Neurogenic locus notch-like protein protein 1

Overview
NameNeurogenic locus notch-like protein protein 1
Smed IDSMED30021405
Length (bp)14096
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neurogenic locus notch-like protein protein 1 (SMED30021405) t-SNE clustered cells

Violin plots show distribution of expression levels for Neurogenic locus notch-like protein protein 1 (SMED30021405) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neurogenic locus notch-like protein protein 1 (SMED30021405) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neurogenic locus notch-like protein protein 1 (SMED30021405) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021405

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30021405SMESG000041513.1 Contig7665newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30021405SMESG000041513.1 Contig7665newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
secretory cellSMED30021405SMESG000041513.1 Contig7665newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30021405SMESG000041513.1 Contig7665newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30021405SMESG000041513.1 Contig7665uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30021405SMESG000041513.1 Contig7665uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
secretory cellSMED30021405SMESG000041513.1 Contig7665uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30021405SMESG000041513.1 Contig7665uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30021405SMESG000041513.1 SmedASXL_012027SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
muscle cellSMED30021405SMESG000041513.1 dd_Smed_v4_6736_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021405SMESG000041513.1 dd_Smed_v4_6736_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30021405SMESG000041513.1 dd_Smed_v4_6736_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30021405SMESG000041513.1 dd_Smed_v6_6736_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021405SMESG000041513.1 dd_Smed_v6_6736_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
oocyteSMED30021405SMESG000041513.1 Contig8113uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30021405SMESG000041513.1 Contig8113uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30021405SMESG000041513.1 Contig8113newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30021405SMESG000041513.1 Contig8113newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neurogenic locus notch-like protein protein 1 vs. Ensembl Human
Match: TNXB (tenascin XB [Source:HGNC Symbol;Acc:HGNC:11976])

HSP 1 Score: 124.405 bits (311), Expect = 2.498e-27
Identity = 194/719 (26.98%), Postives = 279/719 (38.80%), Query Frame = 3
Query: 3888 CTCKRGYVKDGNNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGD--GINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSI------CDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNP--LKHC-FDCRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPH----NNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNP--LQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICLPGFTGD--GTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKC---QPIVHECRPGCGENAKCVNGKCECLPGLQGN--PMQHCFDCKKCHKFADCDVWNKKCVCKNGYFGN--GYMCTPINGCNLKCNENALCVNQKCICLPGFIGDGIKFCFDCSACP---ANSNCVPEKKECKCAKDYFMNEKI 5957
            C C  GY   G +C   S  C  +C    +C+ G C C AG  G    Q    + CSQ   C+    RCVC  GY G+      + +C   C   G CEN  C C PG  G+  G+  C     C     C+  + RCVC  G+T  G+ C      +C   C +  +CV G+C C PG  G+      DCS       C     C  +  +C+C+ GY GD   C + S  C   C+   +C + +C                        +C+P      C S               C   C     C NG C C +G  G    ++ C  DCR          E+ RC+C  G+   GR+C   + C   C     C++  CVC P + G+      +C S     DC  H    +  C C  G++G     +     C   C    +C++G+C C  G  G    ++ C N   C +   C   +  C+C  GY+       S+  C + C     C    C+C PG+TG    TR C   + C     C+  +  C+C  GY   G  C   +P    C  GCG    C  G+C C+ G +G    +Q C     C    +C   +  CVCK+GY G   G     I G  +   E    V  +    PG + D  +  F  +A P   + S   P K E + +  +   + +
Sbjct:  202 CVCFPGYT--GPSCGWPS--CPGDCQGRGRCVQGVCVCRAGFSGPDCSQRSCPRGCSQRGRCE--GGRCVCDPGYTGDD---CGMRSCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSCP--RGCSQRGRCK--DGRCVCDPGYT--GEDCGTR---SCPWDCGEGGRCVDGRCVCWPGYTGE------DCSTRTCPRDCRGRGRC--EDGECICDTGYSGD--DCGVRS--CPGDCNQRGRCEDGRC------------------------VCWPGYTGTDCGSR-------------ACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCR-----GRGRCESGRCMCWPGYT--GRDC-GTRACPGDCRGRGRCVDGRCVCNPGFTGE------DCGSRRCPGDCRGHGLCEDGVCVCDAGYSGE----DCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVCQ--DGVCICWEGYVSED---CSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCP--ADCRGRGRCV--QGVCLCHVGY--GGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCP--GDCRGRGECH--DGSCVCKDGYAGEDCGEEVPTIEGMRMHLLEETT-VRTEWTPAPGPV-DAYEIQFIPTASPLLCSASPHSPAKAEAEISTSWRNQDSL 816          

HSP 2 Score: 120.939 bits (302), Expect = 2.499e-26
Identity = 160/572 (27.97%), Postives = 224/572 (39.16%), Query Frame = 3
Query: 4161 CHVNGFCENQECKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGD--GVQSCFDCSICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNP--LKHCFDCRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGD--GINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICLPGFTGD--GTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCVCKNGYFGN--GYMCTPINGCNLKCNENALCVNQKCICLPGFIG 5846
            C+  G C    C C PG  G    +      C     C      CVC  GF+G    CS     +C R C ++ +C  G+C C PG  GD  G++SC     C     C  +  +CVCNPGY G+   C + S  C   C    +C + +C C+    G+          C     C      C C   + G+   C+ R   C   C     C +G+C C +G  G+   ++ C     C+    C  E+ RC+C  G+ G   +C   + C   C     C N  CVC   Y G+  G+  C     C     CE  + RC C+ G+TG      A    C   C    +CV+G+C C PG  G           C     C+  +  CVC  GY G      S   C   C     C++  C+C  G++G+  G R C +   C ++  C  ++  CIC EGY+         +  C   C    +C  G+C C PG  G           C     C      C+C  GY G   G    P + C   C    LC   +C+C+ GF G
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRC--VQGVCVCRAGFSG--PDCSQR---SCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCP--RGCSQRGRC--ENGRCVCNPGYTGE--DCGVRS--CPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCV--DGRCVCWPGYTGE--DCSTR--TCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPG--DCNQRGRC--EDGRCVCWPGYTGT--DCGS-RACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPG--DCRGRGRCE--SGRCMCWPGYTGRDCGTRA----CPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCE--DGVCVCDAGYSGED---CSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVC--QDGVCICWEGYVSEDCS----IRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRC--VQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRG 711          

