIAPEIKNGKRVLISAHGNSTRALLKHLEGISDSDIVNISLPTGVPVLLELDENLHPVKPHEFL 235          
BLAST of SMED30021467 vs. Ensembl Mouse
Match: Pgam1 (phosphoglycerate mutase 1 [Source:MGI Symbol;Acc:MGI:97552])

HSP 1 Score: 262.692 bits (670), Expect = 4.065e-87
Identity = 127/226 (56.19%), Postives = 165/226 (73.01%), Query Frame = -2
Query:  159 VYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLT--GIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR 830
             YK+V +RHGES +N ENRF GW+DADLS  G  EA+  G+ L+D GY FDI +TSV KRAI+TL  +L+ +D  W+PVV+ WRLNER YG L  LNK+ETAAKHGE QV+IWRR+Y + PP +E     +  +    ++ DLT   +P  E LKDT+ RALPFW + IVP IK+ K VLIAAHGNSLR ++K L+ + ++ I+ LN+PTGIP+VYELD+NL PI+
Sbjct:    3 AYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIK 228          
BLAST of SMED30021467 vs. Ensembl Mouse
Match: Pgam2 (phosphoglycerate mutase 2 [Source:MGI Symbol;Acc:MGI:1933118])

HSP 1 Score: 260.381 bits (664), Expect = 2.587e-86
Identity = 123/226 (54.42%), Postives = 160/226 (70.80%), Query Frame = -2
Query:  159 VYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGL--ETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR 830
             +++V VRHGES++NQENRFCGW DA+LSE+G  EA+     +KD    FDI YTSVLKRAI+TL  IL+  D  W+PVV+ WRLNER YG L  LNK+ETAAKHGE+QV+IWRR++   PP ++     +  +  + +Y  L    +P  E LKDT+ RALPFW + I P IK  + VLIAAHGNSLR ++K L+ + D  I+ LN+PTGIP+VYELD+NL P +
Sbjct:    3 THRLVMVRHGESLWNQENRFCGWFDAELSEKGAEEAKRGATAIKDAKIEFDICYTSVLKRAIRTLWTILDVTDQMWVPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDTPPPPMDEKHNYYTSISKDRRYAGLKPEELPTCESLKDTIARALPFWNEEIAPKIKAGQRVLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELDQNLKPTK 228          
BLAST of SMED30021467 vs. Ensembl Mouse
Match: Bpgm (2,3-bisphosphoglycerate mutase [Source:MGI Symbol;Acc:MGI:1098242])

HSP 1 Score: 219.935 bits (559), Expect = 2.679e-70
Identity = 104/226 (46.02%), Postives = 151/226 (66.81%), Query Frame = -2
Query:  162 YKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGL--ETKYKHLD--LTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPI 827
            +K++ +RHGE  +N+ENRFC W D  L+  G  EAR  G+ LK   + FD+ +TS+L R+I T   IL EL   W+PV   WRLNER YGAL  LN+ + A  HGE+QV++WRR+Y + PP +E +   +  +  + +YK  D  L  +PR+E LKD +ER LP+W + I P I   K++LI+AHGNS RA++K L+ I D++I+ + +PTG+P++ ELDENL  +
Sbjct:    4 HKLIILRHGEGQWNKENRFCSWVDQKLNNDGLEEARNCGRQLKALNFEFDLVFTSILNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREKMALNHGEEQVRLWRRSYNVTPPPIEESHPYFHEIYSDRRYKVCDVPLDQLPRSESLKDVLERLLPYWKERIAPEILKGKSILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAV 229          
BLAST of SMED30021467 vs. Ensembl Mouse
Match: Bpgm (2,3-bisphosphoglycerate mutase [Source:MGI Symbol;Acc:MGI:1098242])

HSP 1 Score: 150.214 bits (378), Expect = 1.975e-44
Identity = 74/163 (45.40%), Postives = 104/163 (63.80%), Query Frame = -2
Query:  351 YKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGL--ETKYKHLD--LTGIPRTECLKDTVERAL 827
            +K++ +RHGE  +N+ENRFC W D  L+  G  EAR  G+ LK   + FD+ +TS+L R+I T   IL EL   W+PV   WRLNER YGAL  LN+ + A  HGE+QV++WRR+Y + PP +E +   +  +  + +YK  D  L  +PR+E LKD +ER L
Sbjct:    4 HKLIILRHGEGQWNKENRFCSWVDQKLNNDGLEEARNCGRQLKALNFEFDLVFTSILNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREKMALNHGEEQVRLWRRSYNVTPPPIEESHPYFHEIYSDRRYKVCDVPLDQLPRSESLKDVLERLL 166          
BLAST of SMED30021467 vs. Ensembl Mouse
Match: Bpgm (2,3-bisphosphoglycerate mutase [Source:MGI Symbol;Acc:MGI:1098242])

HSP 1 Score: 137.887 bits (346), Expect = 4.862e-40
Identity = 61/124 (49.19%), Postives = 83/124 (66.94%), Query Frame = -2
Query:  456 YKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALE 827
            +K++ +RHGE  +N+ENRFC W D  L+  G  EAR  G+ LK   + FD+ +TS+L R+I T   IL EL   W+PV   WRLNER YGAL  LN+ + A  HGE+QV++WRR+Y + PP +E
Sbjct:    4 HKLIILRHGEGQWNKENRFCSWVDQKLNNDGLEEARNCGRQLKALNFEFDLVFTSILNRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREKMALNHGEEQVRLWRRSYNVTPPPIE 127          
BLAST of SMED30021467 vs. UniProt/SwissProt
Match: sp|Q54NE6|PGAM_DICDI (Probable phosphoglycerate mutase OS=Dictyostelium discoideum OX=44689 GN=gpmA PE=1 SV=1)

