SMED30021434

Overview
NameSMED30021434
Smed IDSMED30021434
Length (bp)4904
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30021434 (SMED30021434) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30021434 (SMED30021434) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30021434 (SMED30021434) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30021434 (SMED30021434) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of SMED30021434 vs. Ensembl Human
Match: ZBED8 (zinc finger BED-type containing 8 [Source:HGNC Symbol;Acc:HGNC:30804])

HSP 1 Score: 110.153 bits (274), Expect = 4.042e-51
Identity = 69/242 (28.51%), Postives = 120/242 (49.59%), Query Frame = -3
Query: 1039 IFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLN--FKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKLMQLSVIEKDCI-SSEDITLKTTHLKNLRGF 1755
            +F  F +   ++ I +    +  +DGA SM+G+   F+AY+K E+P I   HC  +   L+ K +  +L + L   ++ IN IK +A N RLF    ++    Y+ LL HTE+RWLS+G  L    +++  + +F     + +     N  FK H+  LAD++   N     +Q   +N + A+  +  F  K   +   + ++ F  F  L ++ V + + I  + +ITL   HL+ L  F
Sbjct:  219 VFNLFRDFFLKHKIALDVCGSVCTDGASSMLGENSEFVAYVKKEIPHIVVTHCLLNPHALVIKTLPTKLRDALFTVVRVINFIKGRAPNHRLFQAFFEEIGIEYSVLLFHTEMRWLSRGQILTHIFEMYEEINQFLHHKSSNLVDGFENKEFKIHLAYLADLFKHLNELSASMQRTGMNTVSAREKLSAFVRKFPFWQKRIEKRNFTNFPFLEEIIVSDNEGIFIAAEITL---HLQQLSNF 457          

HSP 2 Score: 82.4185 bits (202), Expect = 4.042e-51
Identity = 53/138 (38.41%), Postives = 80/138 (57.97%), Query Frame = -2
Query: 1730 LEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTS--KFAIKLDE*T-FGRNSILMLYVRYYSCSKEEIIEEFFCDKSLETCTKGEDIL-LF*KYF 2131
            L+ASY+ AYL AK   PHT+ E L+ P   E+   VL  + +  LQ +PLS+  +  RID+M+++I  Q++ +++ S  K  I+L E T     S LM +VRY    + EI+EEF   + L+   KG D+  LF  +F
Sbjct:   92 LQASYQFAYLCAKEKNPHTVAEKLVKPCALEIAQIVLGPDAQKKLQQVPLSDDVIHSRIDEMSQDILQQVLEDIKASPLKVGIQLAETTDMDDCSQLMAFVRY--IKEREIVEEFLFCEPLQLSMKGIDVFNLFRDFF 227          

HSP 3 Score: 38.1206 bits (87), Expect = 4.042e-51
Identity = 19/65 (29.23%), Postives = 33/65 (50.77%), Query Frame = -3
Query: 2218 KIRQYSEEYLKFGFVIAPV--N*SIPLCLICEKSFSNDYMKPSILKNHLNRMHADKKYSNLQTSK 2406
            K R++ ++Y+++ F           P C++C   FSN  ++PS L +H NR H      +L + K
Sbjct:    3 KKRKWDDDYVRYWFTCTTEVDGTQRPQCVLCNSVFSNADLRPSKLSDHFNRQHGGVAGHDLNSLK 67          

HSP 4 Score: 34.6538 bits (78), Expect = 4.042e-51
Identity = 23/81 (28.40%), Postives = 40/81 (49.38%), Query Frame = -1
Query:  759 WIIDPFLCDLTRFDIS--VHEELITLKEDVQAQVLFNTHDYAKFWTIKVIREKYPHL*MNSKPLLLIFPSSYFVEACFSAI 995
            WI+DPFL ++   D S  +  +L  L+   Q  + F T     FW  +     +P+L   +  +L+ F ++Y  E  FS++
Sbjct:  473 WILDPFLFNIDFVDDSYLMKNDLAELRASGQILMEFETMKLEDFWCAQFT--AFPNLAKTALEILMPFATTYLCELGFSSL 551          
BLAST of SMED30021434 vs. Ensembl Human
Match: ZBED8 (zinc finger BED-type containing 8 [Source:HGNC Symbol;Acc:HGNC:30804])

HSP 1 Score: 110.153 bits (274), Expect = 4.042e-51
Identity = 69/242 (28.51%), Postives = 120/242 (49.59%), Query Frame = -3
Query: 1039 IFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLN--FKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKLMQLSVIEKDCI-SSEDITLKTTHLKNLRGF 1755
            +F  F +   ++ I +    +  +DGA SM+G+   F+AY+K E+P I   HC  +   L+ K +  +L + L   ++ IN IK +A N RLF    ++    Y+ LL HTE+RWLS+G  L    +++  + +F     + +     N  FK H+  LAD++   N     +Q   +N + A+  +  F  K   +   + ++ F  F  L ++ V + + I  + +ITL   HL+ L  F
Sbjct:  219 VFNLFRDFFLKHKIALDVCGSVCTDGASSMLGENSEFVAYVKKEIPHIVVTHCLLNPHALVIKTLPTKLRDALFTVVRVINFIKGRAPNHRLFQAFFEEIGIEYSVLLFHTEMRWLSRGQILTHIFEMYEEINQFLHHKSSNLVDGFENKEFKIHLAYLADLFKHLNELSASMQRTGMNTVSAREKLSAFVRKFPFWQKRIEKRNFTNFPFLEEIIVSDNEGIFIAAEITL---HLQQLSNF 457          

HSP 2 Score: 82.4185 bits (202), Expect = 4.042e-51
Identity = 53/138 (38.41%), Postives = 80/138 (57.97%), Query Frame = -2
Query: 1730 LEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTS--KFAIKLDE*T-FGRNSILMLYVRYYSCSKEEIIEEFFCDKSLETCTKGEDIL-LF*KYF 2131
            L+ASY+ AYL AK   PHT+ E L+ P   E+   VL  + +  LQ +PLS+  +  RID+M+++I  Q++ +++ S  K  I+L E T     S LM +VRY    + EI+EEF   + L+   KG D+  LF  +F
Sbjct:   92 LQASYQFAYLCAKEKNPHTVAEKLVKPCALEIAQIVLGPDAQKKLQQVPLSDDVIHSRIDEMSQDILQQVLEDIKASPLKVGIQLAETTDMDDCSQLMAFVRY--IKEREIVEEFLFCEPLQLSMKGIDVFNLFRDFF 227          

HSP 3 Score: 38.1206 bits (87), Expect = 4.042e-51
Identity = 19/65 (29.23%), Postives = 33/65 (50.77%), Query Frame = -3
Query: 2218 KIRQYSEEYLKFGFVIAPV--N*SIPLCLICEKSFSNDYMKPSILKNHLNRMHADKKYSNLQTSK 2406
            K R++ ++Y+++ F           P C++C   FSN  ++PS L +H NR H      +L + K
Sbjct:    3 KKRKWDDDYVRYWFTCTTEVDGTQRPQCVLCNSVFSNADLRPSKLSDHFNRQHGGVAGHDLNSLK 67          

HSP 4 Score: 34.6538 bits (78), Expect = 4.042e-51
Identity = 23/81 (28.40%), Postives = 40/81 (49.38%), Query Frame = -1
Query:  759 WIIDPFLCDLTRFDIS--VHEELITLKEDVQAQVLFNTHDYAKFWTIKVIREKYPHL*MNSKPLLLIFPSSYFVEACFSAI 995
            WI+DPFL ++   D S  +  +L  L+   Q  + F T     FW  +     +P+L   +  +L+ F ++Y  E  FS++
Sbjct:  473 WILDPFLFNIDFVDDSYLMKNDLAELRASGQILMEFETMKLEDFWCAQFT--AFPNLAKTALEILMPFATTYLCELGFSSL 551          
BLAST of SMED30021434 vs. Ensembl Human
Match: FAM200B (family with sequence similarity 200 member B [Source:HGNC Symbol;Acc:HGNC:27740])

HSP 1 Score: 100.138 bits (248), Expect = 2.479e-45
Identity = 65/211 (30.81%), Postives = 105/211 (49.76%), Query Frame = -3
Query: 1120 ILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEV--PEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLN--FKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTL--NRKEFRYFDKLMQ 1734
            I+ QY +  KN    +SDG  +M GK+   +  L        +W  HCF HR+ L ++ I + L  VL   +K +N IK  +LNSRL    C +    + +LL HT++RWLS+G  L R  ++ + +  F  E  + + +   +  + T +  L DI+ + N    KLQG+N ++      I  FR  + L+   L  NR  +  F + +Q
Sbjct:  280 IVGQYKLNWKNCKGITSDGTATMTGKHSRVIKKLLEVTNNGAVWN-HCFIHREGLASREIPQNLMEVLKNAVKVVNFIKGSSLNSRLLETFCSEIGTNHTHLLYHTKIRWLSQGKILSRVYELRNEIHFFLIEKKSHLASIFEDDTWVTKLAYLTDIFSILNELSLKLQGKNSDVFQHVERIQGFRKTLLLWQVRLKSNRPSYYMFPRFLQ 489          

HSP 2 Score: 73.559 bits (179), Expect = 2.479e-45
Identity = 53/157 (33.76%), Postives = 89/157 (56.69%), Query Frame = -2
Query: 1748 FLTRSNKVIK---SFMKPSTSKNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTS-KFAIKLDE*T-FGRNSILMLYVRYYSCSKEEIIEEFFCDKSLETCTKGEDIL 2203
            +  R  K IK    F+  ST+ + E  L +SY +AY +AK    +T  E ++LP   +++ T+ +      L+ +P +++TV  RI  +AE++E  LIT L++   FAI+LDE T  G  + L++YVRY    +++ +E+F C  +L +   G DI 
Sbjct:  121 YFQRKKKDIKLSTQFLSCSTAVS-EKALLSSYLVAYRVAKEKIANTAAEKIILPACLDMVRTIFDDKSADKLKTIP-NDNTVSLRICTIAEHLETMLITRLQSGIDFAIQLDESTDIGSCTTLLVYVRY--AWQDDFLEDFLCFLNLTSHLSGLDIF 273          

HSP 3 Score: 52.373 bits (124), Expect = 2.479e-45
Identity = 26/59 (44.07%), Postives = 37/59 (62.71%), Query Frame = -3
Query: 2248 KKKI--RQYSEEYLKFGFVIA--PVN*SIPLCLICEKSFSNDYMKPSILKNHLNRMHAD 2412
            KKK+  R+Y+E+YLK+GF+    P     P C+IC    +N+ +KPS LK HL   HA+
Sbjct:   55 KKKVSARRYNEDYLKYGFIKCEKPFENDRPQCVICNNILANESLKPSKLKRHLETQHAE 113          
BLAST of SMED30021434 vs. Ensembl Human
Match: FAM200B (family with sequence similarity 200 member B [Source:HGNC Symbol;Acc:HGNC:27740])

HSP 1 Score: 100.138 bits (248), Expect = 2.479e-45
Identity = 65/211 (30.81%), Postives = 105/211 (49.76%), Query Frame = -3
Query: 1120 ILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEV--PEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLN--FKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTL--NRKEFRYFDKLMQ 1734
            I+ QY +  KN    +SDG  +M GK+   +  L        +W  HCF HR+ L ++ I + L  VL   +K +N IK  +LNSRL    C +    + +LL HT++RWLS+G  L R  ++ + +  F  E  + + +   +  + T +  L DI+ + N    KLQG+N ++      I  FR  + L+   L  NR  +  F + +Q
Sbjct:  280 IVGQYKLNWKNCKGITSDGTATMTGKHSRVIKKLLEVTNNGAVWN-HCFIHREGLASREIPQNLMEVLKNAVKVVNFIKGSSLNSRLLETFCSEIGTNHTHLLYHTKIRWLSQGKILSRVYELRNEIHFFLIEKKSHLASIFEDDTWVTKLAYLTDIFSILNELSLKLQGKNSDVFQHVERIQGFRKTLLLWQVRLKSNRPSYYMFPRFLQ 489          

HSP 2 Score: 73.559 bits (179), Expect = 2.479e-45
Identity = 53/157 (33.76%), Postives = 89/157 (56.69%), Query Frame = -2
Query: 1748 FLTRSNKVIK---SFMKPSTSKNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTS-KFAIKLDE*T-FGRNSILMLYVRYYSCSKEEIIEEFFCDKSLETCTKGEDIL 2203
            +  R  K IK    F+  ST+ + E  L +SY +AY +AK    +T  E ++LP   +++ T+ +      L+ +P +++TV  RI  +AE++E  LIT L++   FAI+LDE T  G  + L++YVRY    +++ +E+F C  +L +   G DI 
Sbjct:  121 YFQRKKKDIKLSTQFLSCSTAVS-EKALLSSYLVAYRVAKEKIANTAAEKIILPACLDMVRTIFDDKSADKLKTIP-NDNTVSLRICTIAEHLETMLITRLQSGIDFAIQLDESTDIGSCTTLLVYVRY--AWQDDFLEDFLCFLNLTSHLSGLDIF 273          

HSP 3 Score: 52.373 bits (124), Expect = 2.479e-45
Identity = 26/59 (44.07%), Postives = 37/59 (62.71%), Query Frame = -3
Query: 2248 KKKI--RQYSEEYLKFGFVIA--PVN*SIPLCLICEKSFSNDYMKPSILKNHLNRMHAD 2412
            KKK+  R+Y+E+YLK+GF+    P     P C+IC    +N+ +KPS LK HL   HA+
Sbjct:   55 KKKVSARRYNEDYLKYGFIKCEKPFENDRPQCVICNNILANESLKPSKLKRHLETQHAE 113          
BLAST of SMED30021434 vs. Ensembl Human
Match: FAM200A (family with sequence similarity 200 member A [Source:HGNC Symbol;Acc:HGNC:25401])

HSP 1 Score: 109.768 bits (273), Expect = 1.290e-40
Identity = 75/231 (32.47%), Postives = 118/231 (51.08%), Query Frame = -3
Query: 1093 IFYCFEN-ILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVP--EIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLN--FKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTL--NRKEFRYFDKLMQ---LSVIEKDCI 1755
            +F   EN +L QY +  K+    SSDG  +M GK+      L        +W  HCF HR+ L++K I   L +VL   +K +N IK  +LNSRL    C +    + +LL HTEVRWLS+G  L R  ++ + +  F  E  + +     +  + T +  L+DI+G+ N    K+QG+N +I      I  F+  + L+ + L  NR  +  F  L+Q    ++I +DC+
Sbjct:  187 LFTELENCLLGQYKLNWKHCKGISSDGTANMTGKHSRLTEKLLEATHNNAVWN-HCFIHREALVSKEISPSLMDVLKNAVKTVNFIKGSSLNSRLLEIFCSEIGVNHTHLLFHTEVRWLSQGKVLSRVYELRNEIYIFLVEKQSHLANIFEDDIWVTKLAYLSDIFGILNELSLKMQGKNNDIFQYLEHILGFQKTLLLWQARLKSNRPSYYMFPTLLQHIEENIINEDCL 416          

HSP 2 Score: 79.7221 bits (195), Expect = 1.290e-40
Identity = 53/157 (33.76%), Postives = 88/157 (56.05%), Query Frame = -2
Query: 1748 NFLTRSNKVIKS--FMKPSTSKNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTS-KFAIKLDE*T-FGRNSILMLYVRYYSCSKEEIIEEFFCDKSLETCTKGEDIL 2206
            +F    NKV  S   +  ST+ N E  L +SY +AY +AK    HT  E ++LP   +++ T+ +      L+ +PLS++T+ RRI  +A+++E  LIT L++   FAI+LDE T       L++YVRY    +++ +E+  C  +L +   G D+ 
Sbjct:   35 HFQKERNKVESSPQVLSRSTTMN-ERALLSSYLVAYRVAKEKMAHTAAEKIILPACMDMVRTIFDDKSADKLRTIPLSDNTISRRICTIAKHLEAMLITRLQSGIDFAIQLDESTDIASCPTLLVYVRY--VWQDDFVEDLLCCLNLNSHITGLDLF 188          
BLAST of SMED30021434 vs. Ensembl Zebrafish
Match: CR392001.3 (pep chromosome:GRCz11:8:38963323:38965260:-1 gene:ENSDARG00000117159.1 transcript:ENSDART00000181495.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR392001.3)