HSP 3 Score: 116.701 bits (291), Expect = 5.153e-25
Identity = 166/580 (28.62%), Postives = 236/580 (40.69%), Query Frame = 3
Query: 4776 CGENAICVNGQCQCQSGLQGNPLKHCFDCRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGD--GINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICLPGFTGD--GTRFC-----------------------FDCS--SCPKNSNCLP--EEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPGFIGD--GIKFCF-DCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIG-PESICPNXXXXXXXXXXXXXXXLQGFSGD--GIKTCFNCSSCSIEAICVPDQEKCICKAGFSGN--GEQCVENIEG 6398
            C     CV G C C++G  G         R C     C  E  RC+C  G+ GD  +C  ++ C   C +   C N  CVC P Y G+  G+  C     C +   C+  + RC C  G+TG     +     C   CGE  +CV+G+C C PG  G         + C     C+  + +C+C  GY G+      V  C   C+    C +  C+C PG+TG   G+R C                        DC   SCP +       E  +C+C  GY       +    +CR       +CV+G+C C PG  G           C     C+  +  CVC  GY  +G  C+    C   C     C++ +C+C  G+ G+  G++ C  DCS      + V +   C C + Y   +  CS I+    C S CH   +C +G C C PG+ G         + C     C   Q  C+C   Y   GE+C +   P S CP  C  +  C   +C C++GF G    I+TC     C     C      C+CK G++G   GE+ V  IEG
Sbjct:  222 CQGRGRCVQGVCVCRAGFSGPDCSQRSCPRGCSQRGRC--EGGRCVCDPGYTGD--DCG-MRSCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSCPR--GCSQRGRCK--DGRCVCDPGYTGE----DCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCE--DGECICDTGYSGDD---CGVRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGDCR----GRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCE--DGVCVCDAGY--SGEDCS-TRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCS-----QHGVCQDGVCICWEGYVSED--CS-IR---TCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCV--QGVCLCHVGY--GGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPG--DCRGRGEC--HDGSCVCKDGYAGEDCGEE-VPTIEG 754          

HSP 4 Score: 114.005 bits (284), Expect = 4.104e-24
Identity = 172/650 (26.46%), Postives = 244/650 (37.54%), Query Frame = 3
Query: 2253 CNTEADCSPYENRCYCRPGYTGNGFTCIKSCDKICHKDALCQNSRCICKPNFEGDGVNYCFDCSK------CHKLAQCHPKTGNCTCRPPYVGD--GVSECETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNP--LEKCNIDCSKCHTDSDCDKTNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGDGVETCFHCSQCDSNAICDQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGN--GVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGNCKCNNNLIGD--GISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEEKCECMERFEGDGFTCQD--KVDCSSRCGENAFCYNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGDGTTYCFNCSSCARNSDCKPE----QQTCTCKRGYVKDGNNCS---IISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNE----RCVCQSGYIGN 4121
            CN +  C     RC C PGYTG       SC   C     C    C+C+  F G       DCS+      C +  +C  + G C C P Y GD  G+  C    P+G     C+    C     C C   Y G    +  C   CS+     D     G C C  G+ G+   C    C   C E  +CVDG+C+C PG++G+   T      C     C+     CIC +G+ G+        +C   C+++ RC  G+C+C  G  G   G   C     C    +C      C CN+G+ G+    +  P     C  +  C +G C C     G   G  +C     C    RC   + RC+C PG+ G      + C   C    +C++G C C  G +G+  +       C    +CL     CE       DG++ +D     C + C ++  C +G C C  G+                                 D   RT C  +CH   +C +GRC C     G        C++    +DC+      Q  C C  GY   G +C      ++ C   CG    C  G+C C+ G +G       DC   +   DC    E     CVC+ GY G 
Sbjct:  191 CNDQGRC--VRGRCVCFPGYTGPSCG-WPSCPGDCQGRGRCVQGVCVCRAGFSGP------DCSQRSCPRGCSQRGRC--EGGRCVCDPGYTGDDCGMRSC----PRG-----CSQRGRCE-NGRCVCNPGYTGEDCGVRSCPRGCSQRGRCKD-----GRCVCDPGYTGE--DCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCEDGE--CICDTGYSGDDCG---VRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRACPR--DCRGRGRC--ENGVCVCNAGYSGEDCGVRSCPG---DCRGRGRCESGRCMCWPGYTGRDCGTRACP--GDCRGRGRC--VDGRCVCNPGFTGEDCG-SRRCPGDCRGHGLCEDGVCVCDAGYSGEDCSTRSCPGGCRGRGQCLDGRCVCE-------DGYSGEDCGVRQCPNDCSQHGVCQDGVCICWEGY------------------------------VSEDCSIRT-CPSNCHGRGRCEEGRCLCDPGYTGP------TCATRMCPADCRGRGRCVQGVCLCHVGY--GGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGP------DCAIQTCPGDCRGRGECHDGSCVCKDGYAGE 743          

HSP 5 Score: 113.62 bits (283), Expect = 4.357e-24
Identity = 157/601 (26.12%), Postives = 231/601 (38.44%), Query Frame = 3
Query: 1878 KCICSPGYSMINNICDKTYSNFKCVPPCHIDATCYENNMCICNSGHQGDGXXXXXXXXXXXXAECYPEISKCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGD--GINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKSCDKICHKDALCQNSRCICKPNFEGD--GVNYC-FDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDK----TNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGD--GVETCFHCSQCDSNAICDQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGN--GVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGNCKCNNNLIGD--GISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEEKCECMERFEGD--GFTCQDKVDCSSRCGENAFCYNGTCKCKLGFQG 3629
            +C+C PGY+        +     C   C     C +  +C+C +G  G                  P+ S+  C  G                 C +   C  G C C+    GD  G+ SC     C+    C     RC C PGYTG     ++SC + C +   C++ RC+C P + G+  G   C +DC +  +        G C C P Y G+   +C T      C   C     C  +  C C   Y G+       DC       DC++     +G C C  G+   G  C    C   C  + +C +G C+C  G+SG+  GV +C     C     C+     C+C  G+ G      RA  C   C  + RC+ G+C+CN G  G   G   C     C  +  C      C C++G+ G+    +  P     C  +  C++G C C +   G+  G+  C   + CS +  C   +  CIC  GY       ++TC  +CH    C+EG C C  G TG         + C    +C+  +  C C   + G+  G        C   CG    C  G C C  GF+G
Sbjct:  201 RCVCFPGYT------GPSCGWPSCPGDCQGRGRCVQ-GVCVCRAGFSG------------------PDCSQRSCPRG-----------------CSQRGRCEGGRCVCDPGYTGDDCGMRSCP--RGCSQRGRCE--NGRCVCNPGYTGEDCG-VRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVD-----GRCVCWPGYTGE---DCSTR----TCPRDCRGRGRCE-DGECICDTGYSGD-------DCGVRSCPGDCNQRGRCEDGRCVCWPGYT--GTDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCP--GDCRGRGRCESGR--CMCWPGYTGRDCG-TRA--CPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPG--DCRGHGLC--EDGVCVCDAGYSGEDCSTRSCPG---GCRGRGQCLDGRCVCEDGYSGEDCGVRQCP--NDCSQHGVC--QDGVCICWEGYVSEDCS-IRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCV--QGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRG 711          