HSP 1 Score: 331.257 bits (848), Expect = 1.785e-113
Identity = 154/228 (67.54%), Postives = 188/228 (82.46%), Query Frame = -2
Query:  147 VYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIRHYYL 830
            VYK+V +RHGES +N+EN+F GW D DLSE+G  EA EAGK L   G+TFDIAYTSVLKRAI+TL  +L EL+L+WIPV + WRLNERMYG+LQ LNKSETAAK+GE QV IWRR+Y I PPALE +D+R+PG + +Y  LD + +P+TECLKDTVER LP W D+I P+IK  + VLIAAHGNS+RA++K+LD I DD+IV ++IPTGIPLVYELDENL PI+HYYL
Sbjct:    2 VYKLVLIRHGESTWNKENKFTGWTDVDLSEKGVQEAHEAGKRLLKAGFTFDIAYTSVLKRAIRTLWILLEELNLYWIPVSRQWRLNERMYGSLQGLNKSETAAKYGEDQVLIWRRSYDIPPPALEESDERYPGNDPRYAKLDKSDLPKTECLKDTVERFLPLWNDTIAPTIKSGQKVLIAAHGNSIRALVKYLDNIADDKIVSMDIPTGIPLVYELDENLKPIKHYYL 229          
BLAST of SMED30021467 vs. UniProt/SwissProt
Match: sp|B3QVL0|GPMA_CHLT3 (2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) OX=517418 GN=gpmA PE=3 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 1.063e-107
Identity = 147/226 (65.04%), Postives = 184/226 (81.42%), Query Frame = -2
Query:  147 KVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIRHYYL 824
            K+V +RHGESV+N+ENRF GW D DL+E+G  EA+ AG+ +K +G  FDIAYTSVLKRAI+TLN  LNE+DL WIPV K WRLNER YGALQ LNKSETA K GE+QV IWRR+Y   PPALE +D+R+PG + +YK L    +P TECLKDTVER LP+W ++I P+IK  K V+IAAHGNSLR+++K+LD I D++IVGLNIPTG+PLVYELD+++ PI++YYL
Sbjct:    3 KLVLLRHGESVWNKENRFTGWKDVDLTEKGVQEAKRAGEFMKKEGLDFDIAYTSVLKRAIRTLNLALNEMDLQWIPVNKTWRLNERHYGALQGLNKSETAEKFGEEQVLIWRRSYDTPPPALEKSDERYPGHDPRYKDLTEAELPLTECLKDTVERFLPYWHETIAPTIKSGKRVIIAAHGNSLRSLVKYLDNISDEDIVGLNIPTGMPLVYELDDDMKPIKNYYL 228          
BLAST of SMED30021467 vs. UniProt/SwissProt
Match: sp|Q3AU60|GPMA_CHLCH (2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobium chlorochromatii (strain CaD3) OX=340177 GN=gpmA PE=3 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 1.395e-106
Identity = 142/226 (62.83%), Postives = 183/226 (80.97%), Query Frame = -2
Query:  147 KVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIRHYYL 824
            K+V +RHGES +N+ENRF GWHD DL++QG  EA  AGK+L+ +G+TFDIAYTSVLKRAI+TL ++L+E+DL W+PV K WRLNER YGALQ LNK+ETA K+GE+QV +WRR+Y   PPALE +D R+PG + +Y  L    +P TECLKDTV R LP W ++I P I+  +NV+IAAHGNS+RA++K+LD + +D+IVG+NIPTGIPLVYELD++L PIR YYL
Sbjct:    3 KLVLLRHGESQWNRENRFTGWHDIDLTDQGRIEASNAGKLLRAEGFTFDIAYTSVLKRAIRTLWHVLDEMDLMWLPVTKSWRLNERHYGALQGLNKAETAQKYGEEQVLVWRRSYDTPPPALEKSDARYPGSQARYASLSEAEVPLTECLKDTVARFLPLWHETIAPEIRKGRNVIIAAHGNSIRALVKYLDNVSEDDIVGINIPTGIPLVYELDDDLKPIRSYYL 228          
BLAST of SMED30021467 vs. UniProt/SwissProt
Match: sp|B1GZZ1|GPMA_UNCTG (2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 OX=471821 GN=gpmA PE=3 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 1.818e-106
Identity = 148/228 (64.91%), Postives = 180/228 (78.95%), Query Frame = -2
Query:  147 VYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIRHYYL 830
            +YKVV +RHGESV+N+EN+F GW D DLSE+G  EA +AGK LK  G+TFD+AYTSVLKRAIKTL N+LN +DL W PVVK WRLNER YGALQ LNK+ETAAK+GE+QV+IWRR+Y IAP AL+  D+R+PG E +Y  L    IP  ECLKDTV R +P+W   +VP IK  K ++IAAHGNSLRA++K+LD I D  IV LNIPT +PLVYELDENL  +++YYL
Sbjct:    1 MYKVVLIRHGESVWNKENKFTGWSDVDLSEKGNEEALKAGKQLKKDGFTFDLAYTSVLKRAIKTLWNVLNTMDLLWTPVVKDWRLNERHYGALQGLNKAETAAKYGEEQVKIWRRSYDIAPMALDENDERYPGKEARYSGLLKGEIPLAECLKDTVARVVPYWGKEVVPQIKAGKKIIIAAHGNSLRALVKYLDNISDSNIVNLNIPTAMPLVYELDENLKAVKNYYL 228          
BLAST of SMED30021467 vs. UniProt/SwissProt
Match: sp|Q8KFC8|GPMA_CHLTE (2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Chlorobaculum tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) OX=194439 GN=gpmA PE=3 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 2.330e-106
Identity = 143/226 (63.27%), Postives = 183/226 (80.97%), Query Frame = -2
Query:  147 KVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIRHYYL 824
            K+V +RHGES +N+ENRF GW D DLSE+G  EAR AG++LKD+G+ FD+AYTSVLKRAI+TL  +L+E++L WIPV K+WRLNER YGALQ LNK+ETA +HG++QV IWRR+Y   PPAL  +D+ WPG + +Y  L    +P TECLKDTV R LP+W ++I P I+D KNV+I AHGNSLRA++K+LD I D++IVGLNIPTGIPLVYELD++L P++ YYL
Sbjct:    3 KLVLLRHGESQWNRENRFTGWVDVDLSEKGREEARTAGQLLKDEGFVFDLAYTSVLKRAIRTLWTVLDEMNLMWIPVTKNWRLNERHYGALQGLNKAETAQRHGDEQVLIWRRSYDTPPPALTESDEFWPGKDPRYASLSSQELPATECLKDTVARFLPYWHETIAPQIRDGKNVIITAHGNSLRALVKYLDNISDEDIVGLNIPTGIPLVYELDDDLKPLKSYYL 228          
BLAST of SMED30021467 vs. TrEMBL
Match: W6UW68 (PGAM OS=Echinococcus granulosus OX=6210 GN=EGR_00140 PE=2 SV=1)