HSP 1 Score: 106.301 bits (264), Expect = 2.864e-27
Identity = 70/229 (30.57%), Postives = 107/229 (46.72%), Query Frame = -3
Query: 1099 EKIFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPE-IWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFEND-------NTMTTQLLNFKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKLMQLSVIEKD 1761
            E +  C    L +  I   ++I+ ++DGAPSM G  RGF+  L+  +   +   HC  H++ L A+    E   V+NL I+ +N I AKALN R F  L D+ D  Y++LLLH +VRWLSK   L+RF+     V  F    D       +T   + L+F      + D+    N     LQ R    +     + +F  K+ +F   + R    +F  L +     +D
Sbjct:  228 EAVLKC----LNENGINTNHLISVATDGAPSMRGSKRGFVTLLQKALDRNLLAFHCILHQEALCAQTFPSECMVVMNLVIEMVNKIIAKALNHRQFRALLDEVDSEYSDLLLHNKVRWLSKDEVLRRFVACLEHVKTFLKSKDLIYPQLEDTEWLEKLHF------MVDMTSHLNKLNESLQVRGNTALQMLEAVLSFERKLTVFARDVQRGTLSHFPSLREFKESHQD 446          

HSP 2 Score: 33.4982 bits (75), Expect = 2.864e-27
Identity = 47/158 (29.75%), Postives = 75/158 (47.47%), Query Frame = -2
Query: 1751 RSNKVIKSFMKPSTSKNVEGGLEASYKIAYLIAKGGYPHT----IRENLLLPVISEVITTVLNQNDRPVLQ---NLPLSNSTVQRRIDKMAENIELQLITELRTS-KFAIKLDE*TFGRNSILMLYVRYYSCS--KEEIIEEFFCDKSLETCTKGEDI 2194
            R NK  K    P+++        AS+     I K G P T    ++E+ +   ISE + +   +N   ++Q   ++PLS  TV+ R  KMA NI  Q I ++ ++  ++I  DE     +    L  RY +    +EEII+       L+  T+GEDI
Sbjct:   87 RKNKFKKWIASPNSTT------AASFVATREIIKRGKPFTDGDYMKESFI--NISEHLFSDF-KNKTEIIQKIKDMPLSAKTVKERAIKMAGNITEQQIKDINSAPAYSIACDE-----SCDTALLCRYVNSDGPQEEIIKLI----PLKGQTRGEDI 226          

HSP 3 Score: 24.2534 bits (51), Expect = 2.864e-27
Identity = 11/31 (35.48%), Postives = 17/31 (54.84%), Query Frame = -3
Query: 2251 SIPLCLICEKSFSNDYMKPSILKNHLNRMHA 2343
             +P CL+C +  SN+  K S ++ H    HA
Sbjct:   33 GLPECLLCSEKLSNN--KKSNVERHFQGRHA 61          
BLAST of SMED30021434 vs. Ensembl Zebrafish
Match: AL928808.1 (pep chromosome:GRCz11:20:17257101:17259573:-1 gene:ENSDARG00000101333.2 transcript:ENSDART00000166397.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL928808.1)

HSP 1 Score: 105.531 bits (262), Expect = 4.225e-25
Identity = 60/213 (28.17%), Postives = 116/213 (54.46%), Query Frame = -3
Query: 1114 NILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLK--NEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDE-VYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLNFK--THIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKLMQLS 1737
             ++++ ++ +  + A  +DGAP+M+G  RG +   K  +  P  WT HC  H++H ++K ++  L +++   ++ +N ++  ALN R F  L D+ DE + ++LL H  VRWLS+G  L RF ++ +  V+ F    +    +L + +  + +  L D+    N     LQG+   + D    +F F +K+ LF + L ++++ +F  L++ S
Sbjct:  239 TVVEKANLQLSKLTAIVTDGAPAMLGSERGLVGLCKADDRFPAFWTFHCIIHQEHWVSKKLN--LDHIMKPVLEIVNFVRTHALNHRQFKNLIDELDEDLPSDLLFHCAVRWLSRGHVLSRFFELLNP-VKLFLAEKHKEYPELHDPQWISDLAFLVDVLHYLNGLNVDLQGKLKMLPDLVQSVFAFVNKLKLFKTHLQKRDYTHFPTLLKAS 448          

HSP 2 Score: 31.187 bits (69), Expect = 4.225e-25
Identity = 27/104 (25.96%), Postives = 49/104 (47.12%), Query Frame = -1
Query:  759 EDFNVRFRDMENLCVP-AWIIDPFLCD-------LTRFDISVHEELITLKEDVQAQVLFNTHDYAKFWTIKVIREKYPHL*MNSKPLLLIFPSSYFVEACFSAI 1046
            + F  RF +++       ++I+PF  +       L   + +   E+I L ED + + +       +FW I V  E+YP++   +  LL +F S+Y  E  FS +
Sbjct:  471 QSFEERFSNLQQKRQQITFLINPFTAESGCLKAPLVEDEAASQLEMIELSEDDRLKSVLR-EGTVEFWKI-VPVERYPNVKQAALKLLSMFGSTYVCELLFSTL 572          
BLAST of SMED30021434 vs. Ensembl Xenopus
Match: spag1 (sperm associated antigen 1 [Source:Xenbase;Acc:XB-GENE-853609])

HSP 1 Score: 90.5077 bits (223), Expect = 1.023e-17
Identity = 58/196 (29.59%), Postives = 101/196 (51.53%), Query Frame = -3
Query: 1117 SDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKA--KALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFF--FENDNTMTTQL--LNFKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKLMQL 1686
            +DGA +MVG+ +G    L+ E  +    HC  H++ L   ++  ++ +++++  K  N I+   ++L  R F    ++ D  Y +LLLHT VRWLS G CL RF  +   +  +    + D+ +   L  ++F T +  L DI    N+    LQGR+ N+    + I  FR+K+ L  S L + +  +F+   +L
Sbjct:  258 TDGARAMVGRNQGLAGRLRKEGIDCHMFHCIVHQEVLCGTSL--KMADIMDVVTKVTNLIRGGNRSLTHRRFKNFLEELDAAYGDLLLHTNVRWLSAGKCLVRFFALRKEIHLYLSDIKCDSYLLEHLTDVSFLTALAFLTDITQFLNSLNLNLQGRDQNVSQLYSHIAAFRNKLHLLKSFLAKNDLTHFESCCEL 451          
BLAST of SMED30021434 vs. Ensembl Xenopus
Match: ENSXETT00000016563.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:37379994:37381838:-1 gene:ENSXETG00000009412.1 transcript:ENSXETT00000016563.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 90.5077 bits (223), Expect = 1.167e-17
Identity = 58/196 (29.59%), Postives = 101/196 (51.53%), Query Frame = -3
Query: 1117 SDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKA--KALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFF--FENDNTMTTQL--LNFKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKLMQL 1686
            +DGA +MVG+ +G    L+ E  +    HC  H++ L   ++  ++ +++++  K  N I+   ++L  R F    ++ D  Y +LLLHT VRWLS G CL RF  +   +  +    + D+ +   L  ++F T +  L DI    N+    LQGR+ N+    + I  FR+K+ L  S L + +  +F+   +L
Sbjct:  258 TDGARAMVGRNQGLAGRLRKEGIDCHMFHCIVHQEVLCGTSL--KMADIMDVVTKVTNLIRGGNRSLTHRRFKNFLEELDAAYGDLLLHTNVRWLSAGKCLVRFFALRKEIHLYLSDIKCDSYLLEHLTDVSFLTALAFLTDITQFLNSLNLNLQGRDQNVSQLYSHIAAFRNKLHLLKSFLAKNDLTHFESCCEL 451          
BLAST of SMED30021434 vs. Ensembl Mouse
Match: Zbed5 (zinc finger, BED type containing 5 [Source:MGI Symbol;Acc:MGI:1919220])

HSP 1 Score: 121.709 bits (304), Expect = 6.899e-48
Identity = 72/220 (32.73%), Postives = 111/220 (50.45%), Query Frame = -3
Query: 1126 IFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFF-------FE---NDNTMTTQLLNFKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKL 1755
            +F   ++ L+Q++I  K+I    +DGAP+ +G   GF   + NE P+    HC  H Q L  K + ++   V+   + ++N +KA +LNSRLF QLC   DE    LLLHTE RWLS+G  L+R  ++   +  FF       FE   +DN+   +       +  L DI+ + N     LQG N   +D    I +F+ K+ L+   L+  +F     L
Sbjct:  381 VFEAVDSFLRQHEISWKSICGVCTDGAPATLGCQSGFQRLVLNESPKAIGAHCMLHLQTLAMKTLPQDFQEVMKSVLSSVNFVKASSLNSRLFLQLCSDLDEPSKTLLLHTEGRWLSRGKVLKRIFELRDELKMFFNQKAIRQFEALFSDNSALQK-------VAYLVDIFTILNELNLSLQGPNSTCLDLSEKIHSFQMKLQLWQKKLDENKFYMLPTL 593          

HSP 2 Score: 72.4034 bits (176), Expect = 6.899e-48
Identity = 49/141 (34.75%), Postives = 76/141 (53.90%), Query Frame = -2
Query: 1748 STSKNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTSKF---AIKLDE*TFGRNSI-LMLYVRYYSCSKEEIIEEFFCDKSLETCTKGEDIL 2158
            S  +NV   +E SY +A  IA+   PHT  E+LL PV  + +  ++       L  + LSN TV+RRI  M+ +I  Q++ E++++     +I+LDE T   N + LM+YVRY   +  +  +EF C K LE      D+ 
Sbjct:  245 SNKQNV-AAVETSYLVALRIARDMKPHTFAEHLLFPVAKDRVRVMIGDEFVTKLSAVSLSNDTVRRRIHDMSADILDQVVQEIKSAPLPICSIQLDESTDVANCLQLMVYVRYI--NDGDFKDEFLCCKPLERTATALDVF 382          

HSP 3 Score: 39.6614 bits (91), Expect = 6.899e-48
Identity = 20/53 (37.74%), Postives = 29/53 (54.72%), Query Frame = -3
Query: 2251 KIRQYSEEYLKFGFVIA-PVN*SIPLCLICEKSFSNDYMKPSILKNHLNRMHA 2406
            K R+Y+E +L++GF     V    P C+IC    S + MKP+ LK H    H+
Sbjct:  165 KRRKYNEGFLQYGFTSTITVGIERPQCVICGVVLSAESMKPNKLKRHFESKHS 217          
BLAST of SMED30021434 vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 78.9518 bits (193), Expect = 4.989e-33
Identity = 60/222 (27.03%), Postives = 103/222 (46.40%), Query Frame = -3
Query: 1171 LKEKIFYCFENILKQYDIPI---------------KNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWT-----VHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLNFK---THIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLF 1767
            +KE++ +C E      D+ +                + +   +DGA SM  +Y      L++++ EI        HCF HR+HL AK +   LH +L    + ++ +K  A +S++   LC++    + NL L+ EVRWLS+G  L R  ++    +E F    ++   +  + +     +  LADI+ L N   + LQG         T  FN  +K+D+F
Sbjct:  770 VKEELLFCTEMPSPSTDLEVFELINKYIDSRSLNWNHCVGFCTDGAASMTDRY----FRLRSKIQEIAKNTVTFTHCFIHREHLAAKKLSPCLHEILLQSSQILSFVKNSASDSQMLTILCEEMGSEHVNLPLNAEVRWLSRGRILTRLFELRHE-IEIFLNQKHSDLARYFHDEEWIAKLAYLADIFSLINKLNSSLQG-------TMTTFFNLYNKVDVF 979          

HSP 2 Score: 70.4774 bits (171), Expect = 4.989e-33
Identity = 43/120 (35.83%), Postives = 74/120 (61.67%), Query Frame = -2
Query: 1790 EGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTSK-FAIKLDE*TFGRN-SILMLYVRYYSCSKEEIIEE-FFC 2140
            E  ++ASY IA+ IA    P +I E L+ P + E+ + VL  +    ++ +PLSNST+  RI K++++IE QL+ ++R S+ FA+++DE +      +L+ YVR+    + ++ EE  FC
Sbjct:  658 ESLVKASYLIAFQIAARNKPFSIAEELIKPYLVEMCSEVLGSSAGEKMKTIPLSNSTIGCRIKKLSDDIEDQLLQKVRESRWFALQVDESSEATEVPLLLCYVRFIDYDRGDVKEELLFC 777          

HSP 3 Score: 34.6538 bits (78), Expect = 4.989e-33
Identity = 17/54 (31.48%), Postives = 29/54 (53.70%), Query Frame = -3
Query: 2248 RQYSEEYLKFGFVIAPVN*SIPL---CLICEKSFSNDYMKPSILKNHLNRMHAD 2400
            + Y+ EY++FGF+I   +        C+IC +   ++ + P  L NHL   H+D
Sbjct:  574 QTYNAEYIRFGFIICSGSEESSPSPQCVICGEVLPSESVMPVSLSNHLKAKHSD 627          
BLAST of SMED30021434 vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 78.9518 bits (193), Expect = 5.360e-33
Identity = 60/222 (27.03%), Postives = 103/222 (46.40%), Query Frame = -3
Query: 1171 LKEKIFYCFENILKQYDIPI---------------KNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWT-----VHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLNFK---THIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLF 1767
            +KE++ +C E      D+ +                + +   +DGA SM  +Y      L++++ EI        HCF HR+HL AK +   LH +L    + ++ +K  A +S++   LC++    + NL L+ EVRWLS+G  L R  ++    +E F    ++   +  + +     +  LADI+ L N   + LQG         T  FN  +K+D+F
Sbjct:  862 VKEELLFCTEMPSPSTDLEVFELINKYIDSRSLNWNHCVGFCTDGAASMTDRY----FRLRSKIQEIAKNTVTFTHCFIHREHLAAKKLSPCLHEILLQSSQILSFVKNSASDSQMLTILCEEMGSEHVNLPLNAEVRWLSRGRILTRLFELRHE-IEIFLNQKHSDLARYFHDEEWIAKLAYLADIFSLINKLNSSLQG-------TMTTFFNLYNKVDVF 1071          

HSP 2 Score: 70.0922 bits (170), Expect = 5.360e-33
Identity = 43/120 (35.83%), Postives = 74/120 (61.67%), Query Frame = -2
Query: 1790 EGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTSK-FAIKLDE*TFGRN-SILMLYVRYYSCSKEEIIEE-FFC 2140
            E  ++ASY IA+ IA    P +I E L+ P + E+ + VL  +    ++ +PLSNST+  RI K++++IE QL+ ++R S+ FA+++DE +      +L+ YVR+    + ++ EE  FC
Sbjct:  750 ESLVKASYLIAFQIAARNKPFSIAEELIKPYLVEMCSEVLGSSAGEKMKTIPLSNSTIGCRIKKLSDDIEDQLLQKVRESRWFALQVDESSEATEVPLLLCYVRFIDYDRGDVKEELLFC 869          

HSP 3 Score: 34.6538 bits (78), Expect = 5.360e-33
Identity = 17/54 (31.48%), Postives = 29/54 (53.70%), Query Frame = -3
Query: 2248 RQYSEEYLKFGFVIAPVN*SIPL---CLICEKSFSNDYMKPSILKNHLNRMHAD 2400
            + Y+ EY++FGF+I   +        C+IC +   ++ + P  L NHL   H+D
Sbjct:  666 QTYNAEYIRFGFIICSGSEESSPSPQCVICGEVLPSESVMPVSLSNHLKAKHSD 719          
BLAST of SMED30021434 vs. Ensembl Mouse
Match: Gtf2ird2 (GTF2I repeat domain containing 2 [Source:MGI Symbol;Acc:MGI:2149780])