HSP 6 Score: 107.071 bits (266), Expect = 5.575e-22
Identity = 164/621 (26.41%), Postives = 249/621 (40.10%), Query Frame = 3
Query: 5376 NKCDSNALCVNRHCICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNP--MQHCFDCKKCHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPGFIGD--GIKFC-FDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGD--GIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGD--GIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCSTCPPNSDC----LPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGD--GIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKG-DGFRCYPVILECP-KCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGD 7187
            + C+    CV   C+C PG+TG    +      C     C+  +  C+C+ G+  +G  C      C  GC +  +C  G+C C PG  G+   M+ C   + C +   C+  N +CVC  GY G       +  C   C++   C + +C+C PG+ G+  G + C +DC        CV     C C   Y   +  CS       C   C    +C  G C C  G+ GD  G++ C     C++   C     RCVC P Y+G   +C        CP  C  + +C+   C C  G+SG+  G+++C     C     C  +  +C+C  G++G    C          C      V+ +C+C PGF G+      DC +     DC    L ++  C+C   Y   D        T  C   C     C+  +C C  G+ G+  G++ C      D +   V +   C+C  G+       D    TC   C   G C   +C C+ G  G    +    + C    +C   V  C+C +GY G D  +  P    CP  C  R  C  G+C C  G +G          +C    +C  +   C C+ GY G+
Sbjct:  189 DDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV--QGVCVCRAGF--SGPDCS--QRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCP--RGCSQRGRCE--NGRCVCNPGYTGEDCG---VRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCG---EGGRCV--DGRCVCWPGYTGED--CS----TRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPG--DCNQRGRC--EDGRCVCWPGYTGT--DCGS----RACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPG--DCRGRGRC--ESGRCMCWPGYTGR--DC--GTRACPGDCRGRGRCVDGRCVCNPGFTGE------DCGSRRCPGDCRGHGLCEDGVCVCDAGYSGEDCS------TRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN----DCSQHGVCQDGVCICWEGYVSE----DCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGV--CLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRGRGEC--HDGSCVCKDGYAGE 743          

HSP 7 Score: 106.686 bits (265), Expect = 6.610e-22
Identity = 136/502 (27.09%), Postives = 199/502 (39.64%), Query Frame = 3
Query: 1878 KCICSPGYSMINNICDKTYSNFKCVPPCHIDATCYENNMCICNSGHQG-DGXXXXXXXXXXXXAECYPEISKCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGD--GINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKSCDKICHKDALCQNSRCICKPNFEGD--GVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDK----TNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGD--GVETCFHCSQCDSNAICDQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGD--GIQCKLLPLCTPACHPQASCINGNCKCNNNLIGD--GISSC-FDCDKCSMNARCDVSNQRCICQPGYEGN 3335
            +C+C+PGY+       +      C   C     C ++  C+C+ G+ G D         C     C     +C C PG+ G     R    C   C     C +G C C+    GD  G+ SC     CN    C   + RC C PGYTG      ++C + C     C+N  C+C   + G+  GV  C     C    +C  ++G C C P Y G    +C T    G+    C     C V+  C C   + G        DC       DC       +G C C  G+ G+   C+   C   C  + QC+DG+C+C+ G+SG+  GV  C +   C  + +C   +  CIC  G+     +      C   CH + RC  G+C+C+ G  G           C    +C+  Q  C C+ G+ G+  G +      C   C P+  C  G C C     G    I +C  DC       R +  +  C+C+ GY G 
Sbjct:  294 RCVCNPGYT------GEDCGVRSCPRGCSQRGRC-KDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCV--DGRCVCWPGYTGEDCSTR---TCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPG--DCNQRGRCE--DGRCVCWPGYTGTDCG-SRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCP--GDCRGRGRC--ESGRCMCWPGYTG---RDCGTRACPGD----CRGRGRC-VDGRCVCNPGFTGE-------DCGSRRCPGDCRGHGLCEDGVCVCDAGYSGE--DCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVC--QDGVCICWEGYVSEDCS---IRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCV--QGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDC-----RGRGECHDGSCVCKDGYAGE 743          

HSP 8 Score: 105.145 bits (261), Expect = 1.745e-21
Identity = 187/785 (23.82%), Postives = 271/785 (34.52%), Query Frame = 3
Query: 10209 CHKNAKCEGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGD--GIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQT-EDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNFAYCRQKVCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPINCYQPCHKNAYCNIGVCTCNPDYIGDGITS------CKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCDPNAVCVLGECICKVGFTGN--GLQCMPTSKCNPLSGCSDTNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVCEPSCHPKAACIIGSCICMKPLIGNGITEC--KLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVDCPTRKICVNSKCICPEQYTSSPDGKLCELPMIMVVPSKLDVPETKDVEVLCFFENGIGNVNYLSWRRI---SPLMTMNFIRQPASVKLIIQKA 12515
            C+   +C  G C C  G+ G          CG  +   D    CQ      + VCVC  GF      C    CP  C    +C+ G+CVC     GD  G+R+C +   C  R  C    C C PGY G     ++    C     C+D             +C C PG++ E+  C   +C   CG+  +C  G CVC  GY+    G  CS          CP     C   G  +   C+C  G+   S   C   +CP  C+    C    C C  G+ G       DC                          R+C P+D CR    C +   VC   Y    C  +               C   C     C  G+C C PG+      T   P DC                        CVC  GF  +   C    C   C  +  C  GVC C+  Y G+  ++      C+ +  CL+                   C C  GY  ++  C  ++C   C  + VC  G CIC  G+      ++  P S C+    C +               C+C PGY   +    C   +C   C  +  C+ G C+C    +G G  +C  + P   +    C  +   C+       +C+C  GF+  +    + Q C    DC  R  C +  C+C + Y     G+  E+P I  +   L     ++  V   +    G V+    + I   SPL+       PA  +  I  +
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGP--------SCGWPSCPGD----CQGRGRCVQGVCVCRAGFS--GPDCSQRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPR--GCSQRGRCENGRCVCNPGYTGEDCGVRSCPRGCSQRGRCKD------------GRCVCDPGYTGED--CGTRSCPWDCGEGGRCVDGRCVCWPGYT----GEDCS-------TRTCP---RDCRGRGRCEDGECICDTGY---SGDDCGVRSCPGDCNQRGRCEDGRCVCWPGYTG------TDCGS------------------------RAC-PRD-CRGRGRCENGVCVCNAGYSGEDCGVRS--------------CPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGDCRGRGRC--------------VDGRCVCNPGFTGED--CGSRRCPGDCRGHGLCEDGVCVCDAGYSGEDCSTRSCPGGCRGRGQCLDGR-----------------CVCEDGYSGED--CGVRQCPNDCSQHGVCQDGVCICWEGYVSEDCSIRTCP-SNCHGRGRCEEGR-------------CLCDPGYTGPT----CATRMCPADCRGRGRCVQGVCLCH---VGYGGEDCGQEEPPASACPGGCGPRE-LCRAG-----QCVCVEGFRGPD---CAIQTC--PGDCRGRGECHDGSCVCKDGYAGEDCGE--EVPTIEGMRMHL----LEETTVRTEWTPAPGPVDAYEIQFIPTASPLLCSASPHSPAKAEAEISTS 809          