HSP 1 Score: 380.178 bits (975), Expect = 3.363e-130
Identity = 175/231 (75.76%), Postives = 200/231 (86.58%), Query Frame = -2
Query:  147 MPKVYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIRHYYL 839
            M  VYKVVF+RHGESVYNQENRFCGWHDADLS +G  EA+ AGKM+K++G +FD+A+TSVLKRAIKTLN++L   DLHWIPV K WRLNERMYG LQ LNKSETAAKHGE QV++WRRAY I+PP LE++DKRWPGLE KYK LD+  IP TECLKDTVERALPFWFDSIVP+IK  K VLI AHGNSLRA++KFLD + D +IV LNIPTGIPLVYELD+NL P++HYYL
Sbjct:    1 MASVYKVVFIRHGESVYNQENRFCGWHDADLSPKGEQEAQNAGKMIKERGLSFDVAFTSVLKRAIKTLNHVLEVNDLHWIPVYKSWRLNERMYGGLQGLNKSETAAKHGEDQVKVWRRAYDISPPPLEVSDKRWPGLEEKYKLLDIECIPVTECLKDTVERALPFWFDSIVPAIKQGKRVLITAHGNSLRAIVKFLDNVSDKDIVELNIPTGIPLVYELDKNLRPVKHYYL 231          
BLAST of SMED30021467 vs. TrEMBL
Match: A0A0R3W3E9 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS4443 PE=3 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 5.564e-130
Identity = 179/231 (77.49%), Postives = 199/231 (86.15%), Query Frame = -2
Query:  147 MPKVYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIRHYYL 839
            M  VYKVVF+RHGESVYNQENRFCGWHDADLS +G  EA+ AGKM+K+ G TFDIA+TSVLKRAIKTLN++L   DLHWIPV K WRLNERMYG LQ LNKSETAAKHGE QV+IWRRAY I PP LE++DKRWPGLE KYK LD+  IP TECLKDTVERALPFWFDS+VP+IK  K VLI AHGNSLRA++KFLDKI D +IV LNIPTGIPLVYELD+NL P++HYYL
Sbjct:    1 MGSVYKVVFIRHGESVYNQENRFCGWHDADLSPKGEQEAQCAGKMIKENGLTFDIAFTSVLKRAIKTLNHVLEVNDLHWIPVYKSWRLNERMYGGLQGLNKSETAAKHGEDQVKIWRRAYDIPPPPLEVSDKRWPGLEEKYKMLDIECIPVTECLKDTVERALPFWFDSVVPAIKQGKRVLITAHGNSLRAIVKFLDKIPDKDIVELNIPTGIPLVYELDKNLRPVKHYYL 231          
BLAST of SMED30021467 vs. TrEMBL
Match: A0A068WB02 (Phosphoglycerate mutase OS=Echinococcus granulosus OX=6210 GN=EgrG_000799500 PE=3 SV=1)

HSP 1 Score: 381.333 bits (978), Expect = 6.916e-130
Identity = 175/231 (75.76%), Postives = 200/231 (86.58%), Query Frame = -2
Query:  147 MPKVYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIRHYYL 839
            M  VYKVVF+RHGESVYNQENRFCGWHDADLS +G  EA+ AGKM+K++G +FD+A+TSVLKRAIKTLN++L   DLHWIPV K WRLNERMYG LQ LNKSETAAKHGE QV++WRRAY I+PP LE++DKRWPGLE KYK LD+  IP TECLKDTVERALPFWFDSIVP+IK  K VLI AHGNSLRA++KFLD + D +IV LNIPTGIPLVYELD+NL P++HYYL
Sbjct:    1 MASVYKVVFIRHGESVYNQENRFCGWHDADLSPKGEQEAQNAGKMIKERGLSFDVAFTSVLKRAIKTLNHVLEVNDLHWIPVYKSWRLNERMYGGLQGLNKSETAAKHGEDQVKVWRRAYDISPPPLEVSDKRWPGLEEKYKLLDIECIPVTECLKDTVERALPFWFDSIVPAIKQGKRVLITAHGNSLRAIVKFLDNVSDKDIVELNIPTGIPLVYELDKNLRPVKHYYL 231          
BLAST of SMED30021467 vs. TrEMBL
Match: A0A068YDW9 (Phosphoglycerate mutase OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000799500 PE=3 SV=1)

HSP 1 Score: 379.793 bits (974), Expect = 2.541e-129
Identity = 174/231 (75.32%), Postives = 199/231 (86.15%), Query Frame = -2
Query:  147 MPKVYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIRHYYL 839
            M  VYKVVF+RHGESVYNQENRFCGWHDADLS +G  EA+ AGKM+K++G +FD+A+TSVLKRAIKTLN++L   DLHWIPV K WRLNERMYG LQ LNKSETAAKHGE QV++WRRAY I PP LE++DKRWPGLE KYK LD+  IP TECLKDTVERALPFWFDS+VP+IK  K VLI AHGNSLRA++KFLD + D +IV LNIPTGIPLVYELD+NL P++HYYL
Sbjct:    1 MASVYKVVFIRHGESVYNQENRFCGWHDADLSPKGEQEAQNAGKMIKERGLSFDVAFTSVLKRAIKTLNHVLEVNDLHWIPVYKSWRLNERMYGGLQGLNKSETAAKHGEAQVKVWRRAYDIPPPPLEVSDKRWPGLEEKYKLLDIECIPVTECLKDTVERALPFWFDSVVPAIKQGKRVLITAHGNSLRAIVKFLDNVSDKDIVELNIPTGIPLVYELDKNLRPVKHYYL 231          
BLAST of SMED30021467 vs. TrEMBL
Match: A0A0R3SQN8 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7400 PE=3 SV=1)

HSP 1 Score: 376.326 bits (965), Expect = 1.192e-128
Identity = 177/231 (76.62%), Postives = 197/231 (85.28%), Query Frame = -2
Query:  147 MPKVYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIRHYYL 839
            M  +YKVVF+RHGESVYNQENRFCGWHDADLS +G  EAR AG+M+K+KG +FD+AYTSVLKRAIKTLN +L   DLHWIPV K WRLNERMYG LQ LNKSETAAKHGE QV+IWRRAY I PPALEI+D RWPG E KYK LD + IP TECLKDTVERALPFWFD IVP+IK  K VLI AHGNSLRA++KFLD I D+EIV LNIPTGIPLVYELD++L P++HYYL
Sbjct:    1 MASLYKVVFIRHGESVYNQENRFCGWHDADLSPKGEQEARSAGQMIKEKGLSFDVAYTSVLKRAIKTLNAVLEVNDLHWIPVHKSWRLNERMYGGLQGLNKSETAAKHGEAQVKIWRRAYDIPPPALEISDDRWPGKEEKYKMLDKSCIPLTECLKDTVERALPFWFDQIVPAIKQGKRVLITAHGNSLRAIVKFLDNIPDNEIVELNIPTGIPLVYELDKDLRPVKHYYL 231          
BLAST of SMED30021467 vs. Ensembl Cavefish
Match: pgam1a (phosphoglycerate mutase 1 [Source:NCBI gene;Acc:103038634])