HSP 1 Score: 74.7146 bits (182), Expect = 7.979e-13
Identity = 57/229 (24.89%), Postives = 104/229 (45.41%), Query Frame = -3
Query: 1099 KIFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVP------EIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLNFKTHIF*LA---DIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKLMQLSVIEKD 1758
            +IF   E  LK++ I    +++ +S G P+M+    G +  L+          ++ +V C  H + L A+ +   + +V+++ + ++N I ++ LN   F  L  + D  Y +LL HT ++WL +G  L+RF +    +  F       +    L+ +  I  LA   D+    N     LQG +  +      I  F +K+ L+ + L R    +F  L  +S  E D
Sbjct:  588 EIFLRVEKSLKKFSIDWSKLVSVASTGTPAMMDANSGLVTKLRARAASCCKGADLKSVRCIIHPEWLCAQKLR--MGHVMDVVVDSVNWICSRGLNHGDFTTLLYELDSQYGSLLYHTALKWLGRGLVLRRFFESLEEIDSFMSSRGKPVPQ--LSSRDWILDLAFLVDMTTHLNTLDASLQGHSQIVTQMYDFIRAFLAKLCLWETHLARNNLAHFPTLKSVSRSESD 812          
BLAST of SMED30021434 vs. UniProt/SwissProt
Match: sp|Q8IZ13|ZBED8_HUMAN (Protein ZBED8 OS=Homo sapiens OX=9606 GN=ZBED8 PE=1 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.793e-50
Identity = 69/242 (28.51%), Postives = 120/242 (49.59%), Query Frame = -3
Query: 1039 IFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLN--FKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKLMQLSVIEKDCI-SSEDITLKTTHLKNLRGF 1755
            +F  F +   ++ I +    +  +DGA SM+G+   F+AY+K E+P I   HC  +   L+ K +  +L + L   ++ IN IK +A N RLF    ++    Y+ LL HTE+RWLS+G  L    +++  + +F     + +     N  FK H+  LAD++   N     +Q   +N + A+  +  F  K   +   + ++ F  F  L ++ V + + I  + +ITL   HL+ L  F
Sbjct:  219 VFNLFRDFFLKHKIALDVCGSVCTDGASSMLGENSEFVAYVKKEIPHIVVTHCLLNPHALVIKTLPTKLRDALFTVVRVINFIKGRAPNHRLFQAFFEEIGIEYSVLLFHTEMRWLSRGQILTHIFEMYEEINQFLHHKSSNLVDGFENKEFKIHLAYLADLFKHLNELSASMQRTGMNTVSAREKLSAFVRKFPFWQKRIEKRNFTNFPFLEEIIVSDNEGIFIAAEITL---HLQQLSNF 457          

HSP 2 Score: 82.4185 bits (202), Expect = 1.793e-50
Identity = 53/138 (38.41%), Postives = 80/138 (57.97%), Query Frame = -2
Query: 1730 LEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTS--KFAIKLDE*T-FGRNSILMLYVRYYSCSKEEIIEEFFCDKSLETCTKGEDIL-LF*KYF 2131
            L+ASY+ AYL AK   PHT+ E L+ P   E+   VL  + +  LQ +PLS+  +  RID+M+++I  Q++ +++ S  K  I+L E T     S LM +VRY    + EI+EEF   + L+   KG D+  LF  +F
Sbjct:   92 LQASYQFAYLCAKEKNPHTVAEKLVKPCALEIAQIVLGPDAQKKLQQVPLSDDVIHSRIDEMSQDILQQVLEDIKASPLKVGIQLAETTDMDDCSQLMAFVRY--IKEREIVEEFLFCEPLQLSMKGIDVFNLFRDFF 227          

HSP 3 Score: 38.1206 bits (87), Expect = 1.793e-50
Identity = 19/65 (29.23%), Postives = 33/65 (50.77%), Query Frame = -3
Query: 2218 KIRQYSEEYLKFGFVIAPV--N*SIPLCLICEKSFSNDYMKPSILKNHLNRMHADKKYSNLQTSK 2406
            K R++ ++Y+++ F           P C++C   FSN  ++PS L +H NR H      +L + K
Sbjct:    3 KKRKWDDDYVRYWFTCTTEVDGTQRPQCVLCNSVFSNADLRPSKLSDHFNRQHGGVAGHDLNSLK 67          

HSP 4 Score: 34.6538 bits (78), Expect = 1.793e-50
Identity = 23/81 (28.40%), Postives = 40/81 (49.38%), Query Frame = -1
Query:  759 WIIDPFLCDLTRFDIS--VHEELITLKEDVQAQVLFNTHDYAKFWTIKVIREKYPHL*MNSKPLLLIFPSSYFVEACFSAI 995
            WI+DPFL ++   D S  +  +L  L+   Q  + F T     FW  +     +P+L   +  +L+ F ++Y  E  FS++
Sbjct:  473 WILDPFLFNIDFVDDSYLMKNDLAELRASGQILMEFETMKLEDFWCAQFT--AFPNLAKTALEILMPFATTYLCELGFSSL 551          
BLAST of SMED30021434 vs. UniProt/SwissProt
Match: sp|P0CF97|F200B_HUMAN (Protein FAM200B OS=Homo sapiens OX=9606 GN=FAM200B PE=3 SV=1)

HSP 1 Score: 100.138 bits (248), Expect = 1.099e-44
Identity = 65/211 (30.81%), Postives = 105/211 (49.76%), Query Frame = -3
Query: 1120 ILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEV--PEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLN--FKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTL--NRKEFRYFDKLMQ 1734
            I+ QY +  KN    +SDG  +M GK+   +  L        +W  HCF HR+ L ++ I + L  VL   +K +N IK  +LNSRL    C +    + +LL HT++RWLS+G  L R  ++ + +  F  E  + + +   +  + T +  L DI+ + N    KLQG+N ++      I  FR  + L+   L  NR  +  F + +Q
Sbjct:  280 IVGQYKLNWKNCKGITSDGTATMTGKHSRVIKKLLEVTNNGAVWN-HCFIHREGLASREIPQNLMEVLKNAVKVVNFIKGSSLNSRLLETFCSEIGTNHTHLLYHTKIRWLSQGKILSRVYELRNEIHFFLIEKKSHLASIFEDDTWVTKLAYLTDIFSILNELSLKLQGKNSDVFQHVERIQGFRKTLLLWQVRLKSNRPSYYMFPRFLQ 489          

HSP 2 Score: 73.559 bits (179), Expect = 1.099e-44
Identity = 53/157 (33.76%), Postives = 89/157 (56.69%), Query Frame = -2
Query: 1748 FLTRSNKVIK---SFMKPSTSKNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTS-KFAIKLDE*T-FGRNSILMLYVRYYSCSKEEIIEEFFCDKSLETCTKGEDIL 2203
            +  R  K IK    F+  ST+ + E  L +SY +AY +AK    +T  E ++LP   +++ T+ +      L+ +P +++TV  RI  +AE++E  LIT L++   FAI+LDE T  G  + L++YVRY    +++ +E+F C  +L +   G DI 
Sbjct:  121 YFQRKKKDIKLSTQFLSCSTAVS-EKALLSSYLVAYRVAKEKIANTAAEKIILPACLDMVRTIFDDKSADKLKTIP-NDNTVSLRICTIAEHLETMLITRLQSGIDFAIQLDESTDIGSCTTLLVYVRY--AWQDDFLEDFLCFLNLTSHLSGLDIF 273          

HSP 3 Score: 52.373 bits (124), Expect = 1.099e-44
Identity = 26/59 (44.07%), Postives = 37/59 (62.71%), Query Frame = -3
Query: 2248 KKKI--RQYSEEYLKFGFVIA--PVN*SIPLCLICEKSFSNDYMKPSILKNHLNRMHAD 2412
            KKK+  R+Y+E+YLK+GF+    P     P C+IC    +N+ +KPS LK HL   HA+
Sbjct:   55 KKKVSARRYNEDYLKYGFIKCEKPFENDRPQCVICNNILANESLKPSKLKRHLETQHAE 113          
BLAST of SMED30021434 vs. UniProt/SwissProt
Match: sp|Q4R6P1|F200A_MACFA (Protein FAM200A OS=Macaca fascicularis OX=9541 GN=FAM200A PE=2 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 1.033e-40
Identity = 77/231 (33.33%), Postives = 119/231 (51.52%), Query Frame = -3
Query: 1093 IFYCFEN-ILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVP--EIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLN--FKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTL--NRKEFRYFDKLMQ---LSVIEKDCI 1755
            +F   EN I+ QY +  K+    SSDGA +M GK+      L        +W  HCF HR+ L++K I   L +VL   +K +N IK  +LNSRL   LC +    + +LL HTEVRWLS+G  L R  ++ + +  F  E  + +     N  + T +  L+DI+G+ N    K+QG+N +I      I  F+  +  + + L  NR  +  F  L+Q    ++I +DC+
Sbjct:  187 LFTELENCIVGQYKLNWKHCKGISSDGAANMTGKHSRLTEKLLEATHNNALWN-HCFIHREALVSKEISPSLMDVLKKAVKIVNFIKGSSLNSRLLEILCSEIGVNHTHLLFHTEVRWLSQGKVLSRVYELRNEIYIFLIEKQSHLANIFENDIWVTKLAYLSDIFGILNELNLKIQGKNNDIFQYLEHILGFQKTLLFWQARLKSNRPSYYMFPTLLQHIEENIINEDCL 416          

HSP 2 Score: 80.1073 bits (196), Expect = 1.033e-40
Identity = 53/157 (33.76%), Postives = 89/157 (56.69%), Query Frame = -2
Query: 1748 NFLTRSNKVIKS--FMKPSTSKNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTS-KFAIKLDE*T-FGRNSILMLYVRYYSCSKEEIIEEFFCDKSLETCTKGEDIL 2206
            +F  + NKV  S   +  ST+ N E  L +SY +AY +AK    HT  E ++LP   +++ T+ +      L+ +PLS++T+ RRI  +A+++E  LIT L++   FAI+LDE T       L++YVRY    +++ +E+  C  +L +   G D+ 
Sbjct:   35 HFQKQRNKVESSPQVLSRSTTMN-ERALLSSYLVAYRVAKEKMAHTAAEKIILPACMDMVRTIFDDKSADKLRTIPLSDNTISRRICTIAKHLEAMLITRLQSGIDFAIQLDESTDIASCPTLLVYVRY--VWQDDFVEDLLCCLNLNSHITGLDLF 188          
BLAST of SMED30021434 vs. UniProt/SwissProt
Match: sp|Q8TCP9|F200A_HUMAN (Protein FAM200A OS=Homo sapiens OX=9606 GN=FAM200A PE=1 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 5.719e-40
Identity = 75/231 (32.47%), Postives = 118/231 (51.08%), Query Frame = -3
Query: 1093 IFYCFEN-ILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVP--EIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLN--FKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTL--NRKEFRYFDKLMQ---LSVIEKDCI 1755
            +F   EN +L QY +  K+    SSDG  +M GK+      L        +W  HCF HR+ L++K I   L +VL   +K +N IK  +LNSRL    C +    + +LL HTEVRWLS+G  L R  ++ + +  F  E  + +     +  + T +  L+DI+G+ N    K+QG+N +I      I  F+  + L+ + L  NR  +  F  L+Q    ++I +DC+
Sbjct:  187 LFTELENCLLGQYKLNWKHCKGISSDGTANMTGKHSRLTEKLLEATHNNAVWN-HCFIHREALVSKEISPSLMDVLKNAVKTVNFIKGSSLNSRLLEIFCSEIGVNHTHLLFHTEVRWLSQGKVLSRVYELRNEIYIFLVEKQSHLANIFEDDIWVTKLAYLSDIFGILNELSLKMQGKNNDIFQYLEHILGFQKTLLLWQARLKSNRPSYYMFPTLLQHIEENIINEDCL 416          

HSP 2 Score: 79.7221 bits (195), Expect = 5.719e-40
Identity = 53/157 (33.76%), Postives = 88/157 (56.05%), Query Frame = -2
Query: 1748 NFLTRSNKVIKS--FMKPSTSKNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTS-KFAIKLDE*T-FGRNSILMLYVRYYSCSKEEIIEEFFCDKSLETCTKGEDIL 2206
            +F    NKV  S   +  ST+ N E  L +SY +AY +AK    HT  E ++LP   +++ T+ +      L+ +PLS++T+ RRI  +A+++E  LIT L++   FAI+LDE T       L++YVRY    +++ +E+  C  +L +   G D+ 
Sbjct:   35 HFQKERNKVESSPQVLSRSTTMN-ERALLSSYLVAYRVAKEKMAHTAAEKIILPACMDMVRTIFDDKSADKLRTIPLSDNTISRRICTIAKHLEAMLITRLQSGIDFAIQLDESTDIASCPTLLVYVRY--VWQDDFVEDLLCCLNLNSHITGLDLF 188          
BLAST of SMED30021434 vs. UniProt/SwissProt
Match: sp|Q6R2W3|SCND3_HUMAN (SCAN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZBED9 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 4.191e-28
Identity = 71/193 (36.79%), Postives = 108/193 (55.96%), Query Frame = -3
Query: 1231 FFVTSLLKRALKEKIFYCFEN-ILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQL---LNFKTHIF*LADIYGLFNATQNKLQGRN 1797
            FF  SL       +++   +N I+ +  +  K  +   SDGA SM GK+   +  +K   PE  T HCF HR+ L  K I  EL++VLN  +K +N IK+ +LNSRLF+ LCD  +  +  LLLH E+RWLS+G  L R  +I + ++  F +    M +QL   +N+   +  L+DI+ +FN     +QG+N
Sbjct:  932 FFSASLPTNTTSSELYEAVKNYIVNKCGLEFKFCVGVCSDGAASMTGKHSEVVTQIKELAPECKTTHCFIHRESLAMKKISAELNSVLNDIVKIVNYIKSNSLNSRLFSLLCDNMEADHKQLLLHAEIRWLSRGKVLSRMFEIRNELL-VFLQGKKPMWSQLFKDVNWTARLAYLSDIFSIFNDLNASMQGKN 1123          

HSP 2 Score: 78.9518 bits (193), Expect = 2.874e-20
Identity = 57/157 (36.31%), Postives = 88/157 (56.05%), Query Frame = -2
Query: 1751 FLTRSNKVIKSFMKPSTSKNVE----GGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTSK-FAIKLDE*TFGRNSILML-YVRYYSCSKEEIIEEFFCDKSLETCTKGEDI 2203
            F  R +  +KS  +P    NV       L ASYK+A  +AK   P+TI E L+   I EV   +L ++    +  +PLSN T+ RRI ++A ++E QLI +++ +K F+++LDE     N I++L YVR+     ++I EEFF   SL T T   ++
Sbjct:  794 FFERKSSELKS--QPKQVFNVSHINISALRASYKVALPVAKSKTPYTIAETLVKDCIKEVCLEMLGESAAKKVAQVPLSNDTIARRIQELANDMEDQLIEQIKLAKYFSLQLDECRDIANMIILLVYVRFE--HDDDIKEEFFFSASLPTNTTSSEL 946          

HSP 3 Score: 43.8986 bits (102), Expect = 2.874e-20
Identity = 22/53 (41.51%), Postives = 32/53 (60.38%), Query Frame = -3
Query: 2248 RQYSEEYLKFGFVIAPVN*SI--PLCLICEKSFSNDYMKPSILKNHLNRMHAD 2400
            R+Y   Y++FGFV A ++  +  P C+IC    +N+ MKPS LK HL   H +
Sbjct:  735 RKYDPSYIEFGFV-AVIDGEVLKPQCIICGDVLANEAMKPSKLKRHLYSKHKE 786          
BLAST of SMED30021434 vs. TrEMBL
Match: A0A5S6QHK7 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 7.724e-108
Identity = 93/237 (39.24%), Postives = 157/237 (66.24%), Query Frame = -3
Query: 1045 IFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLNFKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKLMQLSVIEKDCISSEDITLKTTHLKNLR 1755
            IF   ++ L + +IP++NIIA ++DGA SMVG+YRGF+A+LK  +P ++T+HC  HRQHL++KN+   L++ L++ I+ +N IK+ AL  RLF QLC+  +E +  LLLHTEVRWLSKG+CL+RF+ +++++V F   +D     +L+  K  IF LADI+   +     LQGR+  ++ +K  I +F  K++++   + R+EF  F  + +++    + ++ +D+ +   HL+ +R
Sbjct:  222 IFEEMKSYLAENNIPLENIIACATDGAASMVGRYRGFIAHLKKAIPSVFTIHCVIHRQHLVSKNLGARLNHSLSIVIRTVNFIKSHALRDRLFRQLCEHYNENFRTLLLHTEVRWLSKGNCLRRFVTLWNTIVSFM--SDKEDVGKLIEAKADIFYLADIFEKLDLLNKNLQGRDSTLVSSKEAITSFLKKLEVYWHNMGRREFLQFPNVKEIA----EMVTDDDLLVYVKHLQQIR 452          