HSP 9 Score: 105.145 bits (261), Expect = 2.178e-21
Identity = 170/637 (26.69%), Postives = 227/637 (35.64%), Query Frame = 3
Query: 8988 CVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDGIICRL-PDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGNGYSGCFDCSKCHANADCDESKGCT-----CKPGFEGNGCYCR--PEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNNCVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICITQTCYCVPGYFGD--GIKSCTSCSVCHKNAQCLPDRGCVCKSDFIGDGFNCR--PLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDGINCQRPFECGIDNPCKD--QFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGDGIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFP-GVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQLGVCVCKDGYS--------PSVNGL 10829
            CVC++ F  S   C   +C   C +   CE G C C  GY GD    R  P  C     C  EN  CV          C  G+  +                      C    C   C +   C  G C C P + G       DC       DC E   C      C PG+ G  C  R  P D C+    C D   IC                T  +   C +  CP  C++   C    CVC  GY+GT    +   +     DC     RCE     N  CVC  G+  ++  C  + C   C     C +  C C PGY G   G ++C     C    +C+  R CVC   F G+    R  P D CR +  C D   +C    S ++               C  + C   C    +C  G C C  G+ G+        +CG+     D  Q  VCQ        VC+C  G+  ++  C    CP NCH   +C+ G+C+C     G    T    + C  R  C    C C  GY G       ED  Q +         C P  + +  +C C  GF   +  C+   C   C    +C  G CVCKDGY+        P++ G+
Sbjct:  233 CVCRAGF--SGPDCSQRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPRGCSQRGRC--ENGRCV----------CNPGYTGED---------------------CGVRSCPRGCSQRGRCKDGRCVCDPGYTGE------DCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRD-CRGRGRCEDGECIC---------------DTGYSGDDCGVRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRACPR-----DC-RGRGRCE-----NGVCVCNAGYSGED--CGVRSCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPG--DCRGRGRCVDGR-CVCNPGFTGEDCGSRRCPGD-CRGHGLCEDGVCVCDAGYSGED---------------CSTRSCPGGCRGRGQCLDGRCVCEDGYSGE--------DCGVRQCPNDCSQHGVCQDG------VCICWEGY--VSEDCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGG-------EDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPD--CAIQTCPGDCRGRGECHDGSCVCKDGYAGEDCGEEVPTIEGM 755          

HSP 10 Score: 103.99 bits (258), Expect = 4.607e-21
Identity = 143/563 (25.40%), Postives = 222/563 (39.43%), Query Frame = 3
Query: 1881 CICSPGYSMINNICDKTYSNFKCVPPCHIDATCYENNMCICNSGHQGDGXXXXXXXXX-XXXAECYPEISKCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGD--GINSC-FDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKSCDKICHKDALCQNSRCICKPNFEGD--GVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDC--SKCHTDSDCDKTNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGDGVETCFHCSQCDSNAICDQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGN--GVEYCFN-----------------------------CTSCHLNAKCIPRQNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGNCKCNNNLIGDG-------ISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGD 3431
            C+C  G+S  +       S   C   C     C E   C+C+ G+ GD     +C    ++   C  E  +C C PG+ G     R   +C   C +   C +G C C+    G+  G  SC +DC +     D      RC C PGYTG   +  ++C + C     C++  CIC   + GD  GV  C     C++  +C  + G C C P Y G   ++C +      C   C     C     C C   Y G   E C +      C     C+  +G C C  G+ G    C    C   C  + +CVDG+C+C PGF+G+   +      C  + +C+  +  C+C +G+ G   +     +C   C  + +CL G+C+C  G +G   GV  C N                              ++CH   +C   +  C C+ G+ G     ++ P     C  +  C+ G C C+    G+         S+C     C     C     +C+C  G+ G     ++TC   C     C +G+C C +G  G+
Sbjct:  233 CVCRAGFSGPD------CSQRSCPRGCSQRGRC-EGGRCVCDPGYTGDDCGMRSCPRGCSQRGRC--ENGRCVCNPGYTGEDCGVR---SCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVD-----GRCVCWPGYTGEDCS-TRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCP--GDCNQRGRC--EDGRCVCWPGYTG---TDCGSRA----CPRDCRGRGRCE-NGVCVCNAGYSG---EDCGVRSCPGDCRGRGRCE--SGRCMCWPGYTG--RDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCE--DGVCVCDAGYSGEDCS---TRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCSQHGVCQDGVCICWEGYVSEDCSIRTCPSNCHGRGRC--EEGRCLCDPGYTGPTCATRMCPA---DCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPG--GCGPRELCRAG--QCVCVEGFRGPDCA-IQTCPGDCRGRGECHDGSCVCKDGYAGE 743          

HSP 11 Score: 102.064 bits (253), Expect = 1.958e-20
Identity = 170/662 (25.68%), Postives = 240/662 (36.25%), Query Frame = 3
Query: 5787 CNENALCVNQKCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGD--GIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLP----QEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGD--GIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGD--GVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGD--GFRCYPVILECP-KCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKR-----------CDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGD 7700
            CN+   CV  +C+C PG+ G    +      C     CV  +  C C   +        P      C   C +  +C  G C C PG+ GD  G++ C     C +   C     RCVC P Y+  GE+C                                 G+++C     CS    C     +C+C  G++G  E C          C      V+ +C+C PG+ G+      DCST     DC      ++  CIC   Y  +D           C   C+    C   +C C PG+ G   G + C +   C     C  E   CVC  G+ G     D    +C   C   G C + +C C  G  G   G  +C     C    +C     +C+C  G+ G+  G R       CP  C     C  G C C  G  G+  +       C    QC     +C C  GY   G++C  + +C   C Q+ VC +  C C   Y     S     + C     C  +E  C+C  G+TG   TC      C  +C     C +  C+C  G  G+      DC +           C    +CR  +  CVC   FRG    CA+    TC  DC       +  C CK+G+ G+
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV--QGVCVCRAGFS------GPDCSQRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPR--GCSQRGRC--ENGRCVCNPGYT--GEDC---------------------------------GVRSCPR--GCSQRGRC--KDGRCVCDPGYTG--EDC--GTRSCPWDCGEGGRCVDGRCVCWPGYTGE------DCSTRTCPRDCRGRGRCEDGECICDTGYSGDDCG------VRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRACPR--DCRGRGRC--ENGVCVCNAGYSGE----DCGVRSCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPG--DCRGRGRCVDG--RCVCNPGFTGEDCGSR------RCPGDCRGHGLCEDGVCVCDAGYSGEDCSTRSCPGGCRGRGQCLDG--RCVCEDGY--SGEDC-GVRQCPNDCSQHGVCQDGVCICWEGYVSEDCSIRTCPSNCHGRGRC--EEGRCLCDPGYTG--PTCATR--MCPADCRGRGRCVQGVCLCHVGYGGE------DCGQEEPPASACPGGCGPRELCRAGQ--CVCVEGFRGP--DCAIQ---TCPGDCRGRGECHDGSCVCKDGYAGE 743          