HSP 1 Score: 275.404 bits (703), Expect = 3.222e-92
Identity = 131/226 (57.96%), Postives = 165/226 (73.01%), Query Frame = -2
Query:  159 VYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLT--GIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR 830
             YK+V +RHGES +NQENRFCGW DADLSE G  EA+  G  LKD G+ FDI YTSVLKRAI+TL  +L+ +D  W+PV + WRLNER YG L  LNK+ETAAKHGE QV+IWRR+Y I PP +E     +  +    ++ DL+   +P  E LKDT+ RALPFW D IVP IK  K VLIAAHGNSLR ++K L+ + ++ I+ LN+PTGIP++YELD+NL PI+
Sbjct:    3 AYKLVLIRHGESCWNQENRFCGWFDADLSETGIQEAKRGGVALKDAGFEFDICYTSVLKRAIRTLWLVLDGIDQMWLPVHRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDIPPPPMEEEHDFYSVISKDRRYADLSEDQLPSCESLKDTIARALPFWNDEIVPQIKQGKRVLIAAHGNSLRGIVKHLEGMSEEAIMELNLPTGIPILYELDKNLKPIK 228          
BLAST of SMED30021467 vs. Ensembl Cavefish
Match: pgam2 (phosphoglycerate mutase 2 [Source:NCBI gene;Acc:103021706])

HSP 1 Score: 274.633 bits (701), Expect = 5.621e-92
Identity = 133/235 (56.60%), Postives = 167/235 (71.06%), Query Frame = -2
Query:  159 MPKVYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALE--------ITDKRWPGLETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR 839
            M   Y++V VRHGES +NQENRFCGW DADLSE+G  EA+   + +KD G  FD+ YTSVLKRAIKTL  I+   D  W+PV++ WRLNER YG L  LNK+ETAAKHGE+QV+IWRR++ I PP ++        I++ R      +YK L    +P  E LKDT+ RALPFW D IVP IK  KNVLIAAHGNSLR ++K L+ + D  I+ LN+PTGIP+VYELD++L PI+
Sbjct:    1 MAAAYRLVIVRHGESSWNQENRFCGWFDADLSEKGVEEAKRGAQAVKDAGLKFDVCYTSVLKRAIKTLWTIMEGTDQMWLPVIRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFDIPPPPMDKDHAYHKIISESR------RYKGLKEGELPTCESLKDTIARALPFWNDVIVPEIKAGKNVLIAAHGNSLRGIVKHLEGMTDAAIMELNLPTGIPIVYELDKDLKPIK 229          
BLAST of SMED30021467 vs. Ensembl Cavefish
Match: bpgm (bisphosphoglycerate mutase [Source:NCBI gene;Acc:103029505])

HSP 1 Score: 242.276 bits (617), Expect = 4.305e-79
Identity = 112/227 (49.34%), Postives = 160/227 (70.48%), Query Frame = -2
Query:  159 YKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGL--ETKYKHLDL--TGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR 827
            +K+  +RHGE  +N+ENRFC W D  LSE G  EA+E G++LK+ GY FD  +TS+L R+I+T   +L  +   W+PV K WRLNER YG+L  LN++E A KHGE+QV++WRR+YAI PP +E +   +  +  + +Y   D+    +PRTE LK+ ++R LP+W D IVP IK  + +LI+AHGNS RA++K L+ I D +IV + +PTGIP++ ELDENLHP++
Sbjct:    4 HKLFLLRHGEGAWNKENRFCSWVDQKLSENGVVEAQECGRLLKENGYKFDHVFTSILSRSIQTAWLVLEAMGQEWVPVTKSWRLNERHYGSLIGLNRAEMAQKHGEEQVKLWRRSYAITPPPIEESHPYFAEIYNDRRYTTCDVPKEKLPRTESLKEVLDRLLPYWNDVIVPEIKSGQTILISAHGNSCRALLKHLEGISDTDIVNVTLPTGIPVLLELDENLHPVK 230          
BLAST of SMED30021467 vs. Ensembl Cavefish
Match: pgam1b (phosphoglycerate mutase 1b [Source:ZFIN;Acc:ZDB-GENE-030131-5376])

HSP 1 Score: 177.948 bits (450), Expect = 3.236e-55
Identity = 83/151 (54.97%), Postives = 110/151 (72.85%), Query Frame = -2
Query:  159 WIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLT--GIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR 605
            W+PV + WRLNER YG L  LNK+ETAAKHGE+QV+IWRR+Y   PP +E     +  +    ++ DLT   +P  E LKDT+ RALPFW + IVP IKD K VLIAAHGNSLR ++K L+ + ++ I+ LN+PTGIP++YELD+NL P++
Sbjct:    2 WLPVHRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSYDTPPPPMESDHDFYSTISQDRRYTDLTEDQLPACESLKDTIARALPFWNEEIVPQIKDGKRVLIAAHGNSLRGIVKHLEGMSEEAIMELNLPTGIPILYELDKNLKPVK 152          
BLAST of SMED30021467 vs. Ensembl Sea Lamprey
Match: pgam1a (phosphoglycerate mutase 1a [Source:ZFIN;Acc:ZDB-GENE-030131-1827])

HSP 1 Score: 271.552 bits (693), Expect = 1.833e-91
Identity = 128/224 (57.14%), Postives = 164/224 (73.21%), Query Frame = -2
Query:  165 VYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGL--ETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHP 830
             YK+V VRHGES +N ENRFCGW DADL+++G  EA+     LKD G+ FD+ YTSVLKRAI+TL  +L+E+D  W+PVV+ WRLNER YG L  LNKSETAAKHGE QV+IWRR++ + PP +E     +  +  + +YK L    +P++E LKDT+ RALPFW D I P I+  K VLIAAHGNSLR ++K L+ + D +I+ LN+PTGIP+VYELD NL P
Sbjct:    3 TYKLVIVRHGESTWNNENRFCGWFDADLNDKGLMEAKRGAVALKDAGFKFDVCYTSVLKRAIRTLWIVLDEIDQMWLPVVRTWRLNERHYGGLIGLNKSETAAKHGEAQVKIWRRSFDVPPPPMESDHAYFKAIAQDRRYKDLKAEELPKSESLKDTIARALPFWNDHIAPQIRAGKRVLIAAHGNSLRGIVKHLEGMSDADIMELNLPTGIPIVYELDANLKP 226          
BLAST of SMED30021467 vs. Ensembl Sea Lamprey
Match: bpgm (2,3-bisphosphoglycerate mutase [Source:ZFIN;Acc:ZDB-GENE-040718-375])