HSP 2 Score: 119.783 bits (299), Expect = 7.724e-108
Identity = 70/160 (43.75%), Postives = 104/160 (65.00%), Query Frame = -2
Query: 1748 FKNLKCNFLTRSNKVIKSFMKPSTSKNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTSKFAIKLDE*TFGRN-SILMLYVRYYSCSKEEIIEEFFCDKSLETCTKGEDIL 2224
            FK L+ NF  R   V+   +   T K ++ G+ ASYKI+ LIAK G+ H + E+L+LP +S +I+ V+N N    +Q +PLSNSTV+RRID+MA +IE +L+  LRT KF+++LDE     N S+LM YVR+++  K  ++EE    K ++T T+G  I 
Sbjct:   69 FKALRNNFEKRP--VLTQLLTERTQK-LDKGVVASYKISKLIAKTGHGHNVGESLILPSLSIIISDVMNMNPNSTIQAVPLSNSTVRRRIDEMARDIEERLVDSLRTHKFSLQLDETCLQDNDSLLMAYVRFWNGDK--LMEEMLFAKRIKTDTRGLSIF 223          

HSP 3 Score: 68.1662 bits (165), Expect = 7.724e-108
Identity = 31/62 (50.00%), Postives = 42/62 (67.74%), Query Frame = -3
Query: 2227 KKKIRQYSEEYLKFGFVIAPVN*SIPLCLICEKSFSNDYMKPSILKNHLNRMHADKKYSNLQ 2412
            KKK R+YS EYL++GF+ +P + S+P+CL C  +FSN+  KP  LK HL   H DKK   L+
Sbjct:    6 KKKCRRYSVEYLQYGFIPSPQDQSLPMCLNCMATFSNETTKPCKLKKHLVTSHPDKKDKPLE 67          

HSP 4 Score: 66.6254 bits (161), Expect = 7.724e-108
Identity = 35/95 (36.84%), Postives = 50/95 (52.63%), Query Frame = -1
Query:  759 DFNVRFRDMENLCVPAWIIDPFLCDLTRFDISVHEELITLKEDVQAQVLFNTHDYAKFWTIKVIREKYPHL*MNSKPLLLIFPSSYFVEACFSAI 1043
            D   RF D+ NL +P WI++PF+ D T  D  + E LI L+ D  A+  F+  +   FW    +  KYP L   ++   + FPS Y VE  FS +
Sbjct:  454 DMEERFHDLINLNIPDWILNPFVVDPTEVDTEIQESLIDLQSDTSARHQFSLFE-KDFWMKNDLPNKYPTLWEQARTFFVAFPSMYLVECGFSKV 547          

HSP 5 Score: 38.1206 bits (87), Expect = 7.724e-108
Identity = 16/28 (57.14%), Postives = 20/28 (71.43%), Query Frame = -3
Query:  631 KGDLRIKLSNFRPNIKEIAQGRQAHLSH 714
            +GDLR+ LSN  PNI ++AQ  QA  SH
Sbjct:  562 RGDLRLSLSNLEPNIDQLAQKYQAQGSH 589          
BLAST of SMED30021434 vs. TrEMBL
Match: A0A5S6QR64 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 4.613e-107
Identity = 109/236 (46.19%), Postives = 153/236 (64.83%), Query Frame = -3
Query: 1048 IFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLNFKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKLMQLSVIEKDCISSEDITLKTTHLKNL 1755
            IF       K+ +IP+ NIIA ++DGAPSMVG   GF+++LK  VP +  +HC  HRQHL+A+ + E LH  L   I AIN I+ ++L+ RLF QLC+QNDE +N LLLHT+VRWLSKGSCL RF  +F SV+EF  + D ++ T L  F+  I  +AD+Y  FN    +LQG ++N++  K++I  F SK+  F   L+RKEF +F  L +  V +K  ++ EDI +   HL+ L
Sbjct:  221 IFLVVNEFFKEKEIPLTNIIAVATDGAPSMVGCRTGFISHLKKVVPGVLAIHCVIHRQHLVARCLSERLHLSLQYVISAINRIRGRSLSDRLFRQLCEQNDEDFNRLLLHTDVRWLSKGSCLSRFYCLFESVLEFLEKEDPSLCTNLKMFEGDIAYMADLYFKFNKMNLQLQGDDLNLVRTKSVINAFVSKLLFFKENLSRKEFCHFPSLCE--VHKKMQMNEEDIEVYCHHLEML 454          

HSP 2 Score: 119.013 bits (297), Expect = 4.613e-107
Identity = 62/139 (44.60%), Postives = 96/139 (69.06%), Query Frame = -2
Query: 1745 STSKNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTSKFAIKLDE*TF-GRNSILMLYVRYYSCSKEEIIEEFFCDKSLETCTKGEDILL 2158
            STSK    GL+ASY ++ +IAK G PHTI E LLLPV+SE++ TVL++    +L+ +PLSN+TVQRRID+M+ ++E  L   L+ ++F+++LDE    G  ++L+ YVR+    +E++++EF   + L T +KG  I L
Sbjct:   87 STSKLQNDGLQASYNVSLMIAKSGKPHTIGEELLLPVVSEILRTVLHKPPAEILKKIPLSNNTVQRRIDEMSRDVEQTLCNFLKNTEFSLQLDESILPGNEALLLAYVRF--IKEEQLVQEFLFARELPTDSKGTSIFL 223          

HSP 3 Score: 83.1889 bits (204), Expect = 4.613e-107
Identity = 36/65 (55.38%), Postives = 48/65 (73.85%), Query Frame = -3
Query: 2230 MSKVKKKIRQYSEEYLKFGFVIAPVN*SIPLCLICEKSFSNDYMKPSILKNHLNRMHADKKYSNL 2424
            MS+ K+K RQYS EYLK+GF+ +P N  +P+CL+C K+FSN+ MKPS L  HL +MH DK   +L
Sbjct:    1 MSEKKRKCRQYSTEYLKYGFIASPSNQRLPMCLLCHKTFSNESMKPSRLIEHLAKMHPDKSDKDL 65          

HSP 4 Score: 53.1434 bits (126), Expect = 4.613e-107
Identity = 33/98 (33.67%), Postives = 53/98 (54.08%), Query Frame = -1
Query:  759 EDFNVRFRDMENLCVPAWIIDPFLCDLTRFDISVHEELITLK--EDVQAQVLFNTHDYAKFWTIKVIREKYPHL*MNSKPLLLIFPSSYFVEACFSAI 1046
            +DF  RF D+  + +P W+ DPF   +   +  + EEL+ L+  E+++A++      Y +FW  + I   +P +    K  LL FPSSY VE  FS +
Sbjct:  456 KDFVERFEDILAMDIPTWVTDPF-STIENAERHLQEELLELQANEELKAKLKVG---YQRFWLQENIARLHPEIWAVVKKYLLSFPSSYLVERGFSVV 549          
BLAST of SMED30021434 vs. TrEMBL
Match: A0A5S6Q2S0 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 5.876e-103
Identity = 93/243 (38.27%), Postives = 157/243 (64.61%), Query Frame = -3
Query: 1027 IFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLNFKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKLMQLSVIEKDCISSEDITLKTTHLKNLRGF*CPF 1755
            IF   ++ L + +IP++NIIA ++DGA SMVG+YRGF+A+LK  +P ++T+HC  HRQHL++KN+   L++ L++ I+ +N IK+ AL  RLF QLC+  ++ +  LLLHTEVRWLSKG+CL+RF+ +++++V F   +D     +L+  K  IF LADI+   +     LQGR+  ++ +K  I +F  K++++   + R+EF  F  + +++    + +  +D+ +   HL+ +     PF
Sbjct:  447 IFEEMKSYLAENNIPLENIIACATDGAASMVGRYRGFIAHLKKAIPSVFTIHCVIHRQHLVSKNLGARLNHSLSIVIRTVNFIKSHALRDRLFRQLCEHYNDNFRTLLLHTEVRWLSKGNCLRRFVTLWNTIVSFM--SDKEDVGKLIEAKADIFYLADIFEKLDLLNKNLQGRDSTLVSSKEAITSFLKKLEVYWHNMGRREFLQFPNVKEIA----EMVIDDDLLVYVKHLQQIHWILNPF 683          

HSP 2 Score: 115.161 bits (287), Expect = 5.876e-103
Identity = 69/160 (43.12%), Postives = 103/160 (64.38%), Query Frame = -2
Query: 1748 FKNLKCNFLTRSNKVIKSFMKPSTSKNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTSKFAIKLDE*TFGRN-SILMLYVRYYSCSKEEIIEEFFCDKSLETCTKGEDIL 2224
            FK L+ NF  R   V+   +   T K ++ G+ ASYKI+ LIAK G+ H + E+L+LP +S +I+ V+N      +Q +PLSNSTV+RRID+MA +IE +L+  LRT KF+++LDE     N S+LM YVR+++  K  ++EE    K ++T T+G  I 
Sbjct:  294 FKALRNNFEKRP--VLTQLLTERTQK-LDKGVVASYKISKLIAKTGHGHNVGESLILPSLSIIISDVMNMYPNSTIQAVPLSNSTVRRRIDEMALDIEERLVDSLRTHKFSLQLDETCLQDNDSLLMAYVRFWNGDK--LMEEMLFAKRIKTDTRGLSIF 448          

HSP 3 Score: 74.3294 bits (181), Expect = 5.876e-103
Identity = 38/81 (46.91%), Postives = 52/81 (64.20%), Query Frame = -3
Query: 2227 FLPLNLFF----YSMSKV-KKKIRQYSEEYLKFGFVIAPVN*SIPLCLICEKSFSNDYMKPSILKNHLNRMHADKKYSNLQ 2454
            F P N+F     + MS + KKK R+YS EYL++GF+ +P + S+P+CL C  +FSN+ MKP  LK HL   H DKK   L+
Sbjct:  212 FTPFNVFIAQPHFPMSSLPKKKCRRYSVEYLQYGFIPSPQDQSLPMCLNCMATFSNETMKPCKLKKHLVTSHPDKKDKPLE 292          

HSP 4 Score: 55.0694 bits (131), Expect = 5.876e-103
Identity = 28/79 (35.44%), Postives = 42/79 (53.16%), Query Frame = -1
Query:  759 WIIDPFLCDLTRFDISVHEELITLKEDVQAQVLFNTHDYAKFWTIKVIREKYPHL*MNSKPLLLIFPSSYFVEACFSAI 995
            WI++PF+ D T  D  + E LI L+ D  A+  F+  +   FW    +  KYP L   ++   + FPS+Y VE  FS +
Sbjct:  678 WILNPFVVDPTEVDTEIQESLIDLQSDTSARHQFSLFE-KDFWMKNDLPNKYPTLWEQARTFFVAFPSTYLVECGFSKV 755          

HSP 5 Score: 35.4242 bits (80), Expect = 5.876e-103
Identity = 15/28 (53.57%), Postives = 19/28 (67.86%), Query Frame = -3
Query:  631 KGDLRIKLSNFRPNIKEIAQGRQAHLSH 714
            +GDL + LSN  PNI ++AQ  QA  SH
Sbjct:  770 RGDLHLSLSNLEPNIDQLAQKYQAQGSH 797          
BLAST of SMED30021434 vs. TrEMBL
Match: A0A4Y2IR38 (SCAN domain-containing protein 3 OS=Araneus ventricosus OX=182803 GN=ZBED9_42 PE=4 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 2.593e-102
Identity = 102/234 (43.59%), Postives = 145/234 (61.97%), Query Frame = -3
Query: 1039 ENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLNFKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKLMQLSVIEKDCISSEDITLKTTHLKNLRGF 1740
            E+ L +  IP  NII+ ++DGAP+M G+YRGF+++LK  +P +  +HC  HRQHL+AKN+ + LH  L   I A+N I++ ALN+RLFA LCD+NDE +  LLLHTEVRWLSKG+CL RF  +F SV+EF       +   L+ +K  I  L D++  FN    +LQG ++N+I  K +I  F  K+ L    ++R+EF  F  L Q+  ++      EDI     HL  L G+
Sbjct:  180 ESTLPEKSIPFTNIISVAADGAPAMFGQYRGFISHLKRIIPGLIAIHCVIHRQHLVAKNLSDRLHQSLQFVINAVNKIRSNALNTRLFALLCDENDEDFQRLLLHTEVRWLSKGACLSRFYSLFESVIEFLETKTPDLKENLIKYKADIAYLTDLFKKFNDVNLQLQGDSLNLIKTKGVISVFLGKLKLMEQNISRREFSQFPHLSQIECLD------EDIQTYAPHLNTLHGY 407          

HSP 2 Score: 102.064 bits (253), Expect = 2.593e-102
Identity = 56/105 (53.33%), Postives = 73/105 (69.52%), Query Frame = -2
Query: 1853 MKPSTSKNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTSKFAIKLDE*TFGRNSI 2167
            M  STS++ E GL AS  I+ LIAK G PHTI E L+LP I EV+ TVL++    VL+ +PLSN+TVQRRID+M+ +IE  L   L+T+ F+I+LDE T    SI
Sbjct:   84 MFASTSQSNEDGLRASCNISLLIAKSGKPHTIGEELILPAIEEVLKTVLHKPPFDVLKRIPLSNNTVQRRIDEMSSDIESFLCNYLQTTHFSIQLDESTLPEKSI 188          

HSP 3 Score: 73.9442 bits (180), Expect = 2.593e-102
Identity = 33/66 (50.00%), Postives = 47/66 (71.21%), Query Frame = -3
Query: 2227 MSKVKKKIRQYSEEYLKFGFVIAPVN*SIPLCLICEKSFSNDYMKPSILKNHLNRMHADKKYSNLQ 2424
            M++ KKK RQYS +YLKFGF+ +  +  +P+CL+C K  SND MKPS L++HL R H +K   +L+
Sbjct:    1 MAESKKKCRQYSVDYLKFGFLPSTADKRLPMCLLCNKVLSNDSMKPSKLEDHLRRCHPEKISKDLK 66          

HSP 4 Score: 62.003 bits (149), Expect = 2.593e-102
Identity = 36/94 (38.30%), Postives = 51/94 (54.26%), Query Frame = -1
Query:  759 FNVRFRDMENLCVPAWIIDPFLCDLTRFDISVHEELITLKEDVQAQVLFNTHDYAKFWTIKVIREKYPHL*MNSKPLLLIFPSSYFVEACFSAI 1040
            F  RF D+  + +P WII PF  +    ++ + EEL+ L  + + +V F    Y  FW    I EKYP L   ++  L+ FPSSY VE  FSA+
Sbjct:  408 FKNRFEDILTMDIPPWIITPF-DETEEANVVLQEELLELSTNEELKVKFKK-GYQTFWLQAEIPEKYPGLWEIARKFLIAFPSSYLVERSFSAV 499          
BLAST of SMED30021434 vs. TrEMBL
Match: G1KVP8 (Uncharacterized protein OS=Anolis carolinensis OX=28377 PE=4 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 6.705e-100
Identity = 105/224 (46.88%), Postives = 147/224 (65.62%), Query Frame = -3
Query: 1090 EKIFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLNFKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKLMQLSVIEKDCIS 1761
            E IF+  +   K+ +IP+ NI++ ++DGAP MVG Y  FLAYLK +VP  +TVHC  HRQHL+AKN+   LHN L   I+AIN+I++K+LN RLF QLC +NDE +N LLLHTEVRWLSKG+CL RF  +F+SV+EF    ++ + + L+  K+ I  L D++  FN +  +LQG  +N+I  K +I  F +K+ L+     R EF  F  L      +KD +S
Sbjct:  205 ESIFHALDEFFKEKEIPLSNILSLATDGAPVMVGCYSDFLAYLK-KVPNAFTVHCIIHRQHLVAKNLSARLHNSLQYVIQAINTIRSKSLNDRLFKQLCIENDEEFNRLLLHTEVRWLSKGACLDRFYKLFNSVLEFLKGKNDALQSNLIQSKSDIAYLTDLFQKFNESNLQLQGDELNLIKTKPVISAFVTKL-LYKRNFGRGEFSQFPNLSGAEKKDKDILS 426          