HSP 12 Score: 98.2117 bits (243), Expect = 2.386e-19
Identity = 163/652 (25.00%), Postives = 226/652 (34.66%), Query Frame = 3
Query: 8157 CHPKAVCVKGKCICNRNLVGD--GYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGD--GMTTCTDCSGCDKNAICTEKQGCICKSGFIGDG-------RQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRI-EDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDGIICRL-PDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKS-----------EKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGNGYSGCFDCSK------CHANADCDESKGCTCKPGFEGNGCYCR--PEDKCKFNSDCNDPLKICVQ---SPDTS----------------RNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNNCVCKTGYSGTGLNCKPNDQCSQN----SDCPEPNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICITQTCYCVPGYFGD 9947
            C+ +  CV+G+C+C     G   G+    P +C     CVQ   VCR   S                   C + +C   C  +  C        RC+C PG+ GD  GM +C    GC +   C E   C+C  G+ G+        R C     C D                      +C C  G+   +  C   SC + C +   C+  +C C PG  G      T   +C  +  C D   C+C  GYSGD    R     C+    C D             RCVC   +  ++  C    C   C     CENGVC C  GY G+    R  P +C+    C+            S  C C  G+  +             +   V+ + +          C    C   C    LC  G C C   + G       DCS       C     C + + C C+ G+ G  C  R  P D C  +  C D + IC +   S D S                  C+C PG T  T   C    CP  C     C+   C+C  GY G        + C Q     S CP      E+ +    +CVC+ GF+  +  C+ + C   C     C   +C C  GY G+
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWP-SCPGDCQGRGRCVQGVCVCRAGFSGP----------------DCSQRSCPRGCSQRGRCEGG-----RCVCDPGYTGDDCGMRSCP--RGCSQRGRC-ENGRCVCNPGYTGEDCGVRSCPRGCSQRGRCKDG---------------------RCVCDPGYTGED--CGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCEDGE-CICDTGYSGDDCGVRSCPGDCNQRGRCED------------GRCVCWPGYTGTD--CGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCRGRGRCE------------SGRCMCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGED-CGSRRCPGDCRGHGLCEDGVCVCDAGYSGE------DCSTRSCPGGCRGRGQCLDGR-CVCEDGYSGEDCGVRQCPND-CSQHGVCQDGVCICWEGYVSEDCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPT---CATRMCPADCRGRGRCVQGVCLCHVGYGG--------EDCGQEEPPASACPGGCGPRELCR--AGQCVCVEGFRGPD--CAIQTCPGDCRGRGECHDGSCVCKDGYAGE 743          

HSP 13 Score: 95.9005 bits (237), Expect = 1.200e-18
Identity = 166/619 (26.82%), Postives = 239/619 (38.61%), Query Frame = 3
Query: 5586 CGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPGFIGD--GIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGD--GIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGD--GIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPK-CHSNALRVNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQ----RCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGD--GIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGD--GVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGFRCYPVILECPK-CHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGD--GKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGN 7388
            C +  +CV G+C C PG  G           C     C      CVC+ G+  +G  C+  + C   C++   C   +C+C PG+ GD  G++ C     C     C  E   C C   Y   +     ++    C   C +  +C  G C C PG+ G+  G + C     C +   C     RCVC P Y+G  E+C        CP  C  + +C+  +C C  G+SGD  G+++C     C+    C  +  +C+C  G++G      +    + P+ C       N  C+C  G+ G+      DC       DC  + +    RC+C   Y   D        T  C   C     CV  +C C PGF G+  G + C     C  +  C  E   CVC  G+ G     D    +C   C   G C + +C C  G  G+  GV  C N   C  +  C   V  CIC  GY  +       I  CP  CH R +C  G+C C  G  G      M  ++C    +C      C C  GY G+  G+       C   C    +C    C C+  + G   +       C     C   +  CVC  G+ G 
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRC--VQGVCVCRAGF--SGPDCSQRS-CPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCP--RGCSQRGRC--ENGRCVCNPGYTGED---CGVRS---CPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCP--WDCGEGGRCV--DGRCVCWPGYTG--EDCST----RTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPG--DCNQRGRC--EDGRCVCWPGYTG-----TDCGSRACPRDCRGRGRCENGVCVCNAGYSGE------DCGVRSCPGDCRGRGRCESGRCMCWPGYTGRDCG------TRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCP--GDCRGHGLC--EDGVCVCDAGYSGE----DCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVCQDGV--CICWEGYVSEDC----SIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGV--CLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRGRGECH--DGSCVCKDGYAGE 743          

HSP 14 Score: 95.5153 bits (236), Expect = 1.686e-18
Identity = 172/655 (26.26%), Postives = 246/655 (37.56%), Query Frame = 3
Query: 3267 CSMNARCDVSNQRCICQPGYEG--------------NGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDCSSR-----CGENAFCYNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCIC---ITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGD--GTTYC-FNCSSCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGD--GINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGD--GVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCFDCRPCHSFAVCDVENRRCICQSGFEGD--GRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGN 5138
            CS++   D+S   C C+PG+ G              +      +C   C+    C  G C C  G TG    +      C    +C+  +  C C   F G         DCS R     C +   C  G C C  G+ G+        R C     C+  N +C+C    T  D   R+ C   C    +C  GRC C     G+  GT  C ++C    R  D +     C C  GY   G +CS  +  C  +C    +C +G+C C  G  G+          C+Q   C+  + RCVC  GY G   T      C   C   G CEN  C C  G  G+  G+  C     C     CE  + RC+C  G+T  G+ C   A   C   C  + +CV G+C C PG  G+   S      C  + +C  +   CVC+ GY G+  +    ++ C   C    +C++ +C C +   G+  GV  C N   C    +C      C C   +V +   C++R   C   C     C  G+C C  G  G           C     C      C+C  G+ G+  G+       C   C    +C    CVC+  + G           C    +C  H+  C C  G+ G 
Sbjct:  143 CSLHGVFDLSRCTCSCEPGWGGPTCSDPTDAEIPPSSPPSASGSCPDDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV--QGVCVCRAGFSG--------PDCSQRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPRGCSQRGRCE--NGRCVCNPGYTGEDCGVRS-CPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGR-----CVCWPGYT--GEDCSTRT--CPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPGDCNQRGRCE--DGRCVCWPGYTG---TDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCP--GDCRGRGRCE--SGRCMCWPGYT--GRDCGTRA---CPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLC--EDGVCVCDAGYSGEDCS----TRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVC--QDGVCICWEGYVSE--DCSIR--TCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRC--VQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRGRGEC--HDGSCVCKDGYAGE 743          

