Pogo transposable element with krab domain

Overview
NamePogo transposable element with krab domain
Smed IDSMED30021436
Length (bp)2043
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pogo transposable element with krab domain (SMED30021436) t-SNE clustered cells

Violin plots show distribution of expression levels for Pogo transposable element with krab domain (SMED30021436) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pogo transposable element with krab domain (SMED30021436) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pogo transposable element with krab domain (SMED30021436) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Pogo transposable element with krab domain vs. Ensembl Human
Match: POGK (pogo transposable element derived with KRAB domain [Source:HGNC Symbol;Acc:HGNC:18800])

HSP 1 Score: 176.022 bits (445), Expect = 1.696e-46
Identity = 116/410 (28.29%), Postives = 208/410 (50.73%), Query Frame = 3
Query:  258 QKQKKQRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGG-NARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKI--EGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIADLKK--DLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIF-GTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKK-ESKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYESIKHTKFGNMKAADWNTIFEWIVSSWEDVNLSTILNGFRVA-----FGEDDDVL-EIE 1445
            Q  +  RRS+ +  K  +++ A    N  + A+++ + E  +R W   +  ++  +  RR+ RG  N R+  ++ ++ E++   + +   ++   ++L+A  IA+EM I  +GF AS  W    M+R ++ +R +    Q LP+D   ++  ++  +  L++  D    Q+GN DE P+  ++P   TV+ +G   V +KT G EK + T  L VL DG KLPP++I  GT   P  F   S + I  +  GWM  + ++ WL+ VW+ R            PK   +L+ +  R H   +  N ++   + +  IP GLTS++Q LD+ V +     +R ++ +W++    ++  T  GN K        EW++ +W  ++  +I+ GF+         E+DDVL EIE
Sbjct:  191 QFSRGMRRSYDAGFKLMVVEYAESTNNC-QAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLPEDLTEKLVTYQRSVLALRRAHDYEVAQMGNADETPICLEVPSRVTVDNQGEKPVLVKTPGREKLKITAMLGVLADGRKLPPYIILRGTYIPPGKF--PSGMEIRCHRYGWMTEDLMQDWLEVVWRRRT--------GAVPKQRGMLILNGFRGHATDSVKNSMESMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPT--GNAKKPPLGLFLEWVMVAWNSISSESIVQGFKKCHISSNLEEEDDVLWEIE 587          
BLAST of Pogo transposable element with krab domain vs. Ensembl Human
Match: POGK (pogo transposable element derived with KRAB domain [Source:HGNC Symbol;Acc:HGNC:18800])

HSP 1 Score: 176.022 bits (445), Expect = 1.696e-46
Identity = 116/410 (28.29%), Postives = 208/410 (50.73%), Query Frame = 3
Query:  258 QKQKKQRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGG-NARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKI--EGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIADLKK--DLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIF-GTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKK-ESKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYESIKHTKFGNMKAADWNTIFEWIVSSWEDVNLSTILNGFRVA-----FGEDDDVL-EIE 1445
            Q  +  RRS+ +  K  +++ A    N  + A+++ + E  +R W   +  ++  +  RR+ RG  N R+  ++ ++ E++   + +   ++   ++L+A  IA+EM I  +GF AS  W    M+R ++ +R +    Q LP+D   ++  ++  +  L++  D    Q+GN DE P+  ++P   TV+ +G   V +KT G EK + T  L VL DG KLPP++I  GT   P  F   S + I  +  GWM  + ++ WL+ VW+ R            PK   +L+ +  R H   +  N ++   + +  IP GLTS++Q LD+ V +     +R ++ +W++    ++  T  GN K        EW++ +W  ++  +I+ GF+         E+DDVL EIE
Sbjct:  191 QFSRGMRRSYDAGFKLMVVEYAESTNNC-QAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLPEDLTEKLVTYQRSVLALRRAHDYEVAQMGNADETPICLEVPSRVTVDNQGEKPVLVKTPGREKLKITAMLGVLADGRKLPPYIILRGTYIPPGKF--PSGMEIRCHRYGWMTEDLMQDWLEVVWRRRT--------GAVPKQRGMLILNGFRGHATDSVKNSMESMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPT--GNAKKPPLGLFLEWVMVAWNSISSESIVQGFKKCHISSNLEEEDDVLWEIE 587          
BLAST of Pogo transposable element with krab domain vs. Ensembl Human
Match: POGZ (pogo transposable element derived with ZNF domain [Source:HGNC Symbol;Acc:HGNC:18801])

HSP 1 Score: 105.145 bits (261), Expect = 1.544e-22
Identity = 80/271 (29.52%), Postives = 130/271 (47.97%), Query Frame = 3
Query:  468 ELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIADL--KKDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKKESKV-SFIPAGLTSKVQPLDLTVNRSFKSKLRKKWED 1268
            E E KL EW+L QRE++L V+   +  +A  I + ++  GF  S  W   FM R ++    R      LPKD       F   +      +DLP + I   DE+ +  D      + +    E  ++T G  +    V L +L DGT LP  V +  +      +P+S +++ A  +G+ + E +E+W   VW+            Q  K   +L+ D HR+HL    L  +   S + + +PAG +SK+QPLD+ + R+ K+ L KKW++
Sbjct:  964 EAEEKLAEWVLTQREQQLPVNEETLFQKATKIGRSLE-GGFKISYEWAVRFMLRHHLTPHARRAVAHTLPKDVAENAGLFIDFVQRQIHNQDLPLSMIVAIDEISLFLDT---EVLSSDDRKENALQTVGTGEPWCDVVLAILADGTVLPTLVFYRGQMDQPANMPDS-ILLEAKESGYSDDEIMELWSTRVWQKHTAC-------QRSK--GMLVMDCHRTHLSEEVLAMLSASSTLPAVVPAGCSSKIQPLDVCIKRTVKNFLHKKWKE 1220          
BLAST of Pogo transposable element with krab domain vs. Ensembl Human
Match: POGZ (pogo transposable element derived with ZNF domain [Source:HGNC Symbol;Acc:HGNC:18801])

HSP 1 Score: 105.145 bits (261), Expect = 1.758e-22
Identity = 80/271 (29.52%), Postives = 130/271 (47.97%), Query Frame = 3
Query:  468 ELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIADL--KKDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKKESKV-SFIPAGLTSKVQPLDLTVNRSFKSKLRKKWED 1268
            E E KL EW+L QRE++L V+   +  +A  I + ++  GF  S  W   FM R ++    R      LPKD       F   +      +DLP + I   DE+ +  D      + +    E  ++T G  +    V L +L DGT LP  V +  +      +P+S +++ A  +G+ + E +E+W   VW+            Q  K   +L+ D HR+HL    L  +   S + + +PAG +SK+QPLD+ + R+ K+ L KKW++
Sbjct: 1017 EAEEKLAEWVLTQREQQLPVNEETLFQKATKIGRSLE-GGFKISYEWAVRFMLRHHLTPHARRAVAHTLPKDVAENAGLFIDFVQRQIHNQDLPLSMIVAIDEISLFLDT---EVLSSDDRKENALQTVGTGEPWCDVVLAILADGTVLPTLVFYRGQMDQPANMPDS-ILLEAKESGYSDDEIMELWSTRVWQKHTAC-------QRSK--GMLVMDCHRTHLSEEVLAMLSASSTLPAVVPAGCSSKIQPLDVCIKRTVKNFLHKKWKE 1273          
BLAST of Pogo transposable element with krab domain vs. Ensembl Human
Match: POGZ (pogo transposable element derived with ZNF domain [Source:HGNC Symbol;Acc:HGNC:18801])

HSP 1 Score: 104.76 bits (260), Expect = 1.847e-22
Identity = 80/271 (29.52%), Postives = 130/271 (47.97%), Query Frame = 3
Query:  468 ELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIADL--KKDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKKESKV-SFIPAGLTSKVQPLDLTVNRSFKSKLRKKWED 1268
            E E KL EW+L QRE++L V+   +  +A  I + ++  GF  S  W   FM R ++    R      LPKD       F   +      +DLP + I   DE+ +  D      + +    E  ++T G  +    V L +L DGT LP  V +  +      +P+S +++ A  +G+ + E +E+W   VW+            Q  K   +L+ D HR+HL    L  +   S + + +PAG +SK+QPLD+ + R+ K+ L KKW++
Sbjct:  931 EAEEKLAEWVLTQREQQLPVNEETLFQKATKIGRSLE-GGFKISYEWAVRFMLRHHLTPHARRAVAHTLPKDVAENAGLFIDFVQRQIHNQDLPLSMIVAIDEISLFLDT---EVLSSDDRKENALQTVGTGEPWCDVVLAILADGTVLPTLVFYRGQMDQPANMPDS-ILLEAKESGYSDDEIMELWSTRVWQKHTAC-------QRSK--GMLVMDCHRTHLSEEVLAMLSASSTLPAVVPAGCSSKIQPLDVCIKRTVKNFLHKKWKE 1187          
BLAST of Pogo transposable element with krab domain vs. Ensembl Celegans
Match: Y48G1C.6 (pep chromosome:WBcel235:I:84991:86293:-1 gene:WBGene00021679.1 transcript:Y48G1C.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y48G1C.6)

HSP 1 Score: 51.9878 bits (123), Expect = 3.374e-7
Identity = 40/139 (28.78%), Postives = 71/139 (51.08%), Query Frame = 3
Query:  267 KKQRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVI-KAMNPNRRS----LRGGN--ARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVRRTTTK 662
            K ++R++    K   I  A +  NI + A+  ++N   I++WIAQ++ I K +  N  +    L GG    +Y +++ +L +W+  QR+ + +V+    R+  +   K  +   F AS  W D FM R N+  RR  T+
Sbjct:   11 KTRKRTYDLKFKLHAINYALEHKNISKAAKDLNVNRQNIQQWIAQKAEIEKQLEDNGSTATKRLSGGGRPLKYDDVDKELIKWVHDQRKEKQRVTR---RIIGETAKKISQNSDFKASRGWLDKFMCRHNLSTRRARTE 146          
BLAST of Pogo transposable element with krab domain vs. Ensembl Zebrafish
Match: CR352209.1 (pep chromosome:GRCz11:24:26088143:26089609:1 gene:ENSDARG00000103972.2 transcript:ENSDART00000171129.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR352209.1)