HSP 2 Score: 100.908 bits (250), Expect = 6.705e-100
Identity = 69/167 (41.32%), Postives = 100/167 (59.88%), Query Frame = -2
Query: 1748 KIQQFTNFKNLKCNFLTRSNKVIKSFMKPSTSKNVEG-GLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTSKFAIKLDE*TFGRNSILMLYVRYYSCSKEEIIEEFFCDKSLETCTKGEDIL 2245
            K++  + F+ LK  F+ +   + K F   ST+   +G GL ASYKI  +IAK G PHTI E  ++P ISEVI  VL++    +++ + LSN+TVQRR+D+MA+++E  L   L+TS F+I+LDE T   N  L+L     +   + II      K L+T TKGE I 
Sbjct:   55 KVKDLSYFRTLKEKFIEQPT-LAKLF---STTTTQDGDGLLASYKILLMIAKLGKPHTIGEEQIIPAISEVIHIVLHKPASDIIKKISLSNNTVQRRMDEMAQDVEDSLCGYLKTSWFSIQLDESTLLGNKTLLL-----AYGSQRII----IAKYLQTDTKGESIF 208          

HSP 3 Score: 76.6406 bits (187), Expect = 6.705e-100
Identity = 32/59 (54.24%), Postives = 45/59 (76.27%), Query Frame = -3
Query: 2230 KIRQYSEEYLKFGFVIAPVN*SIPLCLICEKSFSNDYMKPSILKNHLNRMHADKKYSNL 2406
            K RQY+ EYLK+GF+ +PVN ++P+CLIC+K  S + MKPS L+ HL ++H DKK  +L
Sbjct:    1 KCRQYNIEYLKYGFIESPVNNTLPMCLICQKVLSKEAMKPSRLQEHLTKIHGDKKVKDL 59          

HSP 4 Score: 45.4394 bits (106), Expect = 6.705e-100
Identity = 30/94 (31.91%), Postives = 46/94 (48.94%), Query Frame = -1
Query:  759 FNVRFRDMENLCVPAWIIDPFLCDLTRFDISVHEELITLKEDVQAQVLFNTHDYAKFWTIKVIREKYPHL*MNSKPLLLIFPSSYFVEACFSAI 1040
            FN RF D+  + +P      F C        +H+EL+ +  + + +  F +  Y +FW  K I   YP +    +  L+ FPSSY VE  FSA+
Sbjct:  438 FNQRFEDILKMNIPGSF---FKCK--EESPQLHDELMEVTTNDELKFKFKS-GYQQFWLQKEIPTAYPEIWTVIQKFLIAFPSSYLVERGFSAV 525          

HSP 5 Score: 30.8018 bits (68), Expect = 6.705e-100
Identity = 14/41 (34.15%), Postives = 20/41 (48.78%), Query Frame = -3
Query:  631 FIKKNKEQTQYY*KGDLRIKLSNFRPNIKEIAQGRQAHLSH 753
             + K + Q Q   +GDLR+ L    P I ++    Q H SH
Sbjct:  528 LLTKKRNQLQIVNRGDLRLLLMKIEPRITKLVAAYQVHPSH 568          
BLAST of SMED30021434 vs. Ensembl Cavefish
Match: ENSAMXT00000057314.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:4224188:4227217:-1 gene:ENSAMXG00000029268.1 transcript:ENSAMXT00000057314.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.806 bits (338), Expect = 3.130e-53
Identity = 76/216 (35.19%), Postives = 114/216 (52.78%), Query Frame = -3
Query: 1114 EKIFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLNFKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKLMQLS 1761
            E IF   +  +  ++IP KNI+A  +DGA SM+GK +GF + LK + P     HC  HR  L  K++ E+L+  L   +K +N IKA+ +N R+FAQLC+  DE +  LLLHTEVRWLS+G  L                            KT    LADI+ L+N    ++QG +  +I+ K  +  F  K++   + L + + ++F  L+Q S
Sbjct:  217 EDIFSAVDTYITSHNIPYKNIVACCTDGAASMMGKNKGFNSRLKEKAPHCLVFHCMVHRHALAGKHLCEDLNETLKTVVKIVNFIKARPVNRRIFAQLCE--DETHQTLLLHTEVRWLSRGKFL---------------------------IKTAY--LADIFSLYNEANKRMQGADGTVIECKETVDAFVRKVEFRRNKLKKGDLQHFPLLLQQS 401          

HSP 2 Score: 79.7221 bits (195), Expect = 3.130e-53
Identity = 47/127 (37.01%), Postives = 77/127 (60.63%), Query Frame = -2
Query: 1748 ASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTSKFAIKLDE-*TFGRNSILMLYVRYYSCSKEEIIEEFFCDKSLETCTKGEDIL 2125
            AS++ + LIAK   PHTI E L+ P   ++   +         + +PLSN+TV+ RID+MA N+E  L+ +L+TS F+I+LDE  T    +IL++Y +Y   +  E+ ++     +L++ T+GEDI 
Sbjct:   96 ASFECSLLIAKDKKPHTIGETLIKPACIKMAERMCGPQVANKFKIVPLSNNTVKDRIDRMAGNVENTLVEKLKTSPFSIQLDETTTVAEEAILIVYAQYIEGT--EVKQDILMSVNLKSTTRGEDIF 220          

HSP 3 Score: 37.3502 bits (85), Expect = 3.130e-53
Identity = 27/100 (27.00%), Postives = 48/100 (48.00%), Query Frame = -1
Query:  759 EDFNVRFRDMENLCVP-AWIIDPFLCDLTRFD-ISVHEELITLKEDVQAQVLFNTHDYAKFWTIKVIREKYPHL*MNSKPLL--LIFPSSYFVEACFSAI 1046
            E+ + RF D+  L    AW++DPFL      + +   +EL+ +K +      ++ H + +FW  K      P L  ++   +  L F ++Y  E  FSA+
Sbjct:  422 EEMHSRFSDIHELVSKDAWVMDPFLAKEDDVEHLQAEDELMDIKSNSVCMRFYDEHGFKQFWLAKGP-GVAPRLANHADHQISGLPFATTYLSETAFSAL 520          
BLAST of SMED30021434 vs. Ensembl Cavefish
Match: ENSAMXT00000051422.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:35461191:35465166:-1 gene:ENSAMXG00000032672.1 transcript:ENSAMXT00000051422.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.39 bits (285), Expect = 5.881e-52
Identity = 62/193 (32.12%), Postives = 105/193 (54.40%), Query Frame = -3
Query: 1126 IAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLNFK--THIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKL 1698
            +  S+DGA +M+G+  G +A +K   P   +VHC  HR+ L AK +  +L  VL+  +K +N IK++ L SRLF  LC++    +  LLLHTEVRWLS+G  L R  ++   V  F  +++  ++ +  +F+    +  L+DI+   N     LQG+++     +  I     K+D++   + +  +  FD L
Sbjct:  315 VGVSTDGARAMMGQRSGVIARVKAVAPLATSVHCSLHREALAAKRMSRDLKIVLDEAVKIVNFIKSRPLQSRLFRVLCEEMGSSHVQLLLHTEVRWLSRGKVLARLFELRDEVRIFLLDSNFELSDRFTDFEWLAKLSYLSDIFTHLNGLNISLQGKSVTAFHVQNKIEATIKKLDMWTKRVEQSNYESFDNL 507          

HSP 2 Score: 88.1965 bits (217), Expect = 5.881e-52
Identity = 55/125 (44.00%), Postives = 79/125 (63.20%), Query Frame = -2
Query: 1766 GLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTSKF-AIKLDE*TFGRN-SILMLYVRYYSCSKEEIIEEFFCDKSLETCT 2134
             +EASY++A LIAK G PHTI E+L+LP   E+++ +L +     L  + LS++TV+RRI++MA ++  QLI  +R S+F AI+LDE T   N S L+ +VRY      EI E+    K L T T
Sbjct:  169 AVEASYRVAQLIAKAGKPHTIGESLILPAAKEMVSVMLGEKPCKQLNLISLSDNTVERRINEMAHDVTQQLIKRVRESRFYAIQLDESTDIANLSNLLAFVRYE--HNREIFEDILFCKPLPTKT 291          

HSP 3 Score: 44.669 bits (104), Expect = 5.881e-52
Identity = 18/50 (36.00%), Postives = 29/50 (58.00%), Query Frame = -3
Query: 2248 YSEEYLKFGFVIAPV-N*SIPLCLICEKSFSNDYMKPSILKNHLNRMHAD 2394
            Y  EYL  GF      N  +PLC++C +  +N+ +KP+ L+ HL   H++
Sbjct:   85 YCSEYLALGFTCTGTENEPLPLCVVCSEVLANEALKPTKLRRHLETKHSE 134          
BLAST of SMED30021434 vs. Ensembl Cavefish
Match: ENSAMXT00000039226.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000099.1:564912:568121:1 gene:ENSAMXG00000042173.1 transcript:ENSAMXT00000039226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 123.25 bits (308), Expect = 1.688e-30
Identity = 76/254 (29.92%), Postives = 131/254 (51.57%), Query Frame = -3
Query: 1054 SLLKRALKEKIFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEV--PEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTM-----TTQLLNFKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYF---DKLMQLSVIEKDCISSEDITLKTTHLK 1785
             L +R   E I+  F     + D+P + +++ + DGAP+M G + GF+A  + +   P   + HC  H+Q L +K +  +  +V+ + +K +NSI+AKAL  RLF  L D+ D  Y +L+LH +VRWLS+G  LQRFI++   ++ F              T LL+       L D+    N    +LQG++ ++    + +  F+ K+ L+ S L  K+  +F   DK++  ++  KD    E+  +    L+
Sbjct:  215 PLNERTRGEDIYRAFRTYATENDLPFQKLVSITRDGAPAMCGIHAGFIALCRKDPIFPAFVSYHCVIHQQALASKVV--DFSHVMTVVVKIVNSIRAKALQHRLFKSLLDELDAEYGDLILHADVRWLSRGKVLQRFINLLPEIISFLKSRKEEYRELADDTWLLDLAF----LTDLTSKLNELNCELQGKDCDVPHMVSAVNAFKVKLALWTSQLKCKKLTHFQNVDKMLN-NISNKDSFHPENFCIHLNRLE 461          

HSP 2 Score: 31.187 bits (69), Expect = 1.688e-30
Identity = 20/61 (32.79%), Postives = 30/61 (49.18%), Query Frame = -1
Query:  768 SVHEELITLKEDVQAQVLFNTHDYAKFWTIKVIREKYPHL*MNSKPLLLIFPSSYFVEACF 950
             V  E+I L+ D++ +      D   FW + V RE+YP L   +  +   F S+YF E  F
Sbjct:  492 GVDMEIIDLENDIEMKARSRDKD---FWGL-VSRERYPSLSACALKVKAFFGSTYFCEMSF 548          
BLAST of SMED30021434 vs. Ensembl Cavefish
Match: ENSAMXT00000037725.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:29162452:29166863:1 gene:ENSAMXG00000037303.1 transcript:ENSAMXT00000037725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.301 bits (264), Expect = 8.121e-30
Identity = 63/226 (27.88%), Postives = 118/226 (52.21%), Query Frame = -3
Query: 1135 VTSLLKRALKEKIFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLK-----NEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFE--NDNTMTTQLLNFKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYF 1791
            +  L  R    +IF  F+  ++  ++P   + A ++DGA S+VG+  GF+ +LK     ++  E+   HC  H++ L  K++H     +++  + A+N I+A++L  R F    +     Y +++ HTEVRWLS+G+ L+RF  + +  ++ F E    +T+  +  ++   +  L D+ GL N    KLQG++  I      +  F  K++LF + L +    +F
Sbjct:  400 LVPLYGRTTGFEIFNAFKTAVENLNLPWSKLSAVTTDGALSVVGETNGFIGHLKRHLGPDQAAELKHYHCIIHQEALCGKHLH--FKEIMDFVVSAVNFIRARSLKHREFPSFLEDISAAYGDVIYHTEVRWLSRGNVLKRFFALRNE-IKLFLEQKGKDTLVMENTDWIADLAFLTDLTGLLNELNLKLQGKDRLICHLFEAVCAFEMKLNLFATQLKKGNLTHF 622          

HSP 2 Score: 34.2686 bits (77), Expect = 8.121e-30
Identity = 30/107 (28.04%), Postives = 52/107 (48.60%), Query Frame = -2
Query: 1835 KNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELR-TSKFAIKLDE*TFGRNSI-LMLYVR 2149
            K  E    ASY+IA L+AK   P  I    +   + E    +  +  +   +N+ LS +T+Q RI  ++ N   QL + +   + F+  LDE T   ++  L +++R
Sbjct:  281 KESEACTIASYRIANLVAKSARPF-IDGEFVKDCMLEACDVICPEA-KDAFKNISLSRTTIQLRIVDLSSNSYCQLQSRINDVTYFSAALDESTDNTDTAQLSIFIR 385          

HSP 3 Score: 31.9574 bits (71), Expect = 8.121e-30
Identity = 24/93 (25.81%), Postives = 41/93 (44.09%), Query Frame = -1
Query:  765 FNVRFRDMENLCVPAWII-DPFLCDLTRFDISVHEELITLKEDVQAQVLFNTHDYAKFWTIKVIREKYPHL*MNSKPLLLIFPSSYFVEACFS 1040
            F+ RF    N      ++ DPF  D       +  E+I LK     +         +F+   + RE++P+L  N++  + +F S+Y  E  FS
Sbjct:  650 FSARFGQFRNEQATLQLLADPFSVDTETVPGELQPEIIELKCSTAMRTKHREMPLLEFYQ-SLDREQFPNLFANAQKWISMFGSTYICEQMFS 741          
BLAST of SMED30021434 vs. Ensembl Cavefish
Match: ENSAMXT00000030525.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:12992682:12994541:1 gene:ENSAMXG00000035573.1 transcript:ENSAMXT00000030525.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.219 bits (256), Expect = 9.198e-29
Identity = 66/221 (29.86%), Postives = 117/221 (52.94%), Query Frame = -3
Query: 1135 VTSLLKRALKEKIFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLNFK--THIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYF 1791
            V  +  +   ++IF+   + ++   +P K  +  ++DGAPSM G+  G     +  V E   +HC  H+Q L +K +  +  NV+++ +K IN I++++L  R F  L ++ +  Y ++L  TEVRWLS+G+ L+RF ++ +  V+ F E D    T L + K    +  L DI    N    KLQG+   +  A   +  F +K+ L+ + L++  F +F
Sbjct:  267 VIPMHGQTTAQEIFHQLCDAIENAGLPWKRFVGITTDGAPSMTGRKNGLE---EESVEEAIALHCIIHQQALCSKCL--KFDNVMSVVVKCINQIRSRSLKHRRFRALLEEMESEYGDVLYFTEVRWLSRGNILKRFFELRAE-VKAFMEKDGVAVTVLSDPKWLMDLAFLVDITHELNVLNKKLQGQGQLVSAAYDNVRAFSAKLMLWKAQLSQTNFCHF 481          

HSP 2 Score: 45.4394 bits (106), Expect = 9.198e-29
Identity = 35/116 (30.17%), Postives = 61/116 (52.59%), Query Frame = -2
Query: 1835 KSFMKPSTSKNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITEL-RTSKFAIKLDE*T-FGRNSILMLYVR 2176
            + F K +T +N +  +EASY ++ +IAK G P T  E +   ++     +++    +    N+ LS +TV  RI  ++ +I  QL  +  R S +++ LDE T     + L +YVR
Sbjct:  140 QDFFKKATKEN-DAAVEASYVVSEMIAKAGKPFTEGEFVKKCILQ--AASIVCPEKKGQFSNISLSANTVAERISDLSSDIYDQLCEKAKRFSVYSVALDESTDITDTAQLAIYVR 252          
BLAST of SMED30021434 vs. Ensembl Nematostella
Match: EDO43282 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ18])