HSP 15 Score: 95.5153 bits (236), Expect = 1.835e-18
Identity = 157/630 (24.92%), Postives = 234/630 (37.14%), Query Frame = 3
Query: 6621 CHHYASCVQDKCECLPGFIGDGIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGD--GVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGFRCYPVILECPK-CHYRAQCVIGKCQCKNGLQGD--GINFC-MNCSE----CDKNAQCFPNFS----------------------KCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGD--GKNYC-FDCKRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGDGFSFCFNCSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDC-RKCHEKATCNIRSMKCECLPGYIGNG-------FECISITSCTQS----------SDCIR-------------PNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLK 8312
            C+    CV+ +C C PG+ G    +      C     CV  Q  CVC+ GF G     D  + +C   C+  G C   +C C+ G  GD  G+ SC     C    +C     +C+C  GY G+       +  CP+ C  R +C  G+C C  G  G+  G   C  +C E     D    C+P ++                      +C C  GY GD  +C  +  C   C+Q   C +  C C P YTG           C     C  +  +CVC  G++G     +    SC  +C     C    C+C  G +G   G   C  DC+        R  + RCVC P F G+   C       C  DC  + +  +  C C  G+ G+  S       C     C     +C C++ ++G    C  ++C   CS+   +C    C C  G + +  +   C   CH +  C     +C C PGY G          +C     C Q            DC +             P E+C     QC+C    F  P    C    C   C  +  C  G C+C      DGY   A E+C  +   ++   +   ++++++
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV--QGVCVCRAGFSGP----DCSQRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPR--GCSQRGRC--ENGRCVCNPGYTGEDC----GVRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCEDGECICDTGYSGD--DC-GVRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRACPRDCRGRGRC--ENGVCVCNAGYSGEDCGVR----SCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGDCR-----GRGRCVDGRCVCNPGFTGE--DCG---SRRCPGDCRGHGLCEDGVCVCDAGYSGEDCSTRSCPGGCRGRGQCLD--GRCVCEDGYSGE--DCGVRQCPNDCSQH-GVCQDGVCICWEGYVSEDCSIRTCPSNCHGRGRCE--EGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAG--QCVC-VEGFRGPD---CAIQTCPGDCRGRGECHDGSCVCK-----DGY---AGEDCGEEVPTIEGMRMHLLEETTVR 766          

HSP 16 Score: 90.8929 bits (224), Expect = 4.870e-17
Identity = 189/798 (23.68%), Postives = 268/798 (33.58%), Query Frame = 3
Query: 9582 SRNCVCKPGTTP----------------------STNGKCIILGCPV-------QCDKNAVC-------LSN-NCVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNR----KCVCLPGFQDDNGKCSPKECQPKCHMFAICITQTCYCVPGYFGDGIKSCTSCSVCHKNAQCLPDRGCVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDGINCQR-PFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGD--GIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNFAYCRQKVCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNN-PASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPINCYQPCHKNAYCNIGVCTCNPDYIGDGITSCKKKNLCLEDSDCPII-GSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCDPNAVCVLGECICKVGFTGN 11837
            S  C C PGT P                          +C    CP        Q D   +C       LS   C C+ G+ G   +   + +   +S      S  +   D  R    +CVC PG+   +  C    C   C     C+   C C  G+ G      +    C +  +C   R CVC   + G        D+C +    R   + C      +N +C C P +      C  + C   C +  +C+ G C C  G+ G+    +  P++CG    C D               CVC  G+      C    CP +C    +C+ G+C+C     GD  G+R+C     C+ R  C    C C PGY G     +         DCR R   C  GV     C C  G+S E+  C   +C   C    +C+ G C+C  GY+    G    P D C+    C D              RC+C  GF  +    C    CP  C     C   VC C  G+ G+      DCS              +CPG               CR    C D   VC   Y    C  +               C   C ++  C  G C C  G++           DC +   P++C             +  C+C  G+      C    C   C     C  GVC C   ++G G   C ++      S CP   G + + ++    C C  G+      C  + C   C     C  G C+CK G+ G 
Sbjct:   82 STGCGCPPGTEPPVLASEVQALRVRLEILEELVKGLKEQCTGGCCPASAQAGTGQTDVRTLCSLHGVFDLSRCTCSCEPGWGGPTCSDPTDAEIPPSSPPSASGSCPDDCNDQGRCVRGRCVCFPGYTGPS--CGWPSCPGDCQGRGRCVQGVCVCRAGFSGPDCSQRSCPRGCSQRGRCEGGR-CVCDPGYTG--------DDCGM----RSCPRGCSQRGRCENGRCVCNPGY--TGEDCGVRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGR-------------CVCWPGY--TGEDCSTRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCP--GDCNQRGRCEDGRCVCWPGYTGTDCGSRA-----CPRDCRGR-GRCENGV-----CVCNAGYSGED--CGVRSCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGD-CRGRGRCVDG-------------RCVCNPGFTGE---DCGSRRCPGDCRGHGLCEDGVCVCDAGYSGE------DCST------------RSCPG--------------GCRGRGQCLDGRCVCEDGYSGEDCGVRQ--------------CPNDCSQHGVCQDGVCICWEGYVS---------EDCSIRTCPSNCHGRGRC------EEGRCLCDPGYTGPT--CATRMCPADCRGRGRCVQGVCLC---HVGYGGEDCGQEE--PPASACPGGCGPRELCRAG--QCVCVEGFR--GPDCAIQTCPGDCRGRGECHDGSCVCKDGYAGE 743          

HSP 17 Score: 86.2705 bits (212), Expect = 1.184e-15
Identity = 162/625 (25.92%), Postives = 229/625 (36.64%), Query Frame = 3
Query: 7350 ENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGDGFSFCFNCSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDC-RKCHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICNRNLVGDGYQCRA-PEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLV-RDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGD--GMTTCT-DCSGCDKNAICTEKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSGDG-------IQCRIEDQCSL----------NSDCTD-------------PNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGD 9116
               CVC  G+TG   +C    PSC  +C     C +  C+C++G SG   +     + C Q   C     RCVC P + GD   C +    +C   C       N  C C  G+ G+          CS    C     +C C   +TG    C  + C   C E    C+  +C C PG  G+  +   C R C  +  C     +C C  GY G+      + SC    DC   N+       +C+C    +       C +  C   C  +  C  G C+CN    G+    R+ P +C     C   +             C C  G   RD    C   AC G C  +  CV     + RC+C PGF G+  G   C  DC G   + +C E   C+C +G+ G+        +C+  S     RGR  +C+       +C C  G+   +  C    C   C+++ VC    C C  G V       T  S CH +  C + R C+C  GY+G           CR   +C              DC               P ++C        +CVC   F   +  C   TC   C     C +G C C  GY G+
Sbjct:  199 RGRCVCFPGYTG--PSCGW--PSCPGDCQGRGRCVQGVCVCRAGFSGPDCSQRSCPRGCSQRGRCE--GGRCVCDPGYTGD--DCGMR---SCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSCPRGCSQRGRC--KDGRCVCDPGYTGE--DCGTRSCPWDCGEG-GRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCE--DGECICDTGYSGDD---CGVRSC--PGDC---NQRGRCEDGRCVC----WPGYTGTDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCRGRGRCESGR-------------CMCWPGYTGRD----CGTRACPGDCRGRGRCV-----DGRCVCNPGFTGEDCGSRRCPGDCRG---HGLC-EDGVCVCDAGYSGE--------DCSTRSCPGGCRGRG-QCLDG-----RCVCEDGYSGED--CGVRQCPNDCSQHGVCQDGVCICWEGYVSEDCSIRTCPSNCHGRGRCEEGR-CLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELC-----RAGQCVCVEGFRGPD--CAIQTCPGDCRGRGECHDGSCVCKDGYAGE 743          