HSP 1 Score: 275.018 bits (702), Expect = 1.791e-85
Identity = 155/384 (40.36%), Postives = 228/384 (59.38%), Query Frame = 3
Query:  273 QRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIAD--LKKDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKK-ESKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYESIKHTKFGNMKAADWNTIFEWIVSSWEDVNLSTILNGFRVA 1412
            +R ++ +  K + I  A   GN R  A+++ INE+++R+W  QE+ ++ +   ++S RG  AR+P+LE +L +WI+ QR     VS V IRL+A  IA++M IE F     W   FMKR+++ +R RTT  QQLP D++ ++  FR+  ++    K +    I N DEVP+  D+P  +TVE KGA+ V I+TTGHEK  FTV L    DG KLPP VIF  K  P+   P + ++I AN  GWM+ E +  WL+ V+  R       P       PSLL+ D  R+HL++T  N++K+  S+++ IP GLT ++QPLD+ VNR+FK KLR  WE W+     +   TK G  + A + TI EWIV +W  V+  T++  F  A
Sbjct:    5 KRHAYEAQFKLQAISYAVVNGN-RAAAKQFQINESMVRKWRKQENELRQVKKTKQSFRGNKARWPQLEDQLEQWIIEQRTAGRSVSTVTIRLRATKIAQDMGIEHFQGGPSWCFRFMKRRHLSIRARTTVAQQLPADYKEKLDIFRTYCSNKITDKKIQPKHITNMDEVPLTFDIPVNHTVEKKGASTVSIRTTGHEKSAFTVVLGCHGDGQKLPPMVIFKRKTLPKEKFP-AGIIIKANQKGWMDEEKMNEWLREVYVKR-------PDGFFHTSPSLLICDSMRAHLIATVKNQVKQMNSELAVIPGGLTKELQPLDIGVNRAFKVKLRAAWEQWMTDGEHTF--TKTGRQRRASYATICEWIVDAWAKVSALTVVRAFAKA 377          
BLAST of Pogo transposable element with krab domain vs. Ensembl Zebrafish
Match: BX914205.2 (pep chromosome:GRCz11:4:64121772:64123545:-1 gene:ENSDARG00000099590.2 transcript:ENSDART00000170040.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX914205.2)

HSP 1 Score: 273.478 bits (698), Expect = 7.671e-85
Identity = 155/384 (40.36%), Postives = 227/384 (59.11%), Query Frame = 3
Query:  273 QRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIAD--LKKDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKK-ESKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYESIKHTKFGNMKAADWNTIFEWIVSSWEDVNLSTILNGFRVA 1412
            +R ++ +  K + I  A   GN R  A+++ INE+++R+W  QE+ ++ +   ++S RG  AR+P+LE +L +WI+ QR     VS V IRL+A  IA++M IE F     W   FMKR+++ +R RTT  QQLP D++ ++  FR+  ++    K +    I N DEVP+  D+P  +TVE KGA+ V I+TTGHEK  FTV L    DG KLPP VIF  K  P+   P + ++I AN  GWM+ E +  WL+ V+  R       P       PSLL+ D  R+HL +T  N++K+  S+++ IP GLT ++QPLD+ VNR+FK KLR  WE W+     +   TK G  + A + TI EWIV +W  V+  T++  F  A
Sbjct:    5 KRHAYEAQFKLQAISYAVVNGN-RAAAKQFQINESMVRKWRKQENELRQVKKTKQSFRGNKARWPQLEDQLEQWIIEQRTAGRSVSTVTIRLRATKIAQDMGIEHFQGGPSWCFRFMKRRHLSIRARTTVAQQLPADYKEKLDIFRTYCSNKITDKKIQPKHITNMDEVPLTFDIPVNHTVEKKGASTVSIRTTGHEKSAFTVVLGCHGDGQKLPPMVIFKRKTLPKEKFP-AGVIIKANQKGWMDEEKMNEWLREVYVKR-------PDGFFHTSPSLLICDSMRAHLTATVKNQVKQMNSELAVIPGGLTKELQPLDIGVNRAFKVKLRAAWEQWMTDGEHTF--TKTGRQRRASYATICEWIVDAWAKVSALTVVRAFAKA 377          
BLAST of Pogo transposable element with krab domain vs. Ensembl Zebrafish
Match: CR354398.1 (pep chromosome:GRCz11:7:64150332:64152087:-1 gene:ENSDARG00000101994.2 transcript:ENSDART00000165234.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR354398.1)

HSP 1 Score: 273.863 bits (699), Expect = 1.299e-84
Identity = 155/384 (40.36%), Postives = 227/384 (59.11%), Query Frame = 3
Query:  273 QRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIAD--LKKDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKK-ESKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYESIKHTKFGNMKAADWNTIFEWIVSSWEDVNLSTILNGFRVA 1412
            +R ++ +  K + I  A   GN R  A+++ INE+++R+W  QE+ ++ +   ++S RG  AR+P+LE +L +WI+ QR     VS V IRL+A  IA++M IE F     W   FMKR+++ +R RTT  QQLP D++ ++  FR+  ++    K +    I N DEVP+  D+P  +TVE KGA+ V I+TTGHEK  FTV L    DG KLPP VIF  K  P+   P + ++I AN  GWM+ E +  WL+ V+  R       P       PSLL+ D  R+HL +T  N++K+  S+++ IP GLT ++QPLD+ VNR+FK KLR  WE W+     +   TK G  + A + TI EWIV +W  V+  T++  F  A
Sbjct:    5 KRHAYEAQFKLQAISYAVVNGN-RAAAKQFQINESMVRKWRKQENELRQVKKTKQSFRGNKARWPQLEDQLEQWIIEQRTAGRSVSTVTIRLRATKIAQDMGIEHFQGGPSWCFRFMKRRHLSIRARTTVAQQLPADYKEKLDIFRTYCSNKITDKKIQPKHITNMDEVPLTFDIPVNHTVEKKGASTVSIRTTGHEKSAFTVVLGCHGDGQKLPPMVIFKRKTLPKEKFP-AGVIIKANQKGWMDEEKMNEWLREVYVKR-------PDGFFHTSPSLLICDSMRAHLTATVKNQVKQMNSELAVIPGGLTKELQPLDIGVNRAFKVKLRAAWEQWMTDGEHTF--TKTGRQRRASYATICEWIVDAWAKVSALTVVRAFAKA 377          
BLAST of Pogo transposable element with krab domain vs. Ensembl Zebrafish
Match: pogzb (pogo transposable element derived with ZNF domain b [Source:ZFIN;Acc:ZDB-GENE-100609-3])

HSP 1 Score: 77.0258 bits (188), Expect = 5.166e-14
Identity = 79/326 (24.23%), Postives = 144/326 (44.17%), Query Frame = 3
Query:  300 KKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEM-KIEGFAASSHWTDNFMKRKNICVRRT-TTKQQLPKDWEFQMAKFRSIIADLKK--DLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKK-ESKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKW 1262
            ++ I+ LA   G I++ A+  D    +I+ WI  +     +N    S+ G      E   +L +W+L QRE++  ++  R+  +A  +  +  +   F  S  W  NFM +  + +    T +++LP   E     F+ ++    K  ++P   IG  D++ V  D+      + K   +  I+ TG  K    + L +L +GT LP   +F +            ++I A   G+   E LEIW   VWK  +        +Q+ K  +LL+ D H      + ++ +   ++ +  IPAG T + QPL++ V    +     +W
Sbjct: 1443 QRRILLLALCAG-IQKAAKEMDTKPQLIKTWIQDKE--DQLNECCSSICG------EAVDRLVQWVLTQREQQRPINEARLFEKASELQSQTNETSSFRISYEWAVNFMMQHKLGLDTCFTVQRELPSAMEENCRCFKELVHGQVKTNNVPQCVIGVMDQLSVFVDINM-LNEKNKVRRDTAIQFTGSGKPFVKIYLAMLANGTMLPA-ALFTSHTTSTLSSTPDTVLIMAKEEGYKATEELEIWATKVWKQHLD-------SQNEK-EALLVLDSHHCLTSESIISTVSSTKTFLPTIPAGCTCRHQPLEMCVRPVLQRLFLSRW 1749          
BLAST of Pogo transposable element with krab domain vs. Ensembl Zebrafish
Match: pogzb (pogo transposable element derived with ZNF domain b [Source:ZFIN;Acc:ZDB-GENE-100609-3])

HSP 1 Score: 75.8702 bits (185), Expect = 1.144e-13
Identity = 77/326 (23.62%), Postives = 141/326 (43.25%), Query Frame = 3
Query:  300 KKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEM-KIEGFAASSHWTDNFMKRKNICVRRT-TTKQQLPKDWEFQMAKFRSIIADLKK--DLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKK-ESKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKW 1262
            ++ I+ LA   G I++ A+  D    +I+ WI  +     +N    S+ G      E   +L +W+L QRE++  ++  R+  +A  +  +  +   F  S  W  NFM +  + +    T +++LP   E     F+ ++    K   +P   IG  D++ V  D+      + K   +  I+ TG  K    + L +L +GT LP   +F +            ++I A   G+   E LEIW   VWK  +        +   +  +LL+ D H      + ++ +   ++ +  IPAG T + QPL++ V    +     +W
Sbjct: 1443 QRRILLLALCAG-IQKAAKEMDTKPQLIKTWIQDKE--DQLNECCSSICG------EAVDRLVQWVLTQREQQRPINEARLFEKASELQSQTNETSSFRISYEWAVNFMMQHKLGLDTCFTVQRELPSAMEENCRCFKELVHGQIKTNSVPQCVIGVMDQLSVFVDINM-LNEKNKVRRDTAIQFTGSGKPFVKIYLAMLANGTMLPA-ALFTSHTTSTLSSTPDTVLIMAKEEGYKATEELEIWATKVWKQHL--------DSQKEKEALLVLDSHHCLTSESIISTVSSTKTFLPTIPAGCTCRHQPLEMCVRPVLQRLFLSRW 1749          
BLAST of Pogo transposable element with krab domain vs. Ensembl Xenopus
Match: celf3 (CUGBP, Elav-like family member 3 [Source:Xenbase;Acc:XB-GENE-5796618])