HSP 1 Score: 57.3806 bits (137), Expect = 4.569e-8
Identity = 49/229 (21.40%), Postives = 91/229 (39.74%), Query Frame = -3
Query: 1222 YAIIV----VQRKK*SRSFFVTSLLKRALKEKIFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAI---------NSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLL----------NFKTHIF*LADIYGLFNATQNKLQGRNINI 1839
            Y ++V    V R + +  F+   L+     + IF    ++ + Y++P +N+I  S D A   +GK+ G   + + +   ++T  C  H  H  A    +         +            NS K +A + + F   CDQ+   Y  +L +   RWLS+  C+ R +  + S+  +F       + + L            + H+     I  +F+    +LQG    I
Sbjct:  142 YPLVVRIYDVNRGEVASQFWHMCLISDCTAQGIFNSVSDVFRDYEVPWENVIGLSLDNASVNMGKHNGLYRHFERKNASVYTFGCPCHIVHNTASYGAKAYAEAAGFDLGDFLVDIYYYFDNSTKRQA-SLKDFCDFCDQD---YRKILKYGATRWLSRELCVSRVLKQYPSLQSYFASQPELRSDKRLCRLREYFADPXTEIHLMFFQSILPVFSELNKQLQGEEPQI 366          
BLAST of SMED30021434 vs. Ensembl Medaka
Match: ENSORLT00000032459.1 (pep primary_assembly:ASM223467v1:8:14240678:14247355:1 gene:ENSORLG00000024991.1 transcript:ENSORLT00000032459.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.428 bits (350), Expect = 5.805e-56
Identity = 81/251 (32.27%), Postives = 126/251 (50.20%), Query Frame = -3
Query: 1051 FFVTSLLKRALKEKIFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLN--FKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKLMQLSVIEKDCISSEDITLKTTHLKN 1797
             F   L  RA  E+ F C +N   +  +  +N +   SDGA SM G++RG +  + +  PE    HCF HR++L AK +  E H V+++ +K IN IK+ A+NSR FAQLC+  +  +  LL H+EVRWLS+G  L R  ++ + +  F  +  + +     N  F   +  L+DI+ L N     LQGRN NI      +  F+ K+ L+    + +    F  L  +         S  ++   +HL N
Sbjct:  210 LFCGELPTRATAEECFRCMDNYFTENGLDWQNCVGVCSDGAASMTGRHRGVIKQILDLAPEAKWTHCFLHRENL-AKKMSPEFHEVMDVTVKTINFIKSNAVNSRCFAQLCEGMEADHVQLLYHSEVRWLSRGLVLTRIFELRNEIFSFLTDKKSPLAHHYTNATFIAKLAYLSDIFSLLNQLNISLQGRNSNIFFVADKVQAFQKKLSLWSKRAHEERLDMFPLLSDILESSPQVKISHSVSQHLSHLAN 459          

HSP 2 Score: 64.3142 bits (155), Expect = 5.805e-56
Identity = 44/126 (34.92%), Postives = 71/126 (56.35%), Query Frame = -2
Query: 1790 STSKNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTSK-FAIKLDE*TFGRNSILML-YVRY-YSCSKEEIIEEFFC 2158
            S + + +  L+ASY +A  +A+     TI E L+LP   ++   ++ +     L+ +PLSN  V  RI  +A +IE QL+  +R S  F+++LDE T   N+ L+L +VRY +  S +E I   FC
Sbjct:   89 SLTGDAKCALKASYLVARRVAQSKKAFTIAEELVLPAAVDMCREMIGEAAAKKLKTIPLSNDIVSHRIADIASDIEQQLLERIRKSPFFSLQLDESTDVTNAALLLVFVRYRWDSSLQEDI--LFC 212          

HSP 3 Score: 41.5874 bits (96), Expect = 5.805e-56
Identity = 23/83 (27.71%), Postives = 43/83 (51.81%), Query Frame = -1
Query:  759 WIIDPFLCDLTRFDIS----VHEELITLKEDVQAQVLFNTHDYAKFWTIKVIREKYPHL*MNSKPLLLIFPSSYFVEACFSAI 995
            W++DPF  D T  D++    +  +L+ +  D   +  +   D   FW   V+ ++YP L + +  +LL F ++Y  E+ FS +
Sbjct:  475 WVVDPFSVDPTENDVALPSHLESQLLEVSTDSTLKGQWGKLDLGSFWI--VVSKEYPLLALRAFKVLLPFTTTYLCESGFSTV 555          

HSP 4 Score: 36.1946 bits (82), Expect = 5.805e-56
Identity = 22/59 (37.29%), Postives = 31/59 (52.54%), Query Frame = -3
Query: 2251 SKVKKKIRQYSEEYLKFGFVIAPVN*SIPL--CLICEKSFSNDYMKPSILKNHLNRMHA 2421
            S   K IR+Y+ + + FGFV      + P   C+ C  + SN+ +KPS LK HL   H 
Sbjct:    6 SSKAKFIRKYNPDLINFGFVNGGSE-AEPRAQCVECGLTLSNEALKPSKLKRHLETKHP 63          
BLAST of SMED30021434 vs. Ensembl Medaka
Match: ENSORLT00000035512.1 (pep primary_assembly:ASM223467v1:11:22712371:22714941:1 gene:ENSORLG00000026495.1 transcript:ENSORLT00000035512.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.079 bits (279), Expect = 1.404e-51
Identity = 97/409 (23.72%), Postives = 175/409 (42.79%), Query Frame = -3
Query:  631 FFVTSLLKRALKEKIFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLL---NFKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKLMQLSVIEKDCISSEDITLKTTHLKNLRGF*CPFSRYGKFMCPSLDH*SIPL*FN*V*YFGT*RTNYVEGGCPSSSII*HT*LCKILDHQSDS*KVPAFVN----------E*QTPIVN---FSVILFCRSLFQCNQ*FIK----KNKEQTQYY*KGDLRIKLSNFRPNIKEIAQGRQAHLSH 1797
             F   +  RA  E++F   +  L +  +  +N I   SDGA +M G  +G  A +K   P +   HC  HR+ L ++ +  EL  V++  +  +N IK + L +R+F+ +C++    +  +L H+E RWLS+G  L R  ++   +  F  +       +     NF   +  L+DI+G  N    +LQG++ ++      I +F  K+ ++   L+      F+ L +  V   D  ++  I     H+ +L GF   F +Y        D    P  FN                 P+ +        + +D  SDS     F +          E Q P++      ++L   + + C   F      K K ++Q   + +LR+ +S F+P  +++   ++AH SH
Sbjct:  226 LFCKYVRDRATAEELFKMLDCFLTENGLKWENCIGVCSDGAQTMAGMKKGLRALIKKASPNVEWTHCVIHREALASRKLSSELSEVMSDIVGVVNFIKTRPLKTRVFSAICEEMGAEHQAVLFHSEARWLSRGKVLSRVFELREQIRMFLEQEHKHEVAEKFSDENFLAKLAYLSDIFGKLNELNLQLQGKDKHLPQVTDKISSFTRKLAMWGRRLDEGNTDSFENLHEF-VATTDYDATSVIPHIKEHISSLIGF---FKKYFPENSSQYDWVRDP--FN----------------APAPTSFSSAEEDQFIDMTSDSTLRLRFTSQTLSEFWLNVERQYPLLGQRAMGILLPFATSYLCETGFSAVAALKTKYRSQLNIEQELRVAVSCFKPRFEKLCTAKRAHCSH 612          

HSP 2 Score: 83.5741 bits (205), Expect = 1.404e-51
Identity = 45/132 (34.09%), Postives = 81/132 (61.36%), Query Frame = -2
Query: 1832 FKNLKCNFLTRSNKVIKSFMKPSTSKNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTSKFAIKLDE*TFG-RNSILMLYVRY 2224
            F+  +  +  +S++ + +     TS N +  L ASYK+AY IA+   PHTI E L+LP   ++++ +L+      L+ +PLSN TV RRI+ +A +++ QL+ +L+  +FA++ DE T   ++ + + YVR+
Sbjct:   90 FQRKRAEYCQQSSRFVSA-----TSVN-QRALLASYKVAYQIAQCKKPHTIAEELILPAALDMVSVMLDDASAAKLKTVPLSNDTVARRINDIANDLKEQLVEKLKDKRFALQFDEATDSNKDCLFIAYVRF 215          

HSP 3 Score: 50.447 bits (119), Expect = 1.404e-51
Identity = 26/64 (40.62%), Postives = 38/64 (59.38%), Query Frame = -3
Query: 2245 MSKVKKKIRQYSEEYLKFGFVIAPV-N*SIPLCLICEKSFSNDYMKPSILKNHLNRM---HADK 2424
            +S  K K+R+Y E Y+  GF +  V +   P+CL+C K  + D MKP+ L+ HL  +   HADK
Sbjct:   22 VSLPKAKMRKYDEAYVALGFTVTTVGDEERPVCLLCLKMLAADSMKPNKLRRHLKTLHPNHADK 85          
BLAST of SMED30021434 vs. Ensembl Medaka
Match: ENSORLT00000040389.1 (pep primary_assembly:ASM223467v1:19:265767:268275:-1 gene:ENSORLG00000025045.1 transcript:ENSORLT00000040389.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 112.079 bits (279), Expect = 2.171e-51
Identity = 97/409 (23.72%), Postives = 175/409 (42.79%), Query Frame = -3
Query:  631 FFVTSLLKRALKEKIFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLL---NFKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKLMQLSVIEKDCISSEDITLKTTHLKNLRGF*CPFSRYGKFMCPSLDH*SIPL*FN*V*YFGT*RTNYVEGGCPSSSII*HT*LCKILDHQSDS*KVPAFVN----------E*QTPIVN---FSVILFCRSLFQCNQ*FIK----KNKEQTQYY*KGDLRIKLSNFRPNIKEIAQGRQAHLSH 1797
             F   +  RA  E++F   +  L +  +  +N I   SDGA +M G  +G  A +K   P +   HC  HR+ L ++ +  EL  V++  +  +N IK + L +R+F+ +C++    +  +L H+E RWLS+G  L R  ++   +  F  +       +     NF   +  L+DI+G  N    +LQG++ ++      I +F  K+ ++   L+      F+ L +  V   D  ++  I     H+ +L GF   F +Y        D    P  FN                 P+ +        + +D  SDS     F +          E Q P++      ++L   + + C   F      K K ++Q   + +LR+ +S F+P  +++   ++AH SH
Sbjct:  226 LFCKYVRDRATAEELFKMLDCFLTENGLKWENCIGVCSDGAQTMAGMKKGLRALIKKASPNVEWTHCVIHREALASRKLSSELSEVMSDIVGVVNFIKTRPLKTRVFSAICEEMGAEHQAVLFHSEARWLSRGKVLSRVFELREQIRMFLEQEHKHEVAEKFSDENFLAKLAYLSDIFGKLNELNLQLQGKDKHLPQVTDKISSFTRKLAMWGRRLDEGNTDSFENLHEF-VATTDYDATSVIPHIKEHISSLIGF---FKKYFPENSSQYDWVRDP--FN----------------APAPTSFSSAEEDQFIDMTSDSTLRLRFTSQTLSEFWLNVERQYPLLGQRAMGILLPFATSYLCETGFSAVAALKTKYRSQLNIEQELRVAVSCFKPRFEKLCTAKRAHCSH 612          

HSP 2 Score: 83.5741 bits (205), Expect = 2.171e-51
Identity = 45/132 (34.09%), Postives = 81/132 (61.36%), Query Frame = -2
Query: 1832 FKNLKCNFLTRSNKVIKSFMKPSTSKNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTSKFAIKLDE*T-FGRNSILMLYVRY 2224
            F+  +  +  +S++ + +     TS N +  L ASYK+AY IA+   PHTI E L+LP   ++++ +L+      L+ +PLSN TV RRI+ +A +++ QL+ +L+  +FA++ DE T   ++ + + YVR+
Sbjct:   90 FQRKRAEYCQQSSRFVSA-----TSVN-QRALLASYKVAYQIAQCKKPHTIAEELILPAALDMVSVMLDDASAAKLKTVPLSNDTVARRINDIANDLKEQLVEKLKDKRFALQFDEATDSNKDCLFIAYVRF 215          

HSP 3 Score: 49.6766 bits (117), Expect = 2.171e-51
Identity = 26/64 (40.62%), Postives = 37/64 (57.81%), Query Frame = -3
Query: 2245 MSKVKKKIRQYSEEYLKFGFVIAPV-N*SIPLCLICEKSFSNDYMKPSILKNHLNRM---HADK 2424
            +S  K K R+Y E Y+  GF +  V +   P+CL+C K  + D MKP+ L+ HL  +   HADK
Sbjct:   22 VSLPKAKTRKYDEAYVALGFTVTTVGDEERPVCLLCLKMLAADSMKPNKLRRHLKTLHPNHADK 85          
BLAST of SMED30021434 vs. Ensembl Medaka
Match: ENSORLT00000028620.1 (pep primary_assembly:ASM223467v1:3:35179252:35181570:1 gene:ENSORLG00000028714.1 transcript:ENSORLT00000028620.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.887 bits (346), Expect = 2.209e-50
Identity = 73/211 (34.60%), Postives = 111/211 (52.61%), Query Frame = -3
Query: 1171 FFVTSLLKRALKEKIFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLN--FKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLF 1797
             F   L  RA  E+ F C +N   +  +  ++ +   SDGA SM G++RG +  + +  PE    HCF HR++L AK +  E H  +++ +K IN IK+ A+NSR FAQLC+  +  +  LL H+EVRWLS+G    R  ++   V  F  +  + +     N  F   +  L+DI+ L N     LQGRN NI      +  F+ K+ L+
Sbjct:  256 LFCGELPTRATAEECFRCMDNYFTENGLDWQSCVGVCSDGAASMTGRHRGVIKQILDLAPEAKWTHCFLHRENLAAKKMSPEFHEAMDVTVKTINFIKSNAVNSRCFAQLCEGMEADHVKLLYHSEVRWLSRGLVFTRIFELRKEVFSFLTDKKSPLAHHYTNATFIAKLAYLSDIFSLLNQLNISLQGRNSNIFFVADKVPAFQRKLSLW 466          

HSP 2 Score: 64.6994 bits (156), Expect = 2.209e-50
Identity = 45/126 (35.71%), Postives = 70/126 (55.56%), Query Frame = -2
Query: 1790 STSKNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTSK-FAIKLDE*TFGRNSILML-YVRY-YSCSKEEIIEEFFC 2158
            S + + +  L+ASY +A  +A      TI E L+LP   ++   ++ +     L+ +PLSN  V  RI  MA +IE QL+  +R S  F+++LDE T   N+ L+L +VRY +  S +E I   FC
Sbjct:  135 SLTGDAKCALKASYLVARRVALNKKAFTIAEELVLPAAVDMCREMIGEAAAKKLKTIPLSNDIVSHRIADMASDIEQQLLGRIRKSPFFSLQLDESTDVTNAALLLVFVRYRWDSSLQEDI--LFC 258          

HSP 3 Score: 39.6614 bits (91), Expect = 2.209e-50
Identity = 26/70 (37.14%), Postives = 38/70 (54.29%), Query Frame = -3
Query: 2230 FYSMSKVKKKIRQYSEEYLKFGFVIAPVN*SIPL--CLICEKSFSNDYMKPSILKNHLNRMHADKKYSNL 2433
            + S S   K IR+Y+ +++KFGFV      + P   C+ C  + SN+ +KPS LK HL     + KY  L
Sbjct:   48 YASPSSKAKFIRKYNPDFIKFGFVNGGSE-AEPRAQCVECGLTLSNEALKPSKLKRHL-----ETKYPKL 111          
BLAST of SMED30021434 vs. Ensembl Medaka
Match: ENSORLT00000032191.1 (pep primary_assembly:ASM223467v1:7:34400406:34401509:1 gene:ENSORLG00000024356.1 transcript:ENSORLT00000032191.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 2.297e-38
Identity = 54/132 (40.91%), Postives = 78/132 (59.09%), Query Frame = -2
Query: 1751 LEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQN-DRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTS--KFAIKLDE*TFGRN-SILMLYVRYYSCSKEEII-EEFFCDKSLETCTKGEDI 2131
            L ASY++AYLIAK G PHTI E L+ P   ++   +L        L  +PLSN T+  RI  M+ +I  Q++ +L +S  KF+++LDE T   N S L ++VRY    K+++I EEF   K L T +K  D+
Sbjct:   95 LTASYEVAYLIAKQGEPHTIGETLVKPAALKMANLILGTTAAEGKLSQIPLSNDTISDRIGDMSNDILAQVVADLISSPAKFSLQLDETTDVANLSQLAVFVRYV---KDDMIKEEFLFCKPLTTTSKAADV 223          