HSP 1 Score: 214.157 bits (544), Expect = 8.005e-69
Identity = 105/224 (46.88%), Postives = 146/224 (65.18%), Query Frame = -2
Query:  162 VVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGL--ETKYKHLDL--TGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPI 821
            +V VRHGE  + +ENRFC W D  LS  G  EAR   ++L   G  FD A++S+L RAIKT   IL  +   W+P+   WRLNER YGAL  LN+++ A  HGE+QV+ WRRAY + PP ++     +  +  + +Y   D+    IPR E L+D +ER LP+W  SIVP ++  KNVL++AHGNS+RA+IK L+ I D +I+ L IPTG+P+V +LD+ L P+
Sbjct:    6 LVLVRHGEGSWTRENRFCSWVDQPLSADGEAEARRCSRLLAAAGIRFDAAFSSLLTRAIKTAWLILEGVGQAWVPLAHSWRLNERHYGALVGLNRAQLALNHGEEQVKAWRRAYDVRPPPIDEAHPYFDEIHGDRRYASCDVPRGKIPRGESLRDVLERLLPYWEGSIVPELRAGKNVLVSAHGNSVRAIIKHLEGISDADILHLTIPTGVPVVLQLDDELAPV 229          
BLAST of SMED30021467 vs. Ensembl Yeast
Match: GPM1 (Tetrameric phosphoglycerate mutase; mediates the conversion of 3-phosphoglycerate to 2-phosphoglycerate during glycolysis and the reverse reaction during gluconeogenesis [Source:SGD;Acc:S000001635])

HSP 1 Score: 213.772 bits (543), Expect = 4.926e-69
Identity = 108/227 (47.58%), Postives = 148/227 (65.20%), Query Frame = -2
Query:  147 KVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR-HYYL 824
            K+V VRHG+S +N++N F GW D  LS +G  EA  AG++LK+K    D+ YTS L RAI+T N  L + D  WIPV + WRLNER YG LQ  +K+ET  K GE++   +RR++ + PP ++ +       + +YK++D   +P TE L   ++R LP+W D I   +   K V+IAAHGNSLR ++K L+ I D +I  LNIPTGIPLV+ELDENL P +  YYL
Sbjct:    3 KLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRAIQTANIALEKADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPPPPIDASSPFSQKGDERYKYVDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAAHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPSKPSYYL 229          
BLAST of SMED30021467 vs. Ensembl Yeast
Match: GPM3 (Homolog of Gpm1p phosphoglycerate mutase; converts 3-phosphoglycerate to 2-phosphoglycerate in glycolysis; may be non-functional; GPM3 has a paralog, GPM2, that arose from the whole genome duplication [Source:SGD;Acc:S000005417])

HSP 1 Score: 131.339 bits (329), Expect = 1.617e-36
Identity = 87/277 (31.41%), Postives = 140/277 (50.54%), Query Frame = -2
Query:  147 VYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIA-----YTSVLKRAIKTLNNILNELDLH-----------------------WIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEIT----------------DKRWPGLETKYKHLDLTG--IPRTECLKDTVERALPFWFDSIVPSIK--DNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELD-ENLHPIRHYYL 830
             +K+  +RHG+S  N EN FCGW DA L+E+G ++AR + K++K    + +I+     YTS L R  +T++ IL EL L                         +PV++ WRLNER YGA Q   K +   ++G+++    RR Y   PP + +                 D + P    KY   +     +P +E L + V R  PF  + ++ +      ++ +I  HG+S+R+++K L+ I D++I  ++IP GIPLV ELD +N   +R +YL
Sbjct:    6 TFKLFILRHGQSELNSENIFCGWIDAQLTEKGKSQARHSAKLIKQFCDSNNISLPQIGYTSRLIRTQQTMDVILEELGLKHTNYVITTNTNIKEELQDTRFEGSMPVLQTWRLNERHYGAWQGQRKPDILKEYGKEKYMYIRRDYNGKPPKVNLNLEMVQEENDQGSSTGYDFKEPNRHLKYGPEEKANERLPESESLCEVVVRLKPFLNNVVLSTANKISQESCVIVGHGSSVRSLLKVLEGISDEDIKDVDIPNGIPLVIELDRDNYSFVRKFYL 282          
BLAST of SMED30021467 vs. Ensembl Yeast
Match: GPM2 (Homolog of Gpm1p phosphoglycerate mutase; converts 3-phosphoglycerate to 2-phosphoglycerate in glycolysis; may be non-functional; GPM2 has a paralog, GPM3, that arose from the whole genome duplication [Source:SGD;Acc:S000002179])

HSP 1 Score: 126.716 bits (317), Expect = 8.759e-35
Identity = 87/283 (30.74%), Postives = 138/283 (48.76%), Query Frame = -2
Query:  147 VYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFD-----IAYTSVLKRAIKTLNNILNELDLH--------------------------WIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDK----------------RWPGLETKYKHLDLTG----IPRTECLKDTVERALPFWFDSIV--PSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDEN--LHPIRHYYL 830
            V  +  +RHG+S  N EN FCGW DA L+E+G  +AR + ++++      +     I YTS L R  +T+  +  E  L                            IP+++ WRLNER YG+ Q   K     ++G+ +    RR Y   PP +++  +                + P  + KY+ L+ +     +P +E L++ V R  PF  + I+   +  D  + LI  HG+S+R+++K L+ I DD+I  ++IP GIPLV ELD+N  L  IR +YL
Sbjct:    9 VMTLFLLRHGQSELNHENIFCGWIDAKLTEKGKEQARHSAELIEQYCKANNLRLPQIGYTSRLIRTQQTIETMCEEFKLKPQLQVVYDFNKIKLGDEFGSDDKDNMKIPILQTWRLNERHYGSWQGQRKPNVLKEYGKDKYMFIRRDYEGKPPPVDLDREMIQQENEKGSSTGYEFKEPNRQIKYE-LECSNHDIVLPDSESLREVVYRLNPFLQNVILKLANQYDESSCLIVGHGSSVRSLLKILEGISDDDIKNVDIPNGIPLVVELDKNNGLKFIRKFYL 290          
BLAST of SMED30021467 vs. Ensembl Yeast
Match: FBP26 (Fructose-2,6-bisphosphatase, required for glucose metabolism; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003691])