HSP 1 Score: 114.005 bits (284), Expect = 2.029e-25
Identity = 95/351 (27.07%), Postives = 164/351 (46.72%), Query Frame = 3
Query:  237 KMDNDSEQKQKKQRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIADL--KKDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVR---IKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKKESKV-SFIPAGLTSKVQPLDLTVNRSFKSKLRKKWED 1268
            K D     +Q+ Q +    + KK  + L     NI++ A  +  +   IRRW+ +    +    N+ +L  G     E E KL EW+L QRE++  V+   +  +A  I + ++  GF  S  W   FM R N+    +      LPK+ E     F   +      +DLP + I   DE+ +  D+      E  G++E +   ++T G  +    V + +L DG+ LP  V   T+      +PES +++ A   G+ + E +E+W   VW+       + P N+      + + D HR+HL    L+ +     + + +P+G +SK+QPLD+ + R+ K+ L KKW +
Sbjct:  880 KPDEAEAGEQEAQNKQEQLSVKKLRVVLFALCCNIQQAAEHFHNSPQRIRRWLQRFQTFQ--EENQDNLSEGKYLGAEAEEKLAEWVLAQREQQQPVNEETLFQKATKIGRSLE-GGFKISYEWAVRFMLRHNLSTHSKVAVAHPLPKEMESNSKTFIEFVQRQIHSQDLPLSMIAAVDEISLFLDL------EVLGSDERKENALQTVGTGEPWCDVVVTILADGSLLPTLVF--TRSSSSGEVPES-IILEAREDGYTDDEIVELWSSRVWQKHA----ECPNNK-----GMAVVDCHRTHLSEEVLSIMSSTCTLPAIVPSGCSSKIQPLDVCIKRAVKNFLHKKWRE 1209          
BLAST of Pogo transposable element with krab domain vs. Ensembl Xenopus
Match: celf3 (CUGBP, Elav-like family member 3 [Source:Xenbase;Acc:XB-GENE-5796618])

HSP 1 Score: 114.005 bits (284), Expect = 2.203e-25
Identity = 95/351 (27.07%), Postives = 164/351 (46.72%), Query Frame = 3
Query:  237 KMDNDSEQKQKKQRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIADL--KKDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVR---IKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKKESKV-SFIPAGLTSKVQPLDLTVNRSFKSKLRKKWED 1268
            K D     +Q+ Q +    + KK  + L     NI++ A  +  +   IRRW+ +    +    N+ +L  G     E E KL EW+L QRE++  V+   +  +A  I + ++  GF  S  W   FM R N+    +      LPK+ E     F   +      +DLP + I   DE+ +  D+      E  G++E +   ++T G  +    V + +L DG+ LP  V   T+      +PES +++ A   G+ + E +E+W   VW+       + P N+      + + D HR+HL    L+ +     + + +P+G +SK+QPLD+ + R+ K+ L KKW +
Sbjct:  914 KPDEAEAGEQEAQNKQEQLSVKKLRVVLFALCCNIQQAAEHFHNSPQRIRRWLQRFQTFQ--EENQDNLSEGKYLGAEAEEKLAEWVLAQREQQQPVNEETLFQKATKIGRSLE-GGFKISYEWAVRFMLRHNLSTHSKVAVAHPLPKEMESNSKTFIEFVQRQIHSQDLPLSMIAAVDEISLFLDL------EVLGSDERKENALQTVGTGEPWCDVVVTILADGSLLPTLVF--TRSSSSGEVPES-IILEAREDGYTDDEIVELWSSRVWQKHA----ECPNNK-----GMAVVDCHRTHLSEEVLSIMSSTCTLPAIVPSGCSSKIQPLDVCIKRAVKNFLHKKWRE 1243          
BLAST of Pogo transposable element with krab domain vs. Ensembl Mouse
Match: Pogk (pogo transposable element with KRAB domain [Source:MGI Symbol;Acc:MGI:1918842])

HSP 1 Score: 169.859 bits (429), Expect = 1.689e-44
Identity = 107/391 (27.37%), Postives = 198/391 (50.64%), Query Frame = 3
Query:  258 QKQKKQRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGG-NARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKI--EGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIADLKK--DLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIF-GTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKK-ESKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYESIKHTKFGNMKAADWNTIFEWIVSSWEDVNLSTILNGFR 1406
            Q  +  RRS+ +  K  +++ A    N  + A+++ + E  +R W   +  ++  +  RR+ RG  N R+  ++ ++ E++   + +   ++   ++L+A  IA+EM I  +GF AS  W    M+R ++ +R +    Q L +D   ++  ++  +  L++  D    Q+GN DE P+  ++P   TV+ +G   + +KT G EK R T  L VL DG KLPP++I  GT   P  F   S + I  +  GWM  + ++ WL+ VW+ R            P+   +L+ +  R H   +  + ++   + +  IP GLTS++Q LD+ V +     +R ++ +W++    ++  T  GN K        EWI+ +W  ++  +I+ GFR
Sbjct:  198 QFSRGMRRSYDAGFKLMVVEYAESTNNC-QAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLAEDLTEKLVTYQQSVLALRRTHDYEVAQMGNADETPICLEVPSRVTVDNQGEKPILVKTPGREKLRITAMLGVLADGRKLPPYIILRGTYIPPGKF--PSGMEIRCHRYGWMTEDLMQDWLEVVWRRRT--------GAVPRQRGMLILNGFRCHATDSVKSSMENMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPT--GNAKKPPLGLFLEWIMVAWNSISSESIVQGFR 575          
BLAST of Pogo transposable element with krab domain vs. Ensembl Mouse
Match: Pogk (pogo transposable element with KRAB domain [Source:MGI Symbol;Acc:MGI:1918842])

HSP 1 Score: 169.859 bits (429), Expect = 1.689e-44
Identity = 107/391 (27.37%), Postives = 198/391 (50.64%), Query Frame = 3
Query:  258 QKQKKQRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGG-NARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKI--EGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIADLKK--DLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIF-GTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKK-ESKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYESIKHTKFGNMKAADWNTIFEWIVSSWEDVNLSTILNGFR 1406
            Q  +  RRS+ +  K  +++ A    N  + A+++ + E  +R W   +  ++  +  RR+ RG  N R+  ++ ++ E++   + +   ++   ++L+A  IA+EM I  +GF AS  W    M+R ++ +R +    Q L +D   ++  ++  +  L++  D    Q+GN DE P+  ++P   TV+ +G   + +KT G EK R T  L VL DG KLPP++I  GT   P  F   S + I  +  GWM  + ++ WL+ VW+ R            P+   +L+ +  R H   +  + ++   + +  IP GLTS++Q LD+ V +     +R ++ +W++    ++  T  GN K        EWI+ +W  ++  +I+ GFR
Sbjct:  198 QFSRGMRRSYDAGFKLMVVEYAESTNNC-QAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLAEDLTEKLVTYQQSVLALRRTHDYEVAQMGNADETPICLEVPSRVTVDNQGEKPILVKTPGREKLRITAMLGVLADGRKLPPYIILRGTYIPPGKF--PSGMEIRCHRYGWMTEDLMQDWLEVVWRRRT--------GAVPRQRGMLILNGFRCHATDSVKSSMENMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPT--GNAKKPPLGLFLEWIMVAWNSISSESIVQGFR 575          
BLAST of Pogo transposable element with krab domain vs. Ensembl Mouse
Match: Pogk (pogo transposable element with KRAB domain [Source:MGI Symbol;Acc:MGI:1918842])

HSP 1 Score: 169.474 bits (428), Expect = 2.325e-44
Identity = 107/391 (27.37%), Postives = 198/391 (50.64%), Query Frame = 3
Query:  258 QKQKKQRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGG-NARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKI--EGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIADLKK--DLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIF-GTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKK-ESKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYESIKHTKFGNMKAADWNTIFEWIVSSWEDVNLSTILNGFR 1406
            Q  +  RRS+ +  K  +++ A    N  + A+++ + E  +R W   +  ++  +  RR+ RG  N R+  ++ ++ E++   + +   ++   ++L+A  IA+EM I  +GF AS  W    M+R ++ +R +    Q L +D   ++  ++  +  L++  D    Q+GN DE P+  ++P   TV+ +G   + +KT G EK R T  L VL DG KLPP++I  GT   P  F   S + I  +  GWM  + ++ WL+ VW+ R            P+   +L+ +  R H   +  + ++   + +  IP GLTS++Q LD+ V +     +R ++ +W++    ++  T  GN K        EWI+ +W  ++  +I+ GFR
Sbjct:  210 QFSRGMRRSYDAGFKLMVVEYAESTNNC-QAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLAEDLTEKLVTYQQSVLALRRTHDYEVAQMGNADETPICLEVPSRVTVDNQGEKPILVKTPGREKLRITAMLGVLADGRKLPPYIILRGTYIPPGKF--PSGMEIRCHRYGWMTEDLMQDWLEVVWRRRT--------GAVPRQRGMLILNGFRCHATDSVKSSMENMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPT--GNAKKPPLGLFLEWIMVAWNSISSESIVQGFR 587          
BLAST of Pogo transposable element with krab domain vs. Ensembl Mouse
Match: Pogk (pogo transposable element with KRAB domain [Source:MGI Symbol;Acc:MGI:1918842])

HSP 1 Score: 169.474 bits (428), Expect = 2.325e-44
Identity = 107/391 (27.37%), Postives = 198/391 (50.64%), Query Frame = 3
Query:  258 QKQKKQRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGG-NARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKI--EGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIADLKK--DLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIF-GTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKK-ESKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYESIKHTKFGNMKAADWNTIFEWIVSSWEDVNLSTILNGFR 1406
            Q  +  RRS+ +  K  +++ A    N  + A+++ + E  +R W   +  ++  +  RR+ RG  N R+  ++ ++ E++   + +   ++   ++L+A  IA+EM I  +GF AS  W    M+R ++ +R +    Q L +D   ++  ++  +  L++  D    Q+GN DE P+  ++P   TV+ +G   + +KT G EK R T  L VL DG KLPP++I  GT   P  F   S + I  +  GWM  + ++ WL+ VW+ R            P+   +L+ +  R H   +  + ++   + +  IP GLTS++Q LD+ V +     +R ++ +W++    ++  T  GN K        EWI+ +W  ++  +I+ GFR
Sbjct:  210 QFSRGMRRSYDAGFKLMVVEYAESTNNC-QAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLAEDLTEKLVTYQQSVLALRRTHDYEVAQMGNADETPICLEVPSRVTVDNQGEKPILVKTPGREKLRITAMLGVLADGRKLPPYIILRGTYIPPGKF--PSGMEIRCHRYGWMTEDLMQDWLEVVWRRRT--------GAVPRQRGMLILNGFRCHATDSVKSSMENMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPT--GNAKKPPLGLFLEWIMVAWNSISSESIVQGFR 587          
BLAST of Pogo transposable element with krab domain vs. Ensembl Mouse
Match: Pogz (pogo transposable element with ZNF domain [Source:MGI Symbol;Acc:MGI:2442117])