HSP 2 Score: 72.4034 bits (176), Expect = 2.297e-38
Identity = 37/126 (29.37%), Postives = 62/126 (49.21%), Query Frame = -3
Query: 1309 SDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLN 1686
            +DGAP M+G+  GF A +    P I   HC  HR  L  K +  ++  VL   ++ +  ++   L  R+F++LC +    +  L+ H+ VRWLS+ SC        +  +   F    T++ +LL 
Sbjct:  246 TDGAPVMLGRKSGFGALVNAGAPHIVVTHCILHRHALATKTLPPKMAEVLKTVVECVIYVRNSTLRHRIFSELCKEMGAEFEVLMYHSNVRWLSQ-SCF-----CLACGISLVFGRAPTLSCRLLQ 365          

HSP 3 Score: 50.447 bits (119), Expect = 2.297e-38
Identity = 23/63 (36.51%), Postives = 40/63 (63.49%), Query Frame = -3
Query: 2233 VKKKIRQYSEEYLKFGF-VIAPVN*SI-PLCLICEKSFSNDYMKPSILKNHLNRMHADKKYSN 2415
            +  K R++S+EY+++GF  I  ++ S  P+C+IC    SN  + P+ LK H+ ++H D +Y N
Sbjct:    1 MSSKKRKWSDEYVQYGFSCITELDGSQRPICMICNAKLSNSNLAPAKLKEHIEKLHGDGEYKN 63          
BLAST of SMED30021434 vs. Planmine SMEST
Match: SMESG000077232.1 (SMESG000077232.1)

HSP 1 Score: 444.506 bits (1142), Expect = 1.691e-141
Identity = 216/254 (85.04%), Postives = 229/254 (90.16%), Query Frame = -3
Query: 1045 SRSFFVTSLLKRALKEKIFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLNFKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKLMQLSVIEKDCISSEDITLKTTHLKNLR 1806
             R+  + SL      E IFYCFENILKQYDIPIKNIIAASSDGAP++VGKYRGFLAYLKNEVPEIW VHCF HRQHL+AKNIHEEL+N+LNLCIKAINSI+AKALNSRLFAQLCDQNDEVYNNLLLHTE RWLSK +CLQRFIDIFSSVVEFF ENDNTM  QLLNFKTHIF LADIYGLFNATQNKL GRNIN+IDAKTIIF+FRSKIDLFISTLNRKEFRYF  LMQ+SVIEKDCISSEDITL T  LKNL+
Sbjct:  187 GRNSILMSLKTYTKGEDIFYCFENILKQYDIPIKNIIAASSDGAPTIVGKYRGFLAYLKNEVPEIWKVHCFLHRQHLVAKNIHEELYNILNLCIKAINSIRAKALNSRLFAQLCDQNDEVYNNLLLHTEGRWLSKSNCLQRFIDIFSSVVEFFLENDNTMAMQLLNFKTHIFYLADIYGLFNATQNKLLGRNINLIDAKTIIFSFRSKIDLFISTLNRKEFRYFGNLMQISVIEKDCISSEDITLYTNRLKNLK 440          

HSP 2 Score: 224.942 bits (572), Expect = 1.408e-85
Identity = 121/159 (76.10%), Postives = 129/159 (81.13%), Query Frame = -2
Query: 1748 FKNLKCNFLTRSNKVIKSFMKPSTSKNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTSKFAIKLDE*TFGRNSILMLYVRYYSCSKEEIIEEFFCDKSLETCTKGEDIL 2224
            FKNLK NFLTRSNKVIKSFMKPSTSKNV GGL+ASYKIAYLIAKGG PHTI ENLLLPVISEVITTVLNQND+PVLQ+LPL NSTVQ+RID+MAENIELQLITELRTSKFAI+L + TFGRNSILM                     SL+T TKGEDI 
Sbjct:   68 FKNLKSNFLTRSNKVIKSFMKPSTSKNVLGGLKASYKIAYLIAKGGCPHTIGENLLLPVISEVITTVLNQNDKPVLQSLPLLNSTVQQRIDEMAENIELQLITELRTSKFAIQLGKSTFGRNSILM---------------------SLKTYTKGEDIF 205          

HSP 3 Score: 113.62 bits (283), Expect = 1.408e-85
Identity = 54/66 (81.82%), Postives = 58/66 (87.88%), Query Frame = -3
Query: 2227 MSKVKKKIRQYSEEYLKFGFVIAPVN*SIPLCLICEKSFSNDYMKPSILKNHLNRMHADKKYSNLQ 2424
            MS  KKKI QYSEEY KFGFV+AP N S+PLCLICEKSFSNDYMKPS LK+HL+RMHADKK SNLQ
Sbjct:    1 MSTEKKKICQYSEEYSKFGFVVAPCNSSMPLCLICEKSFSNDYMKPSKLKDHLDRMHADKKDSNLQ 66          
BLAST of SMED30021434 vs. Planmine SMEST
Match: SMESG000029634.1 (SMESG000029634.1)

HSP 1 Score: 425.631 bits (1093), Expect = 8.716e-137
Identity = 214/250 (85.60%), Postives = 223/250 (89.20%), Query Frame = -3
Query: 1048 FFVTSLLKRALKEKIFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLNFKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKLMQLSVIEKDCISSEDITLKTTHLKNL 1797
            F V SL      E IF+CFENILKQYDIPIK I   SSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCF HRQHL+AKNIHEELHNVLNL IKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEV WLSKG+CLQRFIDIFS VVEFF ENDNTM  QLLNFKTHIF LADIYGLFNATQNKLQ RNIN++DAKTIIF+FRS I+LFISTLNRKEFRYF+ LMQLSVIEKDC SS+DI L TTHLKNL
Sbjct:   19 FCVKSLETYTKGENIFFCFENILKQYDIPIKKI-PPSSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFLHRQHLVAKNIHEELHNVLNLLIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVLWLSKGNCLQRFIDIFSLVVEFFLENDNTMAMQLLNFKTHIFYLADIYGLFNATQNKLQRRNINLVDAKTIIFSFRSNINLFISTLNRKEFRYFENLMQLSVIEKDCNSSQDIILYTTHLKNL 267          

HSP 2 Score: 72.0182 bits (175), Expect = 5.212e-13
Identity = 31/32 (96.88%), Postives = 32/32 (100.00%), Query Frame = -1
Query:  951 EDFNVRFRDMENLCVPAWIIDPFLCDLTRFDI 1046
            EDFNVRFRDMENLCVPAWII+PFLCDLTRFDI
Sbjct:  269 EDFNVRFRDMENLCVPAWIIEPFLCDLTRFDI 300          

HSP 3 Score: 62.3882 bits (150), Expect = 8.672e-10
Identity = 30/33 (90.91%), Postives = 31/33 (93.94%), Query Frame = -2
Query: 1751 MLYVRYYSCSKEEIIEEFFCDKSLETCTKGEDI 1849
            MLYVRYYSCSKEEIIEEFFC KSLET TKGE+I
Sbjct:    1 MLYVRYYSCSKEEIIEEFFCVKSLETYTKGENI 33          
BLAST of SMED30021434 vs. Planmine SMEST
Match: SMESG000063081.1 (SMESG000063081.1)

HSP 1 Score: 352.058 bits (902), Expect = 1.398e-108
Identity = 166/191 (86.91%), Postives = 179/191 (93.72%), Query Frame = -3
Query: 1183 IFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLNFKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSK 1755
            IFYCFENILKQYDIPI+NIIAASSDGAPSMV KYRGFLAYLKN+VPE+WTVHCF HRQHL+AKNIHEELHNVLNLCIKAINSI+ KALNSRLFAQLCDQNDEVYNNLLLHT+VR++SKG+CLQRFIDI  SVVEFF ENDNTM  QLLNFKTHIF LADIYGLFNATQ KLQGRNIN+IDA+T+IF+F  K
Sbjct:  206 IFYCFENILKQYDIPIQNIIAASSDGAPSMVAKYRGFLAYLKNKVPEMWTVHCFLHRQHLVAKNIHEELHNVLNLCIKAINSIRVKALNSRLFAQLCDQNDEVYNNLLLHTKVRFISKGNCLQRFIDILGSVVEFFLENDNTMAMQLLNFKTHIFYLADIYGLFNATQIKLQGRNINLIDAQTVIFSFDLK 396          

HSP 2 Score: 113.235 bits (282), Expect = 4.065e-26
Identity = 55/61 (90.16%), Postives = 55/61 (90.16%), Query Frame = -2
Query: 2042 FKNLKCNFLTRSNKVIKSFMKPSTSKNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVIS 2224
            FKNLKCNFLTRSNK  K FMKPSTSKNVEGGLEASYKIAY IAKGGY HTI ENLLLPVIS
Sbjct:  123 FKNLKCNFLTRSNKEFKFFMKPSTSKNVEGGLEASYKIAYFIAKGGYLHTIGENLLLPVIS 183          
BLAST of SMED30021434 vs. Planmine SMEST
Match: SMESG000010447.1 (SMESG000010447.1)

HSP 1 Score: 281.567 bits (719), Expect = 2.242e-100
Identity = 147/179 (82.12%), Postives = 154/179 (86.03%), Query Frame = -2
Query: 1676 FLTRSNKVIKSFMKPSTSKNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTSKFAIKLDE*TFGRNSILMLYVRYYSCSKEEIIEEFFCDKSLETCTKGEDILLF*KYFKAI*YSYK---KHYCRIF*WS 2203
            FLTRS KVIKSFMKPSTSKNVEGGLE SYKIAYLIAKGGYPHTI ENLLLPVISEVIT VLNQND+PVLQ+LPLSNSTVQRRID+MAENIELQL TELRT+KFAI+LDE TFGRN ILMLYVRYYSCSKEE+IEEFFC KSLET TKGEDI      F+ I   Y    KHYCR F WS
Sbjct:   68 FLTRSYKVIKSFMKPSTSKNVEGGLETSYKIAYLIAKGGYPHTIGENLLLPVISEVITNVLNQNDKPVLQSLPLSNSTVQRRIDEMAENIELQLNTELRTTKFAIQLDESTFGRNCILMLYVRYYSCSKEEMIEEFFCVKSLETYTKGEDIFYC---FENILKQYDIHIKHYCRFFCWS 243          

HSP 2 Score: 106.301 bits (264), Expect = 2.242e-100
Identity = 52/66 (78.79%), Postives = 57/66 (86.36%), Query Frame = -3
Query: 2227 MSKVKKKIRQYSEEYLKFGFVIAPVN*SIPLCLICEKSFSNDYMKPSILKNHLNRMHADKKYSNLQ 2424
            MS  KKKIRQ+SEEYLKFGFV+AP N S+ LCLIC+K FSNDYMK S LK+HLNRMHADKK SNLQ
Sbjct:    1 MSTEKKKIRQFSEEYLKFGFVVAPGNSSMSLCLICQKRFSNDYMKLSKLKDHLNRMHADKKDSNLQ 66          

HSP 3 Score: 85.1149 bits (209), Expect = 1.217e-17
Identity = 46/66 (69.70%), Postives = 47/66 (71.21%), Query Frame = -3
Query: 1603 FFVTSLLKRALKEKIFYCFENILKQYDIPIKNIIAA-SSDGAPSMVGKYRGFLAYLKNEVPEIWTV 1797
            F V SL      E IFYCFENILKQYDI IK+         APSMVGKYRGFLAYLKNEVPEIWTV
Sbjct:  204 FCVKSLETYTKGEDIFYCFENILKQYDIHIKHYCRFFCWSLAPSMVGKYRGFLAYLKNEVPEIWTV 269          
BLAST of SMED30021434 vs. Planmine SMEST
Match: SMESG000042414.1 (SMESG000042414.1)

HSP 1 Score: 288.115 bits (736), Expect = 8.069e-85
Identity = 143/157 (91.08%), Postives = 150/157 (95.54%), Query Frame = -2
Query: 1754 FKNLKCNFLTRSNKVIKSFMKPSTSKNVEGGLEASYKIAYLIAKGGYPHTIRENLLLPVISEVITTVLNQNDRPVLQNLPLSNSTVQRRIDKMAENIELQLITELRTSKFAIKLDE*TFGRNSILMLYVRYYSCSKEEIIEEFFCDKSLETCTKGED 2224
            FKNLKCNFLTRSNKVIKSFMKPSTSK+VEGGLEASYKIAYLIAKGGY HTI ENLLLPVISE+ITTVLNQND+P+LQ+LPLSNSTVQRRI +MAENIELQLITELRTSKFAI+LDE TF RNSILMLYVRYYSCSKEEIIEEFFC KSLET TKGED
Sbjct:   25 FKNLKCNFLTRSNKVIKSFMKPSTSKDVEGGLEASYKIAYLIAKGGYMHTIGENLLLPVISEIITTVLNQNDKPILQSLPLSNSTVQRRIGEMAENIELQLITELRTSKFAIQLDESTFDRNSILMLYVRYYSCSKEEIIEEFFCAKSLETYTKGED 181          

HSP 2 Score: 253.832 bits (647), Expect = 4.662e-73
Identity = 174/414 (42.03%), Postives = 213/414 (51.45%), Query Frame = -3
Query:  631 FFVTSLLKRALKEKIFYCFENILKQYDIPIKNIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKAINSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIFSSVVEFFFENDNTMTTQLLNFKTHIF*LADIYGLFNATQNKLQGRNINIIDAKTIIFNFRSKIDLFISTLNRKEFRYFDKLMQLSVIEKDCISS--------------EDITLKTTHLKNL-------RGF*CPFSRYGKFMCPSL----DH*SIPL*FN*V*YFGT*RTNYVEGGCPSSSII*HT*LCKILDHQSDS*KVPAFVNE*QTPIVNFSVILFCRSLFQCNQ*FIKKNKEQTQYY*KGDLRIKLSNFRPNIKEIAQGRQAHLSH 1797
            F   SL      E  FYCFENILKQYDIPI+NIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCF H Q+L+AKNIHE+LHNVLNLCIKAINSI+AKALNSRL                    V  + K + +  FI  ++  ++       T+ + LL F  H                                  FRSKIDLFISTLNRKEFRYFD LM LSVIEKDCISS              ED  ++   ++NL         F C  +R+   +   L    +     + FN              G   SS+I       K++  ++     P      +  ++ F    F  + F      ++K + +     +GDLRIKLSN++PNIKEIAQ  QAHLSH
Sbjct:  168 FCAKSLETYTKGEDTFYCFENILKQYDIPIENIIAASSDGAPSMVGKYRGFLAYLKNEVPEIWTVHCFLHIQYLVAKNIHEKLHNVLNLCIKAINSIRAKALNSRLLPNC----------------VTKMMKCTTICFFIRKYAGSLK------ATVCSDLLIFLVH----------------------------------FRSKIDLFISTLNRKEFRYFDNLMHLSVIEKDCISSEDITLYTTHLKNLKEDFNVRYRDMENLCVPARIIEPFLCDLTRFDISVQEELITLKEGVQAQVLFN------------TYGYAKSSTI-------KVIREKN-----PHLQMNSEPLLLTFPSSYFVEAGFSAINNLLRKTRNKLNIIERGDLRIKLSNYKPNIKEIAQEHQAHLSH 501          

HSP 3 Score: 168.318 bits (425), Expect = 8.647e-44
Identity = 82/96 (85.42%), Postives = 86/96 (89.58%), Query Frame = -1
Query:  759 EDFNVRFRDMENLCVPAWIIDPFLCDLTRFDISVHEELITLKEDVQAQVLFNTHDYAKFWTIKVIREKYPHL*MNSKPLLLIFPSSYFVEACFSAI 1046
            EDFNVR+RDMENLCVPA II+PFLCDLTRFDISV EELITLKE VQAQVLFNT+ YAK  TIKVIREK PHL MNS+PLLL FPSSYFVEA FSAI
Sbjct:  363 EDFNVRYRDMENLCVPARIIEPFLCDLTRFDISVQEELITLKEGVQAQVLFNTYGYAKSSTIKVIREKNPHLQMNSEPLLLTFPSSYFVEAGFSAI 458          