HSP 18 Score: 75.8702 bits (185), Expect = 2.092e-12
Identity = 161/653 (24.66%), Postives = 225/653 (34.46%), Query Frame = 3
Query: 7632 NDCHPNAVRVNNCCRCKNGFFGDGFSFCFNCSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDC-RKCHEKATCNIRSMKCECLPGYIGNGFECIS-ITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICNRNLVGDGYQCRA-PEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGD--GMTTC-TDCSGCDKNAICTEKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCECLPGLVGN--GFIKCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRI-EDQCSLNSDCTDPNKIC---ITSTDTVKR----------------CVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDGIICRL-PDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKG------------NGYSGCFD----CSKCHANADCDE 9455
            +DC+     V   C C  G+ G    +     +C     C   +  C C+  F+G    C ++ C   CS+    C   +C C PG  GD      C R C ++  C   + +C C PGY G      S    C+Q   C            +C+C+         + C   +C   C     CV G+C+C     G+    R  P +C     C   +             C C  G   D    C   +C G C+ +  C      + RC+C PG+ G   G   C  DC G  +     E   C+C +G+ G+        +C   S     RGR     R   G  +C C  G+   +  C   +C   C     C+  +C C PG  G   G  +C    +C    LC D   CVC  GYSG+    R     C     C D   +C    +  D   R                C+C   ++S +  C   TC S CH    CE G C C  GY G     R+ P +C+    C               +C C  G+  +              +     S C P  C P+     LC  G C C   F+G             G   C D    C   +A  DC E
Sbjct:  189 DDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCVQGV--CVCRAGFSGP--DCSQRSCPRGCSQ-RGRCEGGRCVCDPGYTGDDCGMRSCPRGCSQRGRCE--NGRCVCNPGYTGEDCGVRSCPRGCSQRGRC---------KDGRCVCDPGY----TGEDCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCEDGE-------------CICDTGYSGD---DCGVRSCPGDCNQRGRC-----EDGRCVCWPGYTGTDCGSRACPRDCRGRGR----CENGVCVCNAGYSGE--------DCGVRSCPGDCRGRG----RCESG--RCMCWPGYTGRD--CGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPG--DCRGHGLCEDGV-CVCDAGYSGEDCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCSQHGVCQDGVCICWEGYVSED--CSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRC------------VQGVCLCHVGYGGED-----------CGQEEPPASAC-PGGCGPR----ELCRAGQCVCVEGFRGPDCAIQTCPGDCRGRGECHDGSCVCKDGYAGEDCGE 747          
BLAST of Neurogenic locus notch-like protein protein 1 vs. Ensembl Human
Match: TNXB (tenascin XB [Source:HGNC Symbol;Acc:HGNC:11976])

HSP 1 Score: 114.005 bits (284), Expect = 5.837e-24
Identity = 183/648 (28.24%), Postives = 259/648 (39.97%), Query Frame = 3
Query: 3888 CTCKRGYVKDGNNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGD--GINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSI------CDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNP--LKHC-FDCRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPH----NNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNP--LQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICLPGFTGD--GTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKC---QPIVHECRPGCGENAKCVNGKCECLPGLQGN--PMQHC-FDCK---KCHKFADCDVWNKKCVCKNGYFGN 5747
            C C  GY   G +C   S  C  +C    +C+ G C C AG  G    Q    + CSQ   C+    RCVC  GY G+   C  + +C   C   G CEN  C C PG  G+  G+  C     C     C+  + RCVC  G+T  G+ C      +C   C +  +CV G+C C PG  G+      DCS       C     C  +  +C+C+ GY GD   C + S  C   C+   +C + +C                        +C+P      C S               C   C     C NG C C +G  G    ++ C  DCR       C  E+ RC+C  G+   GR+C   + C   C     C++  CVC P + G+      +C S     DC  H    +  C C  G++G   +  +    C   C    +C++G+C C  G  G    ++ C N   C +   C   +  C+C  GY+       S+  C + C     C    C+C PG+TG    TR C   + C     C+  +  C+C  GY   G  C   +P    C  GCG    C  G+C C+ G +G    +Q C  DC+   +CH        +  CVCK+GY G 
Sbjct:  202 CVCFPGYT--GPSCGWPS--CPGDCQGRGRCVQGVCVCRAGFSGPDCSQRSCPRGCSQRGRCE--GGRCVCDPGYTGD--DC-GMRSCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSC--PRGCSQRGRCK--DGRCVCDPGYT--GEDCGTR---SCPWDCGEGGRCVDGRCVCWPGYTGE------DCSTRTCPRDCRGRGRC--EDGECICDTGYSGD--DCGVRS--CPGDCNQRGRCEDGRC------------------------VCWPGYTGTDCGSR-------------ACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCR---GRGRC--ESGRCMCWPGYT--GRDC-GTRACPGDCRGRGRCVDGRCVCNPGFTGE------DCGSRRCPGDCRGHGLCEDGVCVCDAGYSGEDCSTRS----CPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVCQ--DGVCICWEGYVSED---CSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMC--PADCRGRGRCV--QGVCLCHVGY--GGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRGRGECH--------DGSCVCKDGYAGE 743          

HSP 2 Score: 110.923 bits (276), Expect = 5.117e-23
Identity = 179/679 (26.36%), Postives = 260/679 (38.29%), Query Frame = 3
Query: 2253 CNTEADCSPYENRCYCRPGYTGN--GFTCIKSCDKICHKDALCQNSRCICKPNFEGDGVNYCFDCSK------CHKLAQCHPKTGNCTCRPPYVGD--GVSECETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDC--SKCHTDSDCDKTNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGDGVETCFHCSQCDSNAICDQNNKACICKSGFEGN--GINCLRAINCKQKCHKQARCLLGKCICNKGLNGN--GVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGD--GIQCKLLPLCTPACHPQASCINGNCKCNNNLIGD--GISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEEKCECMERFEGDGFTCQD--KVDCSSRCGENAFCYNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGDGTTYCFNCSSCARNSDCKPE----QQTCTCKRGYVKDGNNC---SIISARCHPECGVNAQCINGKCECLAGLQGN--PFQQC-FDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQE 4193
            CN +  C     RC C PGYTG   G+    SC   C     C    C+C+  F G       DCS+      C +  +C  + G C C P Y GD  G+  C    P+G     C+    C     C C   Y G   E C +      C     C   +G C C  G+ G+   C    C   C E  +CVDG+C+C PG++G+   T      C     C+     CIC +G+ G+  G+      +C   C+++ RC  G+C+C  G  G   G   C     C    +C      C CN+G+ G+  G++      C   C  +  C +G C C     G   G  +C     C    RC   + RC+C PG+ G      + C   C    +C++G C C  G +G+  +       C    +CL     CE       DG++ +D     C + C ++  C +G C C  G+         DC +                        RT C  +CH   +C +GRC C     G        C++    +DC+      Q  C C  GY   G +C      ++ C   CG    C  G+C C+ G +G     Q C  DC+   +  D       CVC+ GY G      ++ +  +     G    QE
Sbjct:  191 CNDQGRC--VRGRCVCFPGYTGPSCGW---PSCPGDCQGRGRCVQGVCVCRAGFSGP------DCSQRSCPRGCSQRGRC--EGGRCVCDPGYTGDDCGMRSC----PRG-----CSQRGRCE-NGRCVCNPGYTG---EDCGVRSCPRGCSQRGRC--KDGRCVCDPGYTGE--DCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCEDGE--CICDTGYSGDDCGVR-----SCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRACPR--DCRGRGRC--ENGVCVCNAGYSGEDCGVRS-----CPGDCRGRGRCESGRCMCWPGYTGRDCGTRAC--PGDCRGRGRC--VDGRCVCNPGFTGEDCGS-RRCPGDCRGHGLCEDGVCVCDAGYSGEDCSTRSCPGGCRGRGQCLDGRCVCE-------DGYSGEDCGVRQCPNDCSQHGVCQDGVCICWEGYVSE------DCSI------------------------RT-CPSNCHGRGRCEEGRCLCDPGYTGP------TCATRMCPADCRGRGRCVQGVCLCHVGY--GGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRGRGECHDGS-----CVCKDGYAGEDCGEARVPSSASAYDQRGLAPGQE 767          