HSP 1 Score: 108.612 bits (270), Expect = 7.901e-24
Identity = 83/271 (30.63%), Postives = 132/271 (48.71%), Query Frame = 3
Query:  468 ELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIADL--KKDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKKESKV-SFIPAGLTSKVQPLDLTVNRSFKSKLRKKWED 1268
            E E KL EW+LIQRE++L V+   +  +A  I + ++  GF  S  W   FM R ++    R      LPK        F   +      +DLP + I   DE+ +  D      + +    E  ++T G  +    V L +L DGT LP  V F  + +    +P+S +++ A  +G+ + E +E+W   VWK            Q  K  S+L+ D HR+HL    L  +   S + + +PAG +SK+QPLD+ + R+ K+ L KKW++
Sbjct:  927 EAEEKLAEWVLIQREQQLPVNEETLFQKATKIGRSLE-GGFKISYEWAVRFMLRHHLTPHARRAVAHTLPKHVAENAGLFIEFVQRQIHNQDLPLSMIVAIDEISLFLDT---EVLSSDDRKENALQTVGTGEPWCDVVLAILADGTVLPTLVFFRGQANRFANVPDS-ILLEAKDSGYSDDEIMELWSTRVWKKHTAC-------QHSK--SMLVMDCHRTHLSEEVLALLSASSTLPAVVPAGCSSKIQPLDVCIKRTVKNFLHKKWKE 1183          
BLAST of Pogo transposable element with krab domain vs. UniProt/SwissProt
Match: sp|Q9P215|POGK_HUMAN (Pogo transposable element with KRAB domain OS=Homo sapiens OX=9606 GN=POGK PE=1 SV=2)

HSP 1 Score: 176.022 bits (445), Expect = 8.147e-46
Identity = 116/410 (28.29%), Postives = 208/410 (50.73%), Query Frame = 3
Query:  258 QKQKKQRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGG-NARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKI--EGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIADLKK--DLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIF-GTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKK-ESKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYESIKHTKFGNMKAADWNTIFEWIVSSWEDVNLSTILNGFRVA-----FGEDDDVL-EIE 1445
            Q  +  RRS+ +  K  +++ A    N  + A+++ + E  +R W   +  ++  +  RR+ RG  N R+  ++ ++ E++   + +   ++   ++L+A  IA+EM I  +GF AS  W    M+R ++ +R +    Q LP+D   ++  ++  +  L++  D    Q+GN DE P+  ++P   TV+ +G   V +KT G EK + T  L VL DG KLPP++I  GT   P  F   S + I  +  GWM  + ++ WL+ VW+ R            PK   +L+ +  R H   +  N ++   + +  IP GLTS++Q LD+ V +     +R ++ +W++    ++  T  GN K        EW++ +W  ++  +I+ GF+         E+DDVL EIE
Sbjct:  191 QFSRGMRRSYDAGFKLMVVEYAESTNNC-QAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLPEDLTEKLVTYQRSVLALRRAHDYEVAQMGNADETPICLEVPSRVTVDNQGEKPVLVKTPGREKLKITAMLGVLADGRKLPPYIILRGTYIPPGKF--PSGMEIRCHRYGWMTEDLMQDWLEVVWRRRT--------GAVPKQRGMLILNGFRGHATDSVKNSMESMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPT--GNAKKPPLGLFLEWVMVAWNSISSESIVQGFKKCHISSNLEEEDDVLWEIE 587          
BLAST of Pogo transposable element with krab domain vs. UniProt/SwissProt
Match: sp|Q80TC5|POGK_MOUSE (Pogo transposable element with KRAB domain OS=Mus musculus OX=10090 GN=Pogk PE=2 SV=2)

HSP 1 Score: 169.474 bits (428), Expect = 1.350e-43
Identity = 107/391 (27.37%), Postives = 198/391 (50.64%), Query Frame = 3
Query:  258 QKQKKQRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGG-NARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKI--EGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIADLKK--DLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIF-GTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKK-ESKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYESIKHTKFGNMKAADWNTIFEWIVSSWEDVNLSTILNGFR 1406
            Q  +  RRS+ +  K  +++ A    N  + A+++ + E  +R W   +  ++  +  RR+ RG  N R+  ++ ++ E++   + +   ++   ++L+A  IA+EM I  +GF AS  W    M+R ++ +R +    Q L +D   ++  ++  +  L++  D    Q+GN DE P+  ++P   TV+ +G   + +KT G EK R T  L VL DG KLPP++I  GT   P  F   S + I  +  GWM  + ++ WL+ VW+ R            P+   +L+ +  R H   +  + ++   + +  IP GLTS++Q LD+ V +     +R ++ +W++    ++  T  GN K        EWI+ +W  ++  +I+ GFR
Sbjct:  191 QFSRGMRRSYDAGFKLMVVEYAESTNNC-QAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVAEYVRYMQAKGDPITREAMQLKALEIAQEMNIPEKGFKASLGWCRRMMRRYDLSLRHKVPVPQHLAEDLTEKLVTYQQSVLALRRTHDYEVAQMGNADETPICLEVPSRVTVDNQGEKPILVKTPGREKLRITAMLGVLADGRKLPPYIILRGTYIPPGKF--PSGMEIRCHRYGWMTEDLMQDWLEVVWRRRT--------GAVPRQRGMLILNGFRCHATDSVKSSMENMNTDMVIIPGGLTSQLQVLDVVVYKPLNDSVRAQYSNWLLAGNLALSPT--GNAKKPPLGLFLEWIMVAWNSISSESIVQGFR 568          
BLAST of Pogo transposable element with krab domain vs. UniProt/SwissProt
Match: sp|Q8BZH4|POGZ_MOUSE (Pogo transposable element with ZNF domain OS=Mus musculus OX=10090 GN=Pogz PE=1 SV=2)

HSP 1 Score: 108.612 bits (270), Expect = 6.911e-23
Identity = 83/271 (30.63%), Postives = 132/271 (48.71%), Query Frame = 3
Query:  468 ELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIADL--KKDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKKESKV-SFIPAGLTSKVQPLDLTVNRSFKSKLRKKWED 1268
            E E KL EW+LIQRE++L V+   +  +A  I + ++  GF  S  W   FM R ++    R      LPK        F   +      +DLP + I   DE+ +  D      + +    E  ++T G  +    V L +L DGT LP  V F  + +    +P+S +++ A  +G+ + E +E+W   VWK            Q  K  S+L+ D HR+HL    L  +   S + + +PAG +SK+QPLD+ + R+ K+ L KKW++
Sbjct: 1022 EAEEKLAEWVLIQREQQLPVNEETLFQKATKIGRSLE-GGFKISYEWAVRFMLRHHLTPHARRAVAHTLPKHVAENAGLFIEFVQRQIHNQDLPLSMIVAIDEISLFLDT---EVLSSDDRKENALQTVGTGEPWCDVVLAILADGTVLPTLVFFRGQANRFANVPDS-ILLEAKDSGYSDDEIMELWSTRVWKKHTAC-------QHSK--SMLVMDCHRTHLSEEVLALLSASSTLPAVVPAGCSSKIQPLDVCIKRTVKNFLHKKWKE 1278          
BLAST of Pogo transposable element with krab domain vs. UniProt/SwissProt
Match: sp|Q7Z3K3|POGZ_HUMAN (Pogo transposable element with ZNF domain OS=Homo sapiens OX=9606 GN=POGZ PE=1 SV=2)

HSP 1 Score: 104.76 bits (260), Expect = 8.992e-22
Identity = 80/271 (29.52%), Postives = 130/271 (47.97%), Query Frame = 3
Query:  468 ELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIADL--KKDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKKESKV-SFIPAGLTSKVQPLDLTVNRSFKSKLRKKWED 1268
            E E KL EW+L QRE++L V+   +  +A  I + ++  GF  S  W   FM R ++    R      LPKD       F   +      +DLP + I   DE+ +  D      + +    E  ++T G  +    V L +L DGT LP  V +  +      +P+S +++ A  +G+ + E +E+W   VW+            Q  K   +L+ D HR+HL    L  +   S + + +PAG +SK+QPLD+ + R+ K+ L KKW++
Sbjct: 1026 EAEEKLAEWVLTQREQQLPVNEETLFQKATKIGRSLE-GGFKISYEWAVRFMLRHHLTPHARRAVAHTLPKDVAENAGLFIDFVQRQIHNQDLPLSMIVAIDEISLFLDT---EVLSSDDRKENALQTVGTGEPWCDVVLAILADGTVLPTLVFYRGQMDQPANMPDS-ILLEAKESGYSDDEIMELWSTRVWQKHTAC-------QRSK--GMLVMDCHRTHLSEEVLAMLSASSTLPAVVPAGCSSKIQPLDVCIKRTVKNFLHKKWKE 1282          
BLAST of Pogo transposable element with krab domain vs. UniProt/SwissProt
Match: sp|Q8BUZ3|TIGD4_MOUSE (Tigger transposable element-derived protein 4 OS=Mus musculus OX=10090 GN=Tigd4 PE=2 SV=1)