HSP 4 Score: 78.5666 bits (192), Expect = 1.797e-14
Identity = 36/43 (83.72%), Postives = 36/43 (83.72%), Query Frame = -1
Query: 1353 FLPNCVTKMMKCTTICFFIPKYAGSLKAAVCSDLLIFLAQLLS 1481
             LPNCVTKMMKCTTICFFI KYAGSLKA VCSDLLIFL    S
Sbjct:  273 LLPNCVTKMMKCTTICFFIRKYAGSLKATVCSDLLIFLVHFRS 315          
The following BLAST results are available for this feature:
BLAST of SMED30021434 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZBED84.042e-5128.51zinc finger BED-type containing 8 [Source:HGNC Sym... [more]
ZBED84.042e-5128.51zinc finger BED-type containing 8 [Source:HGNC Sym... [more]
FAM200B2.479e-4530.81family with sequence similarity 200 member B [Sour... [more]
FAM200B2.479e-4530.81family with sequence similarity 200 member B [Sour... [more]
FAM200A1.290e-4032.47family with sequence similarity 200 member A [Sour... [more]
back to top
BLAST of SMED30021434 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021434 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021434 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CR392001.32.864e-2730.57pep chromosome:GRCz11:8:38963323:38965260:-1 gene:... [more]
AL928808.14.225e-2528.17pep chromosome:GRCz11:20:17257101:17259573:-1 gene... [more]
back to top
BLAST of SMED30021434 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
spag11.023e-1729.59sperm associated antigen 1 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000016563.11.167e-1729.59pep primary_assembly:Xenopus_tropicalis_v9.1:4:373... [more]
back to top
BLAST of SMED30021434 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Zbed56.899e-4832.73zinc finger, BED type containing 5 [Source:MGI Sym... [more]
Zmym64.989e-3327.03zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Zmym65.360e-3327.03zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Gtf2ird27.979e-1324.89GTF2I repeat domain containing 2 [Source:MGI Symbo... [more]
back to top
BLAST of SMED30021434 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8IZ13|ZBED8_HUMAN1.793e-5028.51Protein ZBED8 OS=Homo sapiens OX=9606 GN=ZBED8 PE=... [more]
sp|P0CF97|F200B_HUMAN1.099e-4430.81Protein FAM200B OS=Homo sapiens OX=9606 GN=FAM200B... [more]
sp|Q4R6P1|F200A_MACFA1.033e-4033.33Protein FAM200A OS=Macaca fascicularis OX=9541 GN=... [more]
sp|Q8TCP9|F200A_HUMAN5.719e-4032.47Protein FAM200A OS=Homo sapiens OX=9606 GN=FAM200A... [more]
sp|Q6R2W3|SCND3_HUMAN4.191e-2836.79SCAN domain-containing protein 3 OS=Homo sapiens O... [more]
back to top
BLAST of SMED30021434 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5S6QHK77.724e-10839.24Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A5S6QR644.613e-10746.19Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A5S6Q2S05.876e-10338.27Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A4Y2IR382.593e-10243.59SCAN domain-containing protein 3 OS=Araneus ventri... [more]
G1KVP86.705e-10046.88Uncharacterized protein OS=Anolis carolinensis OX=... [more]
back to top
BLAST of SMED30021434 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000057314.13.130e-5335.19pep primary_assembly:Astyanax_mexicanus-2.0:1:4224... [more]
ENSAMXT00000051422.15.881e-5232.12pep primary_assembly:Astyanax_mexicanus-2.0:15:354... [more]
ENSAMXT00000039226.11.688e-3029.92pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000037725.18.121e-3027.88pep primary_assembly:Astyanax_mexicanus-2.0:14:291... [more]
ENSAMXT00000030525.19.198e-2929.86pep primary_assembly:Astyanax_mexicanus-2.0:1:1299... [more]
back to top
BLAST of SMED30021434 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021434 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30021434 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO432824.569e-821.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30021434 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000032459.15.805e-5632.27pep primary_assembly:ASM223467v1:8:14240678:142473... [more]
ENSORLT00000035512.11.404e-5123.72pep primary_assembly:ASM223467v1:11:22712371:22714... [more]
ENSORLT00000040389.12.171e-5123.72pep primary_assembly:ASM223467v1:19:265767:268275:... [more]
ENSORLT00000028620.12.209e-5034.60pep primary_assembly:ASM223467v1:3:35179252:351815... [more]
ENSORLT00000032191.12.297e-3840.91pep primary_assembly:ASM223467v1:7:34400406:344015... [more]
back to top
BLAST of SMED30021434 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077232.11.691e-14185.04SMESG000077232.1[more]
SMESG000029634.18.716e-13785.60SMESG000029634.1[more]
SMESG000063081.11.398e-10886.91SMESG000063081.1[more]
SMESG000010447.12.242e-10082.12SMESG000010447.1[more]
SMESG000042414.18.069e-8591.08SMESG000042414.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021434 ID=SMED30021434|Name=SMED30021434|organism=Schmidtea mediterranea sexual|type=transcript|length=4904bp
ATCATCATCATCATCATCAATGGTTATTTATCAATTAATCGTAAAAATTG
ACTATTTACTCTCGTTTGTATTATAATATTGTTGTATTAATTTCATTAAG
GTGTCTCATGTTGGGTGGGGGGGGGGTGGCCACTGATATGGCCAGTCTCG
AATCTGAATGAATACTAAGGGGCATTAAAAATTACTGAAGATCTAGCAAA
TATATTTATGTTTTATTTTAAATTGATTTTTTCTAAGGCAAATTTATCAG
CAAGTTAACTTATTAAAAATTGATATAAAGTTTTTCAATTTTATGAGATT
TACTGGAATAAAATATTTGATATTATTATCGTTGTCTTCGACTTTCAAAA
CTAGTTTATCTTCCGATGAAAACCTAAATCTTAAAAGGAAGTCTTGAATA
TCATTTTTTATCAATTCTGTTAGGTAAATTCTTGTCCATTTTATTAGGAA
TAGCCATTTATTGGTTATTAAATTAAAATCCTTTTACTGTGCATTTGGAC
AACAATTTTATTTAAAGTTCTTTTTTATGTAAATGTTTTCATCCTTCTTG
GTTATGTCTGTTTTACAAACCTGTAAAAATTTTACGCATGGTTCATAATT
ACATTAATATTTTACAAAATTGTAATATTAGTGTGATAGATGGGCTTGAC
GTCCTTGTGCGATTTCCTTTATGTTTGGCCTAAAATTACTAAGTTTTATT
CTTAAATCTCCCTTTCAATAATATTGAGTTTGTTCCTTGTTTTTCTTAAT
AAATTATTGATTGCACTGAAACAAGCTTCTACAAAATAAGATGACGGAAA
AATTAACAATAGGGGTTTGCTATTCATTTACAAATGCGGGTACTTTTCAC
GAATCACTTTGATGGTCCAAAATTTTGCATAATCATGTGTGTTAAATAAT
ACTTGAGCTTGGACATCCTCCTTCAACGTAATTAGTTCTTCATGTACCGA
AATATCAAACCTAGTTAAATCACAGAGGAATGGATCAATGATCCAAGCTG
GGACACATAAATTTTCCATATCGCGAAAACGGACATTAAAATCCTCTTAA
ATTTTTTAAATGGGTTGTTTTTAATGTTATATCTTCAGAAGAAATGCAAT
CTTTTTCAATTACAGATAACTGCATTAATTTATCGAAATAACGGAATTCT
TTTCGATTTAGAGTAGATATGAACAAGTCGATTTTAGATCGAAAATTGAA
GATAATCGTTTTTGCATCTATGATATTAATGTTTCTCCCTTGTAATTTGT
TTTGTGTAGCATTGAATAATCCATAAATATCAGCCAATTAAAAAATGTGA
GTTTTGAAATTTAATAGTTGCGTAGTCATTGTATTGTCATTTTCAAAGAA
AAACTCAACAACTGAGCTAAAAATATCAATAAATCGCTGCAAACAGCTGC
CTTTAGAGAGCCAGCGTACTTCGGTATGAAGAAGCAAATTGTTGTACACT
TCATCATTTTGGTCACACAATTGGGCAAAAAGGCGGGAATTCAGTGCTTT
TGCTTTTATACTATTGATTGCTTTAATGCATAGATTTAAAACATTATGTA
GTTCTTCGTGAATATTCTTAGCTATTAAGTGCTGTCTATGCCAGAAACAA
TGAACTGTCCAGATCTCGGGTACTTCGTTTTTGAGGTATGCTAAGAATCC
TCGATATTTTCCAACCATCGAAGGAGCTCCATCAGAAGATGCGGCAATAA
TGTTTTTTATAGGAATATCATATTGCTTTAAAATATTTTCAAAACAATAA
AATATCTTCTCCTTTAGTGCACGTTTCAAGAGACTTGTCACAAAAAAACT
CCTCGATTATTTCTTCCTTTGAACAACTATAATAGCGTACGTATAACATT
AAAATACTATTCCTGCCGAAAGTTTACTCGTCCAGCTTTATGGCAAATTT
ACTTGTTCTTAATTCTGTTATTAATTGCAGTTCTATATTTTCTGCCATTT
TATCTATTCGTCGTTGAACTGTGCTATTTGACAGCGGCAAATTTTGCAAG
ACAGGTCTGTCGTTTTGATTCAAAACAGTTGTTATTACTTCGCTAATAAC
TGGTAATAATAAATTCTCTCTTATCGTGTGCGGATATCCACCTTTGGCAA
TTAAGTAAGCAATTTTGTAGGAAGCTTCGAGGCCTCCTTCGACATTTTTT
GATGTTGAAGGTTTCATAAAAGATTTGATTACTTTATTTGAGCGTGTTAA
AAAGTTGCATTTTAGATTTTTGAAGTTTGTAAATTGCTGTATTTTTTATC
AGCATGCATTCTATTCAAATGATTTTTTAGTATGGAAGGTTTCATATAGT
CATTGCTGAAACTTTTTTCACAAATGAGGCATAAGGGTATTGATTAATTG
ACTGGAGCTATCACAAACCCAAACTTTAAATATTCCTCGGAATATTGACG
GATTTTTTTCTTTACTTTTGACATGCTGTAAAAAAATAAATTAAGTGGCA
AAAATAAATTAATTACAGGGCAAAACAAATTAATTAAATGACAAAAGAAA
ATTAAAGCTAAAATGAAGAAAAGAAACACTTACTTTTCTTTTAGAAGTCA
ACTTCAAAAACTAATCACAAAACTGATCACACACAAAATTAAAAAAAAAT
TAACCTAACTAATCAAATTTAACATAAGTTACTGTTCAATAATAAAAATT
GTTCAGTGAATAACACTCAGATTACATTAATAAACATGCTAGTATCATGT
TTTTGCTGGTTGAATGGGTTTGTGGTATGCCGGGGATTTTAATTTCGGGT
TTAAACTCTCATATCACAAAACATTGGACATATTTTATAAGTTATCAAAA
CATACTTTTTCATTACTCATGCTCATTTCCTCCCCAAATCTAGTTTATAT
TTACTTATTATTTTTATTACAATACGAATACCTTAATATTCATTTATAAA
TATTATTTTATTTATTATTAATAATAATATTATGTTCATTTTATTTATTT
ATTTTTATTATTTTAATTGGATAATGTCAAAGAGTAGACCTACGAATATA
TTTCGACTAAAATGATTGGAAAAAATCGAGCATCTTTACCAAGTTACTAC
AAATACTCTGGATTTTCATTTACCCAAAGAATGTGAAAGGATAAATCGGT
ACAATAATGTACACGAAATTATTGAAGTATGATTACATTACATCATTATG
GATTATGAAGAAATATTCGGAAATTCTTGGGTATTTGTGGGACTTCAAAT
CCAATGTTATTATAGCTAATTACTGATTGGGGAAAACATCACAATTTTTA
TGTGTAGTTATTAGGTTCGACATCCTGAAGATAACCAAATTTTTTATTAT
TAAATTTAAGGATCCTATTTTTTATTGAGTTTTAAACATTGTTTTTCTTA
ATAAAACAAAATTCTAATCTAAATAACTGACAATCCATGTGAAATGTATT
TAGAAAGTAACATTATAACCGAATTAGGAGAATATGATTTTTGATTATAG
TTAAGTTCACTTATGATTAGCGATTTCAATGAAAACTAATTGATAAGTAA
TTAATGGAAGGGTGATTTCTTCCTCAACTATTGTAACCCAAAATCGGTTG
CCGATGATATAAAATTTAATCCACTATTTGATTTAAGCAACAAGGAAGGG
GATTTAAGGCAAAATTGTATTACGTTTATTAGCCAGAATGTACTTAACAT
TACCACACAGTTAACCCCAGTTTTAGTTTAGTTTTAATTAAGTTAATTCA
TAAATACCTTCTTAATCTAGTCAGGTACCTTAAATTGGAGAGTCCGAAAA
ATGAATCAAATTACAAACAACGTGTTATAAATTAATGCAATAAAATGACC
ATACGTTTGAAAACCATACCAACAATCTTGAAATCTTTGGACACTGTCTT
AACTTCTCGACGGAAATATAGTGAATGGAAAATAATTTCTTCTTAGAGTT
TACATAGAATGCATAACAATTTTAAATCTAATCTCTTTTAGACGATTCGT
GGATTGATGAATCCCGGATCACAGTACGTTTTCCAGCGCATGCGGTAAAC
TTTTGCCGCCAGGCAATGTGGGATGCGGGATTTACCGTATCCCAAGTCAG
AGAGGCCAGAGACAATAGCCTACAACAAGCGGAAGATTTCGAGCTCCCGT
TCGTCACGATAAAGCGGGAGCCGGGTCGGAATCCTGCCAGGGAGATCCGT
TGCCAAGCTGAGTTTCTCCTCGCGCGTCTTGGGGAACATCAGCGACAGAC
CAATGAGCAAGTGGATTGTGCAAAACGCTACCTCGGCAATGTAAACAACG
ACATTGCCGCGGGCCGGATCGCCAGTACGGACGGGTACGCCCCGCCGGAC
AATACGTCGTACAATCTCGACGACGAAAGGTTAAACATCCGATCTACGGC
CATCAACGTGGTCGTTCCCCAGAAGATCCTTCCCCGACATATGAGAAGGA
CTGAGAAGCCAGCCGAAGAACATCGCGACCATCCTTACGCTCGGCCGACC
CCGGAACGGGATGTCTATAAGCATCGCCGGAATCATCATAATGACTAATT
GCTGACAATTGAACATTCTAACTGATTACGAGTTTGAAATAAAATGTCTT
AGTTGAACTCGAGTACTTGTTTGTTTAAAATTATTAACAATAACGCCTGT
AGAACCCCATAATTAATTATTATAGTACTTAGATAAATTGAAACGAATTA
ATCTGATTTAATCACACCCTTTATAGATATGGAGCCACTGAGAGTTCTAC
AACAAGAGTTAGATCACGCGCGCAGAATCAACAAAAAGTTTTACGAACAA
ATCTTACAGCTTACAAAGGAGATACAGCAAATTAAAGCCACTTGGCTAGA
GTCGAAGAAGGTGAAAACTCTCTACCAGAAGATAACAGCGGCACAAAAGG
GCTGGTCGGAGGAGAAATAGATCAACCAGGGCCTGAAAACTCAAATAAGA
GGTC
back to top

protein sequence of SMED30021434-orf-1

>SMED30021434-orf-1 ID=SMED30021434-orf-1|Name=SMED30021434-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=161bp
MWDAGFTVSQVREARDNSLQQAEDFELPFVTIKREPGRNPAREIRCQAEF
LLARLGEHQRQTNEQVDCAKRYLGNVNNDIAAGRIASTDGYAPPDNTSYN
LDDERLNIRSTAINVVVPQKILPRHMRRTEKPAEEHRDHPYARPTPERDV
YKHRRNHHND*
back to top

protein sequence of SMED30021434-orf-2

>SMED30021434-orf-2 ID=SMED30021434-orf-2|Name=SMED30021434-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=127bp
MVGKYRGFLAYLKNEVPEIWTVHCFWHRQHLIAKNIHEELHNVLNLCIKA
INSIKAKALNSRLFAQLCDQNDEVYNNLLLHTEVRWLSKGSCLQRFIDIF
SSVVEFFFENDNTMTTQLLNFKTHIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR003656Znf_BED
IPR012337RNaseH-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003676nucleic acid binding