HSP 1 Score: 49.6766 bits (117), Expect = 2.458e-7
Identity = 54/218 (24.77%), Postives = 92/218 (42.20%), Query Frame = -2
Query:  210 YIFVKMPKVYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIA-YTSVLKRAIKTLNNILNELDLHWIPVVK-HWR-LNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIP 854
            Y+    PK   +   RHGES+YN E +  G  D+ LSE+GF  A++  +++K+     ++  +TS LKR  +T N         ++P  K  W+ L+E   G    +   E   ++               P   +  D        KY++    G    E  +D V R  P     ++  ++  +NVLI  H   LR +  +   +  +E   ++IP
Sbjct:  216 YVMNIRPKPKYIWLSRHGESIYNVEKKIGG--DSSLSERGFQYAKKLEQLVKESAGEINLTVWTSTLKRTQQTAN---------YLPYKKLQWKALDELDAGVCDGMTYEEIEKEY---------------PEDFKARDN------DKYEYRYRGG----ESYRDVVIRLEP-----VIMELERQENVLIITHQAVLRCIYAYFMNVPQEESPWMSIP 392          
BLAST of SMED30021467 vs. Ensembl Nematostella
Match: EDO42671 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S100])

HSP 1 Score: 49.6766 bits (117), Expect = 7.152e-7
Identity = 33/96 (34.38%), Postives = 57/96 (59.38%), Query Frame = -2
Query:  531 VRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLH--WIPVVKHWRLNERMYGALQDLNKSE 812
            VRHGE++ N+ N + G  D  LS++G  +A+   K L+D+   F+  ++S L+RA KT   IL E++ +   + V +  R+ E+ YG ++   K+E
Sbjct:   27 VRHGETMENRLNIYQGHSDTVLSDKGIQQAKLVAKRLQDE--KFNYIFSSDLQRAYKTAEYIL-EVNKYKDGLAVTRDPRIKEKGYGIMEGKTKAE 119          
BLAST of SMED30021467 vs. Ensembl Medaka
Match: pgam2 (phosphoglycerate mutase 2 [Source:NCBI gene;Acc:101164987])

HSP 1 Score: 270.396 bits (690), Expect = 2.884e-90
Identity = 128/235 (54.47%), Postives = 166/235 (70.64%), Query Frame = -2
Query:  159 MPKVYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALE--------ITDKRWPGLETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR 839
            M  V+++V VRHGES +NQENRFCGW DADLSE+G  EA+   + +K+ G+ FD+ YTSVLKRAIKTL  I+   D  W+PV++ WRLNER YG L  LNK+ETA KHGE+QV+IWRR++ I PP ++        I++ R      +YK L    +P  E LKDT+ RALPFW D I P IK  KNV+IAAHGNSLR ++K L+ + D  I+ LN+PTGIP+VYELD +L P++
Sbjct:    1 MTAVHRLVIVRHGESAWNQENRFCGWFDADLSEKGMEEAKRGAQAIKEAGFKFDVCYTSVLKRAIKTLWTIMEGTDQMWLPVIRTWRLNERHYGGLTGLNKAETAEKHGEEQVKIWRRSFDIPPPPMDKDHSYHKIISESR------RYKDLKPGELPTCESLKDTIARALPFWNDVIAPQIKAGKNVIIAAHGNSLRGIVKHLEGMSDAAIMELNLPTGIPIVYELDADLKPVK 229          
BLAST of SMED30021467 vs. Ensembl Medaka
Match: PGAM1 (phosphoglycerate mutase 1 [Source:NCBI gene;Acc:101162235])

HSP 1 Score: 269.626 bits (688), Expect = 5.853e-90
Identity = 127/226 (56.19%), Postives = 163/226 (72.12%), Query Frame = -2
Query:  159 VYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLT--GIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR 830
             YK+V +RHGES +NQENRFCGW DADLSE G  EA+  G+ LKD GY FD+ YTSVLKRAI+TL  +L+ +D  W+PV + WRLNER YG L  LNK+ETAAKHGE QV+IWRR++   PP +      +  +    ++ DLT   +P  E LKDT+ RALPFW + I P IK  K VLIAAHGNSLR ++K L+ + D+ I+ LN+PTGIP++YELD+NL P++
Sbjct:    3 AYKLVLIRHGESNWNQENRFCGWFDADLSETGEREAKRGGQALKDAGYEFDVCYTSVLKRAIRTLWLVLDSIDQMWVPVHRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSFDTPPPPMGPDHDYYSVISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIAPEIKQGKRVLIAAHGNSLRGIVKHLEGMSDEAIMELNLPTGIPILYELDKNLKPVK 228          
BLAST of SMED30021467 vs. Ensembl Medaka
Match: pgam2 (phosphoglycerate mutase 2 [Source:NCBI gene;Acc:101164987])

HSP 1 Score: 268.085 bits (684), Expect = 1.096e-89
Identity = 128/235 (54.47%), Postives = 165/235 (70.21%), Query Frame = -2
Query:  159 MPKVYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALE--------ITDKRWPGLETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIR 839
            M  V+++V VRHGES +NQENRFCGW DADLSE+G  EA+   + +K+ G+ FD+ YTSVLKRAIKTL  I+   D  W+PV++ WRLNER YG L  LNK+ETA KHGE+QV+IWRR++ I PP ++        I++ R      +YK L    +P  E LKDT+ RALPFW D I P IK  KNV+IAAHGNSLR ++K L+ + D  I+ LN+PTGIP+VYELD +L P +
Sbjct:    1 MTAVHRLVIVRHGESAWNQENRFCGWFDADLSEKGMEEAKRGAQAIKEAGFKFDVCYTSVLKRAIKTLWTIMEGTDQMWLPVIRTWRLNERHYGGLTGLNKAETAEKHGEEQVKIWRRSFDIPPPPMDKDHSYHKIISESR------RYKDLKPGELPTCESLKDTIARALPFWNDVIAPQIKAGKNVIIAAHGNSLRGIVKHLEGMSDAAIMELNLPTGIPIVYELDADLKPAK 229          
BLAST of SMED30021467 vs. Ensembl Medaka
Match: bpgm (bisphosphoglycerate mutase [Source:NCBI gene;Acc:101172407])