HSP 1 Score: 70.8626 bits (172), Expect = 1.769e-11
Identity = 97/404 (24.01%), Postives = 160/404 (39.60%), Query Frame = 3
Query:  270 KQRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIA-QESVIKAM-----NPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVRRTTTKQQLPKDWEFQMAKFRSIIADLKKDLPDNQIGNFDEVPVQCDM----PFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETF--IPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKKESKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYESIKHTKFGNMKAAD-----WNTIF-EWIVSSWEDVNLSTILNGFRVAFGEDD 1427
            K+++S S  +K +II          E+A  Y I +  +   +  ++ V++A      +P R+ LR   A Y +LE  L  W  I +   + V+   +RL+A   A+++    F  S+ W D F  R  + V R    +      +     +++++     D     + N  E  +   M     F +  ET    ++        K R T+ L    DG++  P +I G  + P  F  I    +   AN T WM     E W++        L  K    Q  K   ++  D   +H     L  I    +++F P+ L+S    ++  V +S K K R       +   ES K   F  + A D     W  +  E IV S+E+        GFR   GE+D
Sbjct:   16 KKKKSLSIEEKIDIINAVESGKKKAEIAAEYGIKKNSLSSIMKNKDKVLEAFESLRFDPKRKRLR--TAFYTDLEEALMRWYRIAQCLNVPVNGPMLRLKANDFAQKLGHNDFKCSNGWLDRFKSRYGL-VFRAQPVEATGISIDPSTVWYQNVLPYYLNDYHPKNVFNVKETGLLYRMLPTNTFAFKGETCSVGKLC-------KDRITLALGTNMDGSEKLPLLIIGKNRAPRCFKGIKSLPVYYEANRTAWMTAAIFEQWMQ-------KLDEKF---QAQKRRVVIFVDSCPAHPEVKNLKSI----ELAFFPSCLSSGFAAMNQGVIKSLKIKYRHCLIKKFLSSVESSKEFTFSLLDAVDTLHLCWRAVTPETIVKSYEEA-------GFRSPKGEND 388          
BLAST of Pogo transposable element with krab domain vs. TrEMBL
Match: A0A0G2L218 (HTH CENPB-type domain-containing protein OS=Danio rerio OX=7955 PE=4 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 4.007e-82
Identity = 155/384 (40.36%), Postives = 228/384 (59.38%), Query Frame = 3
Query:  273 QRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIAD--LKKDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKK-ESKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYESIKHTKFGNMKAADWNTIFEWIVSSWEDVNLSTILNGFRVA 1412
            +R ++ +  K + I  A   GN R  A+++ INE+++R+W  QE+ ++ +   ++S RG  AR+P+LE +L +WI+ QR     VS V IRL+A  IA++M IE F     W   FMKR+++ +R RTT  QQLP D++ ++  FR+  ++    K +    I N DEVP+  D+P  +TVE KGA+ V I+TTGHEK  FTV L    DG KLPP VIF  K  P+   P + ++I AN  GWM+ E +  WL+ V+  R       P       PSLL+ D  R+HL++T  N++K+  S+++ IP GLT ++QPLD+ VNR+FK KLR  WE W+     +   TK G  + A + TI EWIV +W  V+  T++  F  A
Sbjct:    5 KRHAYEAQFKLQAISYAVVNGN-RAAAKQFQINESMVRKWRKQENELRQVKKTKQSFRGNKARWPQLEDQLEQWIIEQRTAGRSVSTVTIRLRATKIAQDMGIEHFQGGPSWCFRFMKRRHLSIRARTTVAQQLPADYKEKLDIFRTYCSNKITDKKIQPKHITNMDEVPLTFDIPVNHTVEKKGASTVSIRTTGHEKSAFTVVLGCHGDGQKLPPMVIFKRKTLPKEKFP-AGIIIKANQKGWMDEEKMNEWLREVYVKR-------PDGFFHTSPSLLICDSMRAHLIATVKNQVKQMNSELAVIPGGLTKELQPLDIGVNRAFKVKLRAAWEQWMTDGEHTF--TKTGRQRRASYATICEWIVDAWAKVSALTVVRAFAKA 377          
BLAST of Pogo transposable element with krab domain vs. TrEMBL
Match: A0A0G2KDY1 (HTH CENPB-type domain-containing protein OS=Danio rerio OX=7955 PE=4 SV=1)

HSP 1 Score: 273.478 bits (698), Expect = 1.716e-81
Identity = 155/384 (40.36%), Postives = 227/384 (59.11%), Query Frame = 3
Query:  273 QRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIAD--LKKDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKK-ESKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYESIKHTKFGNMKAADWNTIFEWIVSSWEDVNLSTILNGFRVA 1412
            +R ++ +  K + I  A   GN R  A+++ INE+++R+W  QE+ ++ +   ++S RG  AR+P+LE +L +WI+ QR     VS V IRL+A  IA++M IE F     W   FMKR+++ +R RTT  QQLP D++ ++  FR+  ++    K +    I N DEVP+  D+P  +TVE KGA+ V I+TTGHEK  FTV L    DG KLPP VIF  K  P+   P + ++I AN  GWM+ E +  WL+ V+  R       P       PSLL+ D  R+HL +T  N++K+  S+++ IP GLT ++QPLD+ VNR+FK KLR  WE W+     +   TK G  + A + TI EWIV +W  V+  T++  F  A
Sbjct:    5 KRHAYEAQFKLQAISYAVVNGN-RAAAKQFQINESMVRKWRKQENELRQVKKTKQSFRGNKARWPQLEDQLEQWIIEQRTAGRSVSTVTIRLRATKIAQDMGIEHFQGGPSWCFRFMKRRHLSIRARTTVAQQLPADYKEKLDIFRTYCSNKITDKKIQPKHITNMDEVPLTFDIPVNHTVEKKGASTVSIRTTGHEKSAFTVVLGCHGDGQKLPPMVIFKRKTLPKEKFP-AGVIIKANQKGWMDEEKMNEWLREVYVKR-------PDGFFHTSPSLLICDSMRAHLTATVKNQVKQMNSELAVIPGGLTKELQPLDIGVNRAFKVKLRAAWEQWMTDGEHTF--TKTGRQRRASYATICEWIVDAWAKVSALTVVRAFAKA 377          
BLAST of Pogo transposable element with krab domain vs. TrEMBL
Match: A0A0G2KPX7 (HTH CENPB-type domain-containing protein OS=Danio rerio OX=7955 PE=4 SV=2)

HSP 1 Score: 273.863 bits (699), Expect = 2.906e-81
Identity = 155/384 (40.36%), Postives = 227/384 (59.11%), Query Frame = 3
Query:  273 QRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIAD--LKKDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKK-ESKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYESIKHTKFGNMKAADWNTIFEWIVSSWEDVNLSTILNGFRVA 1412
            +R ++ +  K + I  A   GN R  A+++ INE+++R+W  QE+ ++ +   ++S RG  AR+P+LE +L +WI+ QR     VS V IRL+A  IA++M IE F     W   FMKR+++ +R RTT  QQLP D++ ++  FR+  ++    K +    I N DEVP+  D+P  +TVE KGA+ V I+TTGHEK  FTV L    DG KLPP VIF  K  P+   P + ++I AN  GWM+ E +  WL+ V+  R       P       PSLL+ D  R+HL +T  N++K+  S+++ IP GLT ++QPLD+ VNR+FK KLR  WE W+     +   TK G  + A + TI EWIV +W  V+  T++  F  A
Sbjct:    5 KRHAYEAQFKLQAISYAVVNGN-RAAAKQFQINESMVRKWRKQENELRQVKKTKQSFRGNKARWPQLEDQLEQWIIEQRTAGRSVSTVTIRLRATKIAQDMGIEHFQGGPSWCFRFMKRRHLSIRARTTVAQQLPADYKEKLDIFRTYCSNKITDKKIQPKHITNMDEVPLTFDIPVNHTVEKKGASTVSIRTTGHEKSAFTVVLGCHGDGQKLPPMVIFKRKTLPKEKFP-AGVIIKANQKGWMDEEKMNEWLREVYVKR-------PDGFFHTSPSLLICDSMRAHLTATVKNQVKQMNSELAVIPGGLTKELQPLDIGVNRAFKVKLRAAWEQWMTDGEHTF--TKTGRQRRASYATICEWIVDAWAKVSALTVVRAFAKA 377          
BLAST of Pogo transposable element with krab domain vs. TrEMBL
Match: A0A2I4CL25 (pogo transposable element with KRAB domain OS=Austrofundulus limnaeus OX=52670 GN=pogk PE=4 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 1.467e-80
Identity = 146/384 (38.02%), Postives = 227/384 (59.11%), Query Frame = 3
Query:  273 QRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIAD--LKKDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKKESKV-SFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYESIKHTKFGNMKAADWNTIFEWIVSSWEDVNLSTILNGFRVA 1412
            +R ++++  K + I  A + GN R  AR ++INE+++R+W  QE  ++ +   ++S RG  AR+P+LE KL +W++ QR     VS + IRL+A  +A+E+ I  F     W   FMKR+N+ +  RTT  QQLP D++ ++A FR+   +   +K +    I N DEVP+  D+P   TV+  GA  V ++TTG+EK  FTV L    DG KLPP VIF  K  P+   P + +VI AN  GWM+ E +  WL+ ++  R       P       PSLL++D  RSH+      ++K+ + V + IP GLT ++QPLD+ +NR+FK++LR  WE W+ +   +   TK G  + A + TI +WIV++W D++ ST++  F+ A
Sbjct:    5 KRHAYNAEFKLKAISHAVEHGN-RAAAREFNINESMVRKWRKQEDELRQVKKTKQSFRGNKARWPQLEDKLKQWVVEQRAASRSVSTITIRLKATALARELNINDFRGGPSWCFRFMKRRNLSIHTRTTVSQQLPADYQEKLANFRTYCRNKITEKKIRPEHIINMDEVPLTFDIPVNRTVDKTGARTVNVRTTGNEKSSFTVVLACQADGQKLPPMVIFKRKTLPKENFP-AGVVIKANSKGWMDEEKMSEWLREIYVKR-------PGGFFHTAPSLLIYDSMRSHITDNVQKQVKRTNSVLAVIPGGLTKELQPLDVGINRAFKARLRTAWEQWMTEGEHTF--TKTGRQRRATYATICQWIVNAWADISDSTVVRAFKKA 377          
BLAST of Pogo transposable element with krab domain vs. TrEMBL
Match: A0A146PAS9 (Tigger transposable element-derived protein 7 OS=Fundulus heteroclitus OX=8078 PE=4 SV=1)

HSP 1 Score: 266.544 bits (680), Expect = 2.029e-78
Identity = 145/384 (37.76%), Postives = 224/384 (58.33%), Query Frame = 3
Query:  273 QRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVR-RTTTKQQLPKDWEFQMAKFRSIIAD--LKKDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKK-ESKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYESIKHTKFGNMKAADWNTIFEWIVSSWEDVNLSTILNGFRVA 1412
            +R ++ +  K + I  A + GN R  AR ++INE+++R+W  QE  ++ +   +RS RG  AR+  LE KL +W++ QR     VS + IR++A  +A E+ I  F     W   FMKR+N+ +R RTT  QQLPKD++ ++A FR+       +K +    I N DEVP+  D+P   TV+  GA  V ++TTG+EK  FTV L    +G KLPP VIF  K  P+   P + +VI A+  GWM+ E +  WL+ ++  R       P       PSLL++D  RSH+      ++K   S ++ IP GLT ++QPLD+ V+R+FK++LR  WE W+ +   +   TK G  +   + TI +WIV++W+D+++ST++  FR A
Sbjct:    5 KRHAYDAEFKLKAISHAVEHGN-RAAAREFNINESMVRKWRKQEDDLRQVKKTKRSFRGNKARWLPLEDKLEQWVVEQRAASRSVSTITIRMKATALASELNITDFKGGPSWCFRFMKRRNLSIRTRTTVSQQLPKDYQEKLATFRAYCKKNITEKKIRPEHITNMDEVPLTFDIPVNRTVDKTGARTVNVRTTGNEKSSFTVVLACQANGNKLPPMVIFKRKTLPKENFP-AGVVIKAHSKGWMDEEKMSEWLREIYVKR-------PGGFFHTAPSLLIYDSMRSHITDGVKKQVKHTNSTLAVIPGGLTKELQPLDIGVHRAFKARLRTAWEQWMTEGEHTF--TKTGRQRRTTYATICQWIVNAWDDISVSTVVRAFRKA 377          
BLAST of Pogo transposable element with krab domain vs. Ensembl Cavefish
Match: pogzb (pogo transposable element derived with ZNF domain b [Source:ZFIN;Acc:ZDB-GENE-100609-3])

HSP 1 Score: 85.5001 bits (210), Expect = 1.245e-16
Identity = 83/333 (24.92%), Postives = 144/333 (43.24%), Query Frame = 3
Query:  312 IKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRG-GNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEM-KIEGFAASSHWTDNFMKRKNICVRRTT---TKQQLPKDWEFQMAKFRSIIADLKK--DLPDNQIGNFDEVPVQCDMPFGYTVETKGAN-EVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIF-GT---KKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKKESKVS-FIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDW 1271
            I L      I++ A+  + N  +I+ W+  +         R    G GN+    +E +L EW+L++RE++  V+   +  +A  I  +  +   F  S  W  +FM +  + ++      +  QLP+  E     F   +    +   +P + +G  DE+ V  D  F   VE    + E   +  G EK    + L  + DGT LP F+   GT   K  P++ + ES++       G+  +E LEIW   VW+  +        N      ++L  D H SH+    ++ +     +   IP G T ++QPL++ VN   K  L  +W  +
Sbjct: 1411 ILLFALCSGIKKAAKEMNTNPQLIKAWLRDKE-------KRLDQEGLGNSSKEAIE-RLVEWVLVEREQQRIVNEKNLFQKASEIHMQTSQSSSFRISYEWAVSFMLKHKLGLQSPVMMLSYHQLPRSMEENCLHFTGFVQRQIQMHSVPHSAVGAMDELSVFVD--FDSLVEANSTSREAAFRLEGREKPWMNIYLSSMADGTMLPTFLFLKGTPFSKSLPDSLLLESRVY------GFSENEELEIWNSRVWQQHL--------NSQNGSKTILAMDGHHSHMSEGFVSTMSGTKTLPVIIPPGCTGQLQPLEMCVNPVLKKFLLARWSQF 1719          
BLAST of Pogo transposable element with krab domain vs. Ensembl Cavefish
Match: pogzb (pogo transposable element derived with ZNF domain b [Source:ZFIN;Acc:ZDB-GENE-100609-3])

HSP 1 Score: 85.5001 bits (210), Expect = 1.245e-16
Identity = 83/333 (24.92%), Postives = 144/333 (43.24%), Query Frame = 3
Query:  312 IKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRG-GNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEM-KIEGFAASSHWTDNFMKRKNICVRRTT---TKQQLPKDWEFQMAKFRSIIADLKK--DLPDNQIGNFDEVPVQCDMPFGYTVETKGAN-EVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIF-GT---KKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKKESKVS-FIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDW 1271
            I L      I++ A+  + N  +I+ W+  +         R    G GN+    +E +L EW+L++RE++  V+   +  +A  I  +  +   F  S  W  +FM +  + ++      +  QLP+  E     F   +    +   +P + +G  DE+ V  D  F   VE    + E   +  G EK    + L  + DGT LP F+   GT   K  P++ + ES++       G+  +E LEIW   VW+  +        N      ++L  D H SH+    ++ +     +   IP G T ++QPL++ VN   K  L  +W  +
Sbjct: 1411 ILLFALCSGIKKAAKEMNTNPQLIKAWLRDKE-------KRLDQEGLGNSSKEAIE-RLVEWVLVEREQQRIVNEKNLFQKASEIHMQTSQSSSFRISYEWAVSFMLKHKLGLQSPVMMLSYHQLPRSMEENCLHFTGFVQRQIQMHSVPHSAVGAMDELSVFVD--FDSLVEANSTSREAAFRLEGREKPWMNIYLSSMADGTMLPTFLFLKGTPFSKSLPDSLLLESRVY------GFSENEELEIWNSRVWQQHL--------NSQNGSKTILAMDGHHSHMSEGFVSTMSGTKTLPVIIPPGCTGQLQPLEMCVNPVLKKFLLARWSQF 1719          
BLAST of Pogo transposable element with krab domain vs. Ensembl Cavefish
Match: pogzb (pogo transposable element derived with ZNF domain b [Source:ZFIN;Acc:ZDB-GENE-100609-3])

HSP 1 Score: 84.3445 bits (207), Expect = 2.312e-16
Identity = 83/333 (24.92%), Postives = 144/333 (43.24%), Query Frame = 3
Query:  312 IKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRG-GNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEM-KIEGFAASSHWTDNFMKRKNICVRRTT---TKQQLPKDWEFQMAKFRSIIADLKK--DLPDNQIGNFDEVPVQCDMPFGYTVETKGAN-EVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIF-GT---KKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKKESKVS-FIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDW 1271
            I L      I++ A+  + N  +I+ W+  +         R    G GN+    +E +L EW+L++RE++  V+   +  +A  I  +  +   F  S  W  +FM +  + ++      +  QLP+  E     F   +    +   +P + +G  DE+ V  D  F   VE    + E   +  G EK    + L  + DGT LP F+   GT   K  P++ + ES++       G+  +E LEIW   VW+  +        N      ++L  D H SH+    ++ +     +   IP G T ++QPL++ VN   K  L  +W  +
Sbjct:  861 ILLFALCSGIKKAAKEMNTNPQLIKAWLRDKE-------KRLDQEGLGNSSKEAIE-RLVEWVLVEREQQRIVNEKNLFQKASEIHMQTSQSSSFRISYEWAVSFMLKHKLGLQSPVMMLSYHQLPRSMEENCLHFTGFVQRQIQMHSVPHSAVGAMDELSVFVD--FDSLVEANSTSREAAFRLEGREKPWMNIYLSSMADGTMLPTFLFLKGTPFSKSLPDSLLLESRVY------GFSENEELEIWNSRVWQQHL--------NSQNGSKTILAMDGHHSHMSEGFVSTMSGTKTLPVIIPPGCTGQLQPLEMCVNPVLKKFLLARWSQF 1169          
BLAST of Pogo transposable element with krab domain vs. Ensembl Cavefish
Match: pogza (pogo transposable element with ZNF domain [Source:NCBI gene;Acc:103028128])

HSP 1 Score: 66.2402 bits (160), Expect = 1.072e-10
Identity = 74/305 (24.26%), Postives = 124/305 (40.66%), Query Frame = 3
Query:  465 PELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVRRTTTKQQL--PKDWEFQMAKFRSIIADL-KKDLPDNQIGNFDEVPVQCDM-PFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPET----FIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVP--SLLLFDMHRSHLVSTTLNKIKKESKV-SFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYESIKHTKFGNMK--AADWNT 1340
            P    +L EW+L QRE++L V+  ++  +A  I    K+ G   S  W  +F+ R N+ V   +   +L  PK  E   +  R I   +  +    + IG  DE  +  DM           +     +  G       +    L DGT LP  V    K  P T     +P S +++ A   G+ + E L++W K VW+           N DP      LL+ D +R H+    L  +   S +   +P   +  +QPL+  V    +  L+ +W   +++  + +   +  N+    A W T
Sbjct:  978 PRASDRLAEWVLCQREQQLPVNEGKLFSKASEIMN--KVGGPGISYEWAVDFLLRYNLDVHALSVCSRLLPPKSQEHVHSFTRIITKQVSSQGFAQSSIGAMDEFSIFIDMEQLDPASADSSSMMSAFQLVGETDLLMDMVFTGLADGTMLPTMVFL--KGAPLTSNVPALPGS-IILEAKPEGFSDEERLQLWFKRVWR----------QNVDPGSGGKGLLVMDSYRGHMSDDFLATLNSASTLPGIVPRSCSCCLQPLEAGVWPVLREFLQARWSQHVMEAPQDLIGAQPANLALLLASWLT 1267          
BLAST of Pogo transposable element with krab domain vs. Ensembl Medaka
Match: ENSORLT00000030675.1 (zinc finger protein 37 [Source:NCBI gene;Acc:101161026])

HSP 1 Score: 157.918 bits (398), Expect = 6.802e-40
Identity = 124/395 (31.39%), Postives = 189/395 (47.85%), Query Frame = 3
Query:  273 QRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQ----ESVIKAMNPNRRSLRGGNARYP--ELETKLHEWILIQRERELQVSVVRIRLQAQ-VIAKEM-----KIEGFAASSHWTDNFMKRKNICVRRTTT-KQQLPKDWEFQMAKFRSIIADLK--KDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPE-SKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKKES-KVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYESIKHTKFGNMKAADWNTIFEWIVSSWEDVNLSTILNGFR 1406
            ++RSF  A K   +  A++     E AR + ++   IR W  Q    E  I       + LRGG A+    ELE  +  WI  QR +  +VS   IR++A+ +  KE+     + E F ASS W D FMKR  + +RR T   Q+ P     ++  F + +A+ +    + D +I   DE     DMP   T E  G+    +  +GHEK  FTV L    +G KL P ++F   K     + +  +  +A +  GWMN E  E+W + V  S   L             SLL++D    H+   T  ++KK +  ++ IP G T  VQP D+   + FK KLR+ +  W++ D E  + T  GN+KA     +  WI+S+W+D+   TI   F+
Sbjct:    3 KKRSFDLAFKLRAVAYAKEHSG-EESARHFGVDSKRIREWRKQMGDMEKTIAEKGATSKRLRGGGAKKASDELENLVLTWITEQRRKGGRVSRKMIRMKAKKIFDKEIDEASKRKETFTASSGWLDKFMKRHQLLLRRKTAPAQKDPDQVVHRLVSFVTSVANKRTADGIEDGEIIAMDETSAWFDMPGPTTAEPAGSRSDVMNASGHEKSHFTVTLAAKANGAKLKPLIVFRDAKREVARLQDVQEAAVATSINGWMNQELTEMWCQKVC-SGFGL-----------RKSLLVWDADHCHISKETKEELKKYNVSMTVIPNGCTKYVQPADI-WGKPFKDKLRELYAKWMVGD-EDKEWTSGGNLKAPALRLLVTWIISAWQDIPPETIRKSFK 382          
BLAST of Pogo transposable element with krab domain vs. Ensembl Medaka
Match: pogza (pogo transposable element derived with ZNF domain [Source:NCBI gene;Acc:101162766])