HSP 1 Score: 223.016 bits (567), Expect = 1.318e-71
Identity = 101/222 (45.50%), Postives = 154/222 (69.37%), Query Frame = -2
Query:  174 YKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGL--ETKYKHLDLTG--IPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDEN 827
            + ++ +RHGE  +N+ENRFC W D  LSE G  EAR+ G++LK++GY FD+ +TS+L R+I T   +L  +   W+PVVK WRLNER YGAL  LN++E A KHGE++V++WRR+Y + PP ++ +   +  +  + +Y   D+    +P++E LKD + R LP+W  +I P I+  K VLI+AHGNS RA++K L+ I +++I  + +PTG+P++ ELDEN
Sbjct:    4 FSLLLLRHGEGAWNKENRFCSWVDQKLSEDGVKEARDCGRLLKEQGYQFDMVFTSLLSRSIHTAWLVLEAMGQEWVPVVKSWRLNERHYGALIGLNRAEMAQKHGEEKVKLWRRSYDLTPPPIDESHPYFLEIYSDRRYSTCDVPNDKLPKSESLKDVLGRLLPYWNGTIAPEIRKGKTVLISAHGNSCRALLKHLEGISNEDIAKVTLPTGVPVLLELDEN 225          
BLAST of SMED30021467 vs. Ensembl Medaka
Match: tigarb (fructose-2,6-bisphosphatase TIGAR B [Source:NCBI gene;Acc:101175449])

HSP 1 Score: 47.3654 bits (111), Expect = 8.053e-6
Identity = 33/107 (30.84%), Postives = 54/107 (50.47%), Query Frame = -2
Query:  531 VYKVVFVRHGESVYNQENRFCGWH-DADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILN------ELDLHWIPVVKHWRLNERMYGALQDLNKSE 830
             + +  +RHGE+ YN++    G   D  LSE G  +A  AG+ LKD  Y+    + S L+RA++T   IL       +++L   P+     L ER +G  +  +K +
Sbjct:    3 TFSLTLIRHGETQYNRDKLLQGQGVDTPLSETGVLQAEAAGQYLKDMAYS--KVFVSNLQRAVQTAEIILRSSTQCPDMELTLEPL-----LRERGFGVAEGRHKED 102          
BLAST of SMED30021467 vs. Planmine SMEST
Match: SMESG000013722.1 (SMESG000013722.1)

HSP 1 Score: 484.567 bits (1246), Expect = 4.700e-175
Identity = 231/231 (100.00%), Postives = 231/231 (100.00%), Query Frame = -2
Query:  147 MPKVYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIRHYYL 839
            MPKVYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIRHYYL
Sbjct:    1 MPKVYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKGYTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLNKSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLTGIPRTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIGDDEIVGLNIPTGIPLVYELDENLHPIRHYYL 231          
The following BLAST results are available for this feature:
BLAST of SMED30021467 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PGAM23.323e-8755.90phosphoglycerate mutase 2 [Source:HGNC Symbol;Acc:... [more]
PGAM15.252e-8756.19phosphoglycerate mutase 1 [Source:HGNC Symbol;Acc:... [more]
PGAM42.309e-8153.98phosphoglycerate mutase family member 4 [Source:HG... [more]
BPGM1.598e-7246.90bisphosphoglycerate mutase [Source:HGNC Symbol;Acc... [more]
BPGM1.598e-7246.90bisphosphoglycerate mutase [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of SMED30021467 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021467 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pglym787.706e-7852.84gene:FBgn0014869 transcript:FBtr0100483[more]
Pglym787.706e-7852.84gene:FBgn0014869 transcript:FBtr0100482[more]
Pglym787.706e-7852.84gene:FBgn0014869 transcript:FBtr0085384[more]
Pglym879.572e-7853.78gene:FBgn0011270 transcript:FBtr0082620[more]
CG70592.322e-4436.77gene:FBgn0038957 transcript:FBtr0084221[more]
back to top
BLAST of SMED30021467 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pgam1a5.962e-9357.96phosphoglycerate mutase 1a [Source:ZFIN;Acc:ZDB-GE... [more]
pgam1b4.626e-9257.52phosphoglycerate mutase 1b [Source:ZFIN;Acc:ZDB-GE... [more]
pgam28.400e-9156.90phosphoglycerate mutase 2 (muscle) [Source:ZFIN;Ac... [more]
bpgm1.715e-7346.702,3-bisphosphoglycerate mutase [Source:ZFIN;Acc:ZD... [more]
bpgm1.715e-7346.702,3-bisphosphoglycerate mutase [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of SMED30021467 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tdrd64.004e-9357.08tudor domain containing 6 [Source:Xenbase;Acc:XB-G... [more]
pgam21.602e-8756.96phosphoglycerate mutase 2 [Source:NCBI gene;Acc:44... [more]
pabpn1l6.035e-7848.71poly(A) binding protein, nuclear 1-like (cytoplasm... [more]
back to top
BLAST of SMED30021467 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pgam14.065e-8756.19phosphoglycerate mutase 1 [Source:MGI Symbol;Acc:M... [more]
Pgam22.587e-8654.42phosphoglycerate mutase 2 [Source:MGI Symbol;Acc:M... [more]
Bpgm2.679e-7046.022,3-bisphosphoglycerate mutase [Source:MGI Symbol;... [more]
Bpgm1.975e-4445.402,3-bisphosphoglycerate mutase [Source:MGI Symbol;... [more]
Bpgm4.862e-4049.192,3-bisphosphoglycerate mutase [Source:MGI Symbol;... [more]
back to top
BLAST of SMED30021467 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q54NE6|PGAM_DICDI1.785e-11367.54Probable phosphoglycerate mutase OS=Dictyostelium ... [more]
sp|B3QVL0|GPMA_CHLT31.063e-10765.042,3-bisphosphoglycerate-dependent phosphoglycerate... [more]
sp|Q3AU60|GPMA_CHLCH1.395e-10662.832,3-bisphosphoglycerate-dependent phosphoglycerate... [more]
sp|B1GZZ1|GPMA_UNCTG1.818e-10664.912,3-bisphosphoglycerate-dependent phosphoglycerate... [more]
sp|Q8KFC8|GPMA_CHLTE2.330e-10663.272,3-bisphosphoglycerate-dependent phosphoglycerate... [more]
back to top
BLAST of SMED30021467 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W6UW683.363e-13075.76PGAM OS=Echinococcus granulosus OX=6210 GN=EGR_001... [more]
A0A0R3W3E95.564e-13077.49Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A068WB026.916e-13075.76Phosphoglycerate mutase OS=Echinococcus granulosus... [more]
A0A068YDW92.541e-12975.32Phosphoglycerate mutase OS=Echinococcus multilocul... [more]
A0A0R3SQN81.192e-12876.62Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of SMED30021467 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pgam1a3.222e-9257.96phosphoglycerate mutase 1 [Source:NCBI gene;Acc:10... [more]
pgam25.621e-9256.60phosphoglycerate mutase 2 [Source:NCBI gene;Acc:10... [more]
bpgm4.305e-7949.34bisphosphoglycerate mutase [Source:NCBI gene;Acc:1... [more]
pgam1b3.236e-5554.97phosphoglycerate mutase 1b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of SMED30021467 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pgam1a1.833e-9157.14phosphoglycerate mutase 1a [Source:ZFIN;Acc:ZDB-GE... [more]
bpgm8.005e-6946.882,3-bisphosphoglycerate mutase [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of SMED30021467 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
GPM14.926e-6947.58Tetrameric phosphoglycerate mutase; mediates the c... [more]
GPM31.617e-3631.41Homolog of Gpm1p phosphoglycerate mutase; converts... [more]
GPM28.759e-3530.74Homolog of Gpm1p phosphoglycerate mutase; converts... [more]
FBP262.458e-724.77Fructose-2,6-bisphosphatase, required for glucose ... [more]
back to top
BLAST of SMED30021467 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO426717.152e-734.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30021467 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pgam22.884e-9054.47phosphoglycerate mutase 2 [Source:NCBI gene;Acc:10... [more]
PGAM15.853e-9056.19phosphoglycerate mutase 1 [Source:NCBI gene;Acc:10... [more]
pgam21.096e-8954.47phosphoglycerate mutase 2 [Source:NCBI gene;Acc:10... [more]
bpgm1.318e-7145.50bisphosphoglycerate mutase [Source:NCBI gene;Acc:1... [more]
tigarb8.053e-630.84fructose-2,6-bisphosphatase TIGAR B [Source:NCBI g... [more]
back to top
BLAST of SMED30021467 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000013722.14.700e-175100.00SMESG000013722.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021467 ID=SMED30021467|Name=SMED30021467|organism=Schmidtea mediterranea sexual|type=transcript|length=939bp
GCAAGACGGGAAAAATTATATTTGAAATTCTATTCAAAACTATTCAAAAC
AAGTTCAATAATATGTTTTTCAGGTTGAAACTTTTATTTAGCTTTTCCTT
GATTGGCTACTCGCGCCACCGCAGCTGCTACATCAGCTTCACTAGCCAAA
TAATAATGTCGGATCGGATGTAAATTCTCATCAAGTTCATAAACTAATGG
AATACCAGTTGGGATGTTTAATCCGACTATTTCATCGTCCCCTATTTTAT
CCAAAAATTTAATAACAGCTCGTAAACTATTTCCGTGAGCAGCAATCAAT
ACGTTTTTATTGTCCTTTATACTCGGTACGATACTGTCAAACCAAAAAGG
TAAAGCTCTTTCAACTGTATCTTTAAGACATTCCGTTCGAGGAATTCCAG
TAAGATCAAGATGTTTATATTTTGTTTCTAATCCAGGCCATCGTTTATCA
GTTATTTCCAAAGCAGGAGGGGCAATAGCATATGCTCTTCGCCATATCTG
AACTTGCTGTTCGCCGTGTTTAGCAGCAGTTTCCGATTTATTAAGATCTT
GTAAAGCTCCATACATTCTTTCATTCAATCGCCAGTGTTTTACAACTGGA
ATCCAATGGAGATCCAATTCATTTAAAATATTATTAAGCGTTTTTATTGC
TCGTTTCAAAACACTTGTATAAGCAATATCAAAAGTGTATCCTTTATCTT
TTAACATTTTCCCAGCTTCTCTAGCTTCATTAAATCCTTGTTCAGAGAGA
TCAGCGTCATGCCATCCACAAAATCTATTTTCCTGATTGTAAACACTTTC
ACCGTGTCTAACAAATACGACTTTGTAAACTTTGGGCATCTTGACAAAAA
TATATCTAAAATATAAGTTAATATATTTTATGTAGAAAAACAAATATAAA
TAAAATACGAAATACTAAATGTCGACAACTGATACGGTC
back to top