HSP 1 Score: 97.0561 bits (240), Expect = 2.782e-20
Identity = 81/327 (24.77%), Postives = 151/327 (46.18%), Query Frame = 3
Query:  312 IKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIRLQAQV-IAKEMKIEGFAASSHWTDNFMKRKNICVRRTTTK--QQLPKDWEFQMAKFRSIIADLKKDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIF-GTKKH-PETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKK-ESKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWI 1274
            + L+     + + +RR+     VIR WI ++         +R L     R+     K+ EW+L +RE++L V    + L A+  +    K+E +    +WT + M R ++ V+ T      Q+     F +    S + +L   +P + +G  DE+PV  ++        +  +  ++ T+  EK    + LC L DG+ LPP + + G   H PE F     +++ +   G+   E L +W++ VW   +     + + Q     S+LL D+HR HL +     +   +++ + IPAG   ++QPLD+ V +  +  L  +W   +
Sbjct:  840 VILSSMCHGVAQASRRFQTRPGVIRSWITRQ---------QRGLLKRKWRWKT--DKMAEWVLNRREQQLTVGEDVLLLTARATLGGSCKLEEYY---NWTVDVMLRHDLGVQTTNNHKLHQIELSSHFFLKTLFSQVQNLA--VPLHCLGCMDELPVFINL---DQFSNQNPSAFQLFTSHQEKPVIDIVLCGLSDGSFLPPMLFYTGAALHVPEGF--PDNVLLESRQQGFTEEERLALWVQKVWCPNVA----SKYKQA----SILLMDVHRGHLSTEFQGNLSSCQTQTAVIPAGCCCRLQPLDVCVAQVLRDHLMARWNQLV 1137          
BLAST of Pogo transposable element with krab domain vs. Ensembl Medaka
Match: pogzb (pogo transposable element derived with ZNF domain b [Source:ZFIN;Acc:ZDB-GENE-100609-3])

HSP 1 Score: 71.633 bits (174), Expect = 2.183e-12
Identity = 81/392 (20.66%), Postives = 167/392 (42.60%), Query Frame = 3
Query:  282 SFSSAKKKEIIKLARQL--------GNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKI-EGFAASSHWTDNFMKRKNICVRRTTTKQQL--PKDWEFQMAKFRSIIADLKK--DLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGTGWMNHEALEIWLK*VWKSRITLPPKTPWNQDPKVPSLLLFDMHRSHLVSTTLNKIKKE-SKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKWEDWIIKDYESIKHTKFGNMKAADWNTIFEWIVSSWEDVNLSTILNGFRVAF 1415
            S ++AK +E +  ARQL          ++  +R +     +IR W+ +          RR + G  A  P  E ++  W+L  RE++L +S   +  +A  + ++    + F  S  W  +F+ +  +          L  P   E ++  FR     + +   +P+  +   DE+ +  D       + +  +   ++ +G      TV L VL DGT LP  ++  ++  P   +PES +++ A        ++L++W   VW   +   P+          S+L+ D HR HL    L       S ++ IP G +  +QP+++ +  + +  L  +W  ++  +   ++      ++      + EW++ + +  +L T+ +  R +F
Sbjct: 1089 STAAAKDQEDVLTARQLRIVLFALCSGVQPASRVFSTEAPLIRSWLKEA---------RRRV-GQKAADPGSE-RMAAWVLSMREQQLPISEGALLHKASTLKQKGAFSDSFRISYDWAVSFLLQHQLGPHPAGRTAVLAPPPFLEAKVRAFREFTQRVVRVHGVPETCVAAMDELCLFVDWQLA---QDRSRSSEALEFSG-SVPAVTVFLTVLADGTALP-SLLLTSRPVPPKVLPES-VLLEAGPESLSAEDSLDLWTNKVWLPHVCAEPRK---------SVLVLDRHREHLGDQFLTSTAGSLSLLAVIPRGCSWWLQPMEVCLKPALQRLLLCRWTSFVAGNPPQLQDASPQQLQTHVIQLLVEWLMEALD--HLKTLPHMLRRSF 1452          
BLAST of Pogo transposable element with krab domain vs. Planmine SMEST
Match: SMESG000040582.1 (SMESG000040582.1)

HSP 1 Score: 461.07 bits (1185), Expect = 9.511e-160
Identity = 228/262 (87.02%), Postives = 232/262 (88.55%), Query Frame = 3
Query:  240 MDNDSEQKQKKQRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRRWIAQESVIKAMNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVRRTTTKQQLPKDWEFQMAKFRSIIADLKKDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGTGWMNHEALEIWL 1025
            MDNDSEQKQKKQRRSFSSAKKKEII+LARQLGNIREVARRY+INETVIRRWIAQESVIKA NPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRI LQAQVIAKEMKIEG AASS WTDNFMK KNICVR TTTK               S IADLKKDLPDNQIGNFDEV +QCDM  GYTVETKGANEVRIKT GHEKKRFTVNLCVLKDGTKLPPFVI GTKKH  TFIPESKLVIAANGTGWMNHE LEI+L
Sbjct:    1 MDNDSEQKQKKQRRSFSSAKKKEIIELARQLGNIREVARRYNINETVIRRWIAQESVIKAKNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIHLQAQVIAKEMKIEGLAASSQWTDNFMKCKNICVRGTTTK---------------STIADLKKDLPDNQIGNFDEVSIQCDMTLGYTVETKGANEVRIKTKGHEKKRFTVNLCVLKDGTKLPPFVILGTKKHTNTFIPESKLVIAANGTGWMNHETLEIFL 247          
BLAST of Pogo transposable element with krab domain vs. Planmine SMEST
Match: SMESG000052069.1 (SMESG000052069.1)

HSP 1 Score: 322.013 bits (824), Expect = 9.678e-107
Identity = 158/185 (85.41%), Postives = 164/185 (88.65%), Query Frame = 3
Query:  420 MNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVRRTTTKQQLPKDWEFQMAKFRSIIADLKKDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKK-HPETFIPESKLV 971
            MNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSV RIRLQAQVIAKEMKIEGFAASS  TDNFMKRKNICVRRT TKQQLPKDWEFQMAKFR+ IADL     DNQIGNFDEV VQCDMP GYTVETKG NEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVI GT+     +F+ +S L+
Sbjct:    1 MNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVFRIRLQAQVIAKEMKIEGFAASSQLTDNFMKRKNICVRRTITKQQLPKDWEFQMAKFRNTIADLL----DNQIGNFDEVSVQCDMPLGYTVETKGTNEVRIKTTGHEKKRFTVNLCVLKDGTKLPPFVILGTRNIQRLSFLNQSLLL 181          

HSP 2 Score: 47.7506 bits (112), Expect = 6.377e-6
Identity = 23/28 (82.14%), Postives = 24/28 (85.71%), Query Frame = 1
Query:  913 LLFLAQRNIQRLSFLNQSLLLQPMELVG 996
             + L  RNIQRLSFLNQSLLLQPMELVG
Sbjct:  161 FVILGTRNIQRLSFLNQSLLLQPMELVG 188          
BLAST of Pogo transposable element with krab domain vs. Planmine SMEST
Match: SMESG000052241.1 (SMESG000052241.1)

HSP 1 Score: 184.882 bits (468), Expect = 1.246e-49
Identity = 88/103 (85.44%), Postives = 94/103 (91.26%), Query Frame = 3
Query:  420 MNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVRRTTTKQQLPKDWEFQMAKFRSIIADLK 728
            MNPN+RSLRGGNARYP+LETKLHEWILIQRERELQVSVVRIRL AQVIAKE+KIEGFA SS WTDNFMKRKNICVRRTTTKQQL KDWEFQMA   S++  +K
Sbjct:    1 MNPNQRSLRGGNARYPKLETKLHEWILIQRERELQVSVVRIRLHAQVIAKEIKIEGFATSSKWTDNFMKRKNICVRRTTTKQQLSKDWEFQMANEFSLLLTMK 103          
BLAST of Pogo transposable element with krab domain vs. Planmine SMEST
Match: SMESG000031681.1 (SMESG000031681.1)

HSP 1 Score: 91.2781 bits (225), Expect = 3.040e-21
Identity = 48/152 (31.58%), Postives = 85/152 (55.92%), Query Frame = 3
Query:  348 VARRYDINETVIRRWIAQESVIKAMNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVRR-TTTKQQLPKDWEFQMAKFRSIIADLKKDLPDNQIGNFDEVPVQCDMPFGY 800
              R Y+++E  IR W   E+ +K ++P +R+ R G   + +++ +L E +L  ++ +  VS + IR++   IA E  I  F  +S    +FMKR ++ +R  T+  Q LP+DWE ++  F+  +   K D   + I + D+VPV+ DMP  +
Sbjct:    3 AGRHYEVDEKCIRNWRKSETALKKISPTKRARRRGMEYWLKIDAELKECVLDIKKAKRGVSTLAIRIKVNQIAFERNITNFGGNSKCYHSFMKRNSLSIRAVTSVGQSLPQDWEDKVTSFKIYLEQKKSDFEFSHICSMDKVPVRFDMPVNW 154          
BLAST of Pogo transposable element with krab domain vs. Planmine SMEST
Match: SMESG000055010.1 (SMESG000055010.1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.010e-11
Identity = 42/129 (32.56%), Postives = 68/129 (52.71%), Query Frame = 3
Query:  420 MNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVRIRLQAQVIAKEM-----KIEGFAASSHWTDNFMKRKNICVRR-TTTKQQLPKDWEFQMAKFRSIIADLKKDLPDNQIGNFDEVPVQCDM 788
            M P +R+ R     +PELE+ L +W+L +R    +VS ++I L+AQ +AK +      IE F +S  W   FM+R  + +R  T+  Q LP+DW+ +   F   + +++ DL         EVP   D+
Sbjct:    1 MKPIKRARRFRKEFWPELESVLKDWVLSERLNGSRVSALKICLKAQELAKNLFQNSVNIENFKSSITWCIRFMRRHRLSIRAVTSVGQNLPEDWK-EKCVFDEELTEIESDL---------EVPENLDL 119          
The following BLAST results are available for this feature:
BLAST of Pogo transposable element with krab domain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
POGK1.696e-4628.29pogo transposable element derived with KRAB domain... [more]
POGK1.696e-4628.29pogo transposable element derived with KRAB domain... [more]
POGZ1.544e-2229.52pogo transposable element derived with ZNF domain ... [more]
POGZ1.758e-2229.52pogo transposable element derived with ZNF domain ... [more]
POGZ1.847e-2229.52pogo transposable element derived with ZNF domain ... [more]
back to top
BLAST of Pogo transposable element with krab domain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y48G1C.63.374e-728.78pep chromosome:WBcel235:I:84991:86293:-1 gene:WBGe... [more]
back to top
BLAST of Pogo transposable element with krab domain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with krab domain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CR352209.11.791e-8540.36pep chromosome:GRCz11:24:26088143:26089609:1 gene:... [more]
BX914205.27.671e-8540.36pep chromosome:GRCz11:4:64121772:64123545:-1 gene:... [more]
CR354398.11.299e-8440.36pep chromosome:GRCz11:7:64150332:64152087:-1 gene:... [more]
pogzb5.166e-1424.23pogo transposable element derived with ZNF domain ... [more]
pogzb1.144e-1323.62pogo transposable element derived with ZNF domain ... [more]
back to top
BLAST of Pogo transposable element with krab domain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
celf32.029e-2527.07CUGBP, Elav-like family member 3 [Source:Xenbase;A... [more]
celf32.203e-2527.07CUGBP, Elav-like family member 3 [Source:Xenbase;A... [more]
back to top
BLAST of Pogo transposable element with krab domain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pogk1.689e-4427.37pogo transposable element with KRAB domain [Source... [more]
Pogk1.689e-4427.37pogo transposable element with KRAB domain [Source... [more]
Pogk2.325e-4427.37pogo transposable element with KRAB domain [Source... [more]
Pogk2.325e-4427.37pogo transposable element with KRAB domain [Source... [more]
Pogz7.901e-2430.63pogo transposable element with ZNF domain [Source:... [more]
back to top
BLAST of Pogo transposable element with krab domain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9P215|POGK_HUMAN8.147e-4628.29Pogo transposable element with KRAB domain OS=Homo... [more]
sp|Q80TC5|POGK_MOUSE1.350e-4327.37Pogo transposable element with KRAB domain OS=Mus ... [more]
sp|Q8BZH4|POGZ_MOUSE6.911e-2330.63Pogo transposable element with ZNF domain OS=Mus m... [more]
sp|Q7Z3K3|POGZ_HUMAN8.992e-2229.52Pogo transposable element with ZNF domain OS=Homo ... [more]
sp|Q8BUZ3|TIGD4_MOUSE1.769e-1124.01Tigger transposable element-derived protein 4 OS=M... [more]
back to top
BLAST of Pogo transposable element with krab domain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0G2L2184.007e-8240.36HTH CENPB-type domain-containing protein OS=Danio ... [more]
A0A0G2KDY11.716e-8140.36HTH CENPB-type domain-containing protein OS=Danio ... [more]
A0A0G2KPX72.906e-8140.36HTH CENPB-type domain-containing protein OS=Danio ... [more]
A0A2I4CL251.467e-8038.02pogo transposable element with KRAB domain OS=Aust... [more]
A0A146PAS92.029e-7837.76Tigger transposable element-derived protein 7 OS=F... [more]
back to top
BLAST of Pogo transposable element with krab domain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
pogzb1.245e-1624.92pogo transposable element derived with ZNF domain ... [more]
pogzb1.245e-1624.92pogo transposable element derived with ZNF domain ... [more]
pogzb2.312e-1624.92pogo transposable element derived with ZNF domain ... [more]
pogza1.072e-1024.26pogo transposable element with ZNF domain [Source:... [more]
back to top
BLAST of Pogo transposable element with krab domain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with krab domain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with krab domain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pogo transposable element with krab domain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000030675.16.802e-4031.39zinc finger protein 37 [Source:NCBI gene;Acc:10116... [more]
pogza2.782e-2024.77pogo transposable element derived with ZNF domain ... [more]
pogzb2.183e-1220.66pogo transposable element derived with ZNF domain ... [more]
back to top
BLAST of Pogo transposable element with krab domain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040582.19.511e-16087.02SMESG000040582.1[more]
SMESG000052069.19.678e-10785.41SMESG000052069.1[more]
SMESG000052241.11.246e-4985.44SMESG000052241.1[more]
SMESG000031681.13.040e-2131.58SMESG000031681.1[more]
SMESG000055010.12.010e-1132.56SMESG000055010.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021436 ID=SMED30021436|Name=Pogo transposable element with krab domain|organism=Schmidtea mediterranea sexual|type=transcript|length=2043bp
AAAATCCCGAGTATAAGCTGCAGCGCGTATTAGCTGCAGATGACATTTTT
ATAAAAATGTATTTTTTAGTCGTATAAACCGCAGCACGTATTAGCTGCAA
CATTTGCGTTGAAAACACATGATTTTAAAATCAGCAACCTATCGTTAAAA
AACAAATTTCACCGTGACAATAACCATTTTGTTTTAATCGTTTATATTGT
TTACATTTTTTATTGCACTGTTTTGAATCCTTGATTAAAATGGATAACGA
TTCTGAACAAAAACAAAAGAAACAACGAAGATCTTTTAGTTCAGCAAAGA
AAAAAGAAATTATTAAATTAGCTCGTCAGTTAGGAAACATACGGGAGGTT
GCAAGACGATATGATATTAATGAAACTGTTATTCGACGATGGATCGCCCA
AGAGTCTGTTATCAAAGCAATGAATCCAAATCGAAGATCTTTGCGTGGTG
GTAATGCTAGATATCCGGAATTGGAAACGAAATTACACGAATGGATCCTA
ATTCAACGTGAACGAGAACTTCAAGTGTCGGTTGTTCGAATTCGTTTACA
GGCACAAGTAATTGCCAAAGAGATGAAAATTGAAGGATTTGCCGCGAGCT
CTCATTGGACTGATAATTTCATGAAACGCAAGAATATTTGTGTTCGACGG
ACTACCACGAAGCAACAATTACCGAAAGATTGGGAATTTCAGATGGCCAA
GTTTAGAAGCATCATCGCAGATTTAAAGAAGGATTTGCCCGATAATCAAA
TCGGTAATTTTGATGAAGTGCCCGTTCAATGTGACATGCCTTTTGGGTAC
ACAGTTGAGACAAAAGGTGCCAATGAGGTCCGAATTAAAACTACAGGACA
TGAGAAAAAACGATTTACCGTCAATCTATGTGTTCTCAAAGATGGTACTA
AACTTCCGCCTTTTGTTATTTTTGGCACAAAGAAACATCCAGAGACTTTC
ATTCCTGAATCAAAGCTTGTTATTGCAGCCAATGGAACTGGTTGGATGAA
TCATGAAGCTCTTGAGATATGGCTTAAGTAAGTATGGAAGAGTCGAATTA
CATTGCCTCCAAAGACACCATGGAACCAGGATCCAAAAGTACCATCATTG
CTTTTATTTGATATGCATCGCTCACATCTTGTCAGTACTACACTTAATAA
AATTAAGAAGGAATCCAAAGTATCTTTCATACCTGCCGGATTGACATCAA
AGGTGCAGCCATTAGATCTTACTGTTAACCGTTCGTTCAAGTCGAAATTG
CGCAAGAAGTGGGAGGATTGGATCATTAAAGATTATGAAAGCATCAAACA
TACTAAGTTCGGAAATATGAAAGCAGCTGACTGGAATACTATTTTCGAAT
GGATTGTCTCCTCTTGGGAAGATGTTAACCTTTCCACCATTTTGAATGGT
TTTCGTGTTGCATTCGGTGAAGACGACGATGTTCTTGAAATTGAAGAAAA
TGAAATGAATGTGAACGAGTCTGATCCAAACATTGTAGAATTACTAGAAA
ATTTCACTTTTATTGACAATGAAAAGTGTGATGTTGAAAATTTAAATAAA
TAATCTTATCTTCAATTTGAATTGTTTTTTAGTTGTATAAGCTGCACATC
ATATTAGGTTCAATTCAAAAATGTTGCCTTTTTGTACGTATTAGCTGCCG
CTTATACTCGGGATTTTACAGTAATAATACAATACGTTTATTGTCAATAT
TTAAACAACTATATTATTTTCAAATAATATAATTTATTTAAATTAATTAT
TTTAAAAATTTATAAATTTTTTTAAAAAAAATTAATCTTGCTTTATAGAT
TACGTTGATATTTGTAAAACATGCAATTGTGACGGCAGAGGAAAGAAGAT
GGAATGAGTTTAAACCTAAGACTGTTTTAATTTATAACACATTTTTTAAG
ATTATAATAAACGATAATCTTATATACAATAGATTATAATCTTATACGTT
ATAGCTACATATTTGTTATTGTGTCCTCTGCGTTAAACCAACTAAATACC
TTTACACTCGAGTTATTAAAGGTAATAGAAATTCGAGATCGGA
back to top

protein sequence of SMED30021436-orf-1

>SMED30021436-orf-1 ID=SMED30021436-orf-1|Name=SMED30021436-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=264bp
MDNDSEQKQKKQRRSFSSAKKKEIIKLARQLGNIREVARRYDINETVIRR
WIAQESVIKAMNPNRRSLRGGNARYPELETKLHEWILIQRERELQVSVVR
IRLQAQVIAKEMKIEGFAASSHWTDNFMKRKNICVRRTTTKQQLPKDWEF
QMAKFRSIIADLKKDLPDNQIGNFDEVPVQCDMPFGYTVETKGANEVRIK
TTGHEKKRFTVNLCVLKDGTKLPPFVIFGTKKHPETFIPESKLVIAANGT
GWMNHEALEIWLK*
back to top

protein sequence of SMED30021436-orf-2

>SMED30021436-orf-2 ID=SMED30021436-orf-2|Name=SMED30021436-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=147bp
MHRSHLVSTTLNKIKKESKVSFIPAGLTSKVQPLDLTVNRSFKSKLRKKW
EDWIIKDYESIKHTKFGNMKAADWNTIFEWIVSSWEDVNLSTILNGFRVA
FGEDDDVLEIEENEMNVNESDPNIVELLENFTFIDNEKCDVENLNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002075pigment cell
Vocabulary: INTERPRO
TermDefinition
IPR006600HTH_CenpB_DNA-bd_dom
IPR009057Homeobox-like_sf
IPR004875DDE_SF_endonuclease_dom
IPR002514Transposase_8
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003676nucleic acid binding
GO:0004803transposase activity
Vocabulary: biological process
TermDefinition
GO:0006313transposition, DNA-mediated