protein sequence of SMED30021467-orf-1

>SMED30021467-orf-1 ID=SMED30021467-orf-1|Name=SMED30021467-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=252bp
MPKVYKVVFVRHGESVYNQENRFCGWHDADLSEQGFNEAREAGKMLKDKG
YTFDIAYTSVLKRAIKTLNNILNELDLHWIPVVKHWRLNERMYGALQDLN
KSETAAKHGEQQVQIWRRAYAIAPPALEITDKRWPGLETKYKHLDLTGIP
RTECLKDTVERALPFWFDSIVPSIKDNKNVLIAAHGNSLRAVIKFLDKIG
DDEIVGLNIPTGIPLVYELDENLHPIRHYYLASEADVAAAVARVANQGKA
K*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR005952Phosphogly_mut1
IPR013078His_Pase_superF_clade-1
IPR029033His_PPase_superfam
Vocabulary: molecular function
TermDefinition
GO:0004619phosphoglycerate mutase activity
GO:0016868intramolecular transferase activity, phosphotransferases
Vocabulary: biological process
TermDefinition
GO:0006096glycolytic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013078Histidine phosphatase superfamily, clade-1SMARTSM00855PGAM_5coord: 6..192
e-value: 1.5E-23
score: 94.2
IPR013078Histidine phosphatase superfamily, clade-1PFAMPF00300His_Phos_1coord: 7..128
e-value: 1.1E-26
score: 93.8
IPR013078Histidine phosphatase superfamily, clade-1CDDcd07067HP_PGM_likecoord: 6..231
e-value: 1.00047E-48
score: 155.943
IPR005952Phosphoglycerate mutase 1TIGRFAMTIGR01258TIGR01258coord: 6..249
e-value: 6.0E-111
score: 367.6
IPR005952Phosphoglycerate mutase 1PANTHERPTHR11931PHOSPHOGLYCERATE MUTASEcoord: 4..251
NoneNo IPR availablePIRSFPIRSF0007096PFK_fruc_bisph_Ptasecoord: 3..112
e-value: 1.2E-7
score: 28.2
coord: 149..245
e-value: 0.37
score: 6.8
NoneNo IPR availablePANTHERPTHR11931:SF202,3-BISPHOSPHOGLYCERATE-DEPENDENT PHOSPHOGLYCERATE MUTASEcoord: 4..251
IPR029033Histidine phosphatase superfamilyGENE3DG3DSA:3.40.50.1240coord: 4..251
e-value: 6.6E-83
score: 279.8
IPR029033Histidine phosphatase superfamilySUPERFAMILYSSF53254Phosphoglycerate mutase-likecoord: 5..235