HSP 3 Score: 110.153 bits (274), Expect = 1.038e-22
Identity = 182/679 (26.80%), Postives = 250/679 (36.82%), Query Frame = 3
Query: 4161 CHVNGFCENQECKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGD--GVQSCFDCSICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCFDCRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGD--GINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICLPGFTGDGTRFCFDCSS--CPKN--SNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNP--MQHCFDCKKCHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPV-LCTSKCHKNAKCLKGNCECLPGFVGD--GIQVCFNCSTCDKNANCFPYQERCVCKPRYSGN 6158
            C+  G C    C C PG  G    +      C     C      CVC  GF+G    CS     +C R C ++ +C  G+C C PG  GD  G++SC     C     C  +  +CVCNPGY G+   C + S  C   C    +C + +C C+    G                      ++C  +S               C   CGE   CV+G+C C  G  G         R C     C  E+  CIC +G+ GD  +C  ++ C   C++   C +  CVC P Y G   G   C     C     CE  N  C C  G++G      +    C   C    +C +G+C C PG  G                DC                         C   C     CV+  C+C PGFTG+      DC S  CP +   + L E+  C+C  GY  +G  C      C  GC    +C++G+C C  G  G    ++ C +   C +   C   +  C+C  GY      C+ I  C   C+    C   +C+C PG+ G         + C     CV  +  C C   Y   +  C   + P   C   C     C  G C C+ GF G    IQ C     C     C  +   CVCK  Y+G 
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRC--VQGVCVCRAGFSG--PDCSQR---SCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSC--PRGCSQRGRC--ENGRCVCNPGYTGE--DCGVRS--CPRGCSQRGRCKDGRCVCDPGYTG----------------------EDCGTRS---------------CPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRC--EDGECICDTGYSGD--DC-GVRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRACPR--DCRGRGRCE--NGVCVCNAGYSGEDCGVRS----CPGDCRGRGRCESGRCMCWPGYTGR---------------DC---------------------GTRACPGDCRGRGRCVDGRCVCNPGFTGE------DCGSRRCPGDCRGHGLCEDGVCVCDAGY--SGEDCS--TRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVCQ--DGVCICWEGYVSED--CS-IRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCV--QGVCLCHVGYGGED--CGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPG--DCRGRGEC--HDGSCVCKDGYAGE 743          

HSP 4 Score: 105.916 bits (263), Expect = 1.782e-21
Identity = 164/603 (27.20%), Postives = 238/603 (39.47%), Query Frame = 3
Query: 1878 KCICSPGYSMINNICDKTYSNFKCVPPCHIDATCYENNMCICNSGHQGDGXXXXXXXXXXXXAECYPEISKCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGD--GINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTC-IKSCDKICHKDALCQNSRCICKPNFEGD--GVNYC-FDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDK----TNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGD--GVETCFHCSQCDSNAICDQNNKACICKSGFEGNGINC-LRAINCKQKCHKQARCLLGKCICNKGLNGN--GVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGNCKCNNNLIGD--GISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEEKCECMERFEGD--GFTCQDKVDCSSRCGENAFCYNGTCKCKLGFQG 3629
            +C+C PGY+  +  C          P C  D  C     C+     QG                       C C+ GF  SG +C +  +C   C +   C  G C C+    GD  G+ SC     C+    C     RC C PGYTG    C ++SC + C +   C++ RC+C P + G+  G   C +DC +  +        G C C P Y G+   +C T      C   C     C  +  C C   Y G+       DC       DC++     +G C C  G+   G  C    C   C  + +C +G C+C  G+SG+  GV +C     C     C+     C+C  G+ G   +C  RA  C   C  + RC+ G+C+CN G  G   G   C     C  +  C      C C++G+ G+    +    C   C  +  C++G C C +   G+  G+  C   + CS +  C   +  CIC  GY       ++TC  +CH    C+EG C C  G TG         + C    +C+  +  C C   + G+  G        C   CG    C  G C C  GF+G
Sbjct:  201 RCVCFPGYTGPS--CG--------WPSCPGD--CQGRGRCV-----QG----------------------VCVCRAGF--SGPDCSQR-SCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSC--PRGCSQRGRCE--NGRCVCNPGYTGE--DCGVRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVD-----GRCVCWPGYTGE---DCSTR----TCPRDCRGRGRCE-DGECICDTGYSGD-------DCGVRSCPGDCNQRGRCEDGRCVCWPGYT--GTDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSC--PGDCRGRGRCESGR--CMCWPGYTGR--DCGTRA--CPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPG--DCRGHGLC--EDGVCVCDAGYSGEDCSTR---SCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQC--PNDCSQHGVC--QDGVCICWEGYVSEDCS-IRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCV--QGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRG 711          

HSP 5 Score: 103.605 bits (257), Expect = 9.348e-21
Identity = 162/564 (28.72%), Postives = 227/564 (40.25%), Query Frame = 3
Query: 4794 CVNGQCQCQSGLQGNPLKHCFDCRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGD--GINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICLPGFTGD--GTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQG-------------------------NPMQHCFDCKKCHKFADCDVW----NKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPGFIGD--GIKFCF-DCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENC-VKIGPESICPNXXXXXXXXXXXXXXXLQGFSGD--GIKTCFNCSSCSIEAICVPDQEKCICKAGFSGN 6368
            CV G C C++G  G         R C     C  E  RC+C  G+ GD  +C  ++ C   C +   C N  CVC P Y G+  G+  C     C +   C+  + RC C  G+TG      +    C   CGE  +CV+G+C C PG  G         + C     C+  + +C+C  GY G+      V  C   C+    C +  C+C PG+TG   G+R C     C     C  E   C+C  GY  +G  C   V  C   C    +C +G+C C PG  G                         NP     DC       DC       +  CVC  GY  +G  C+    C   C     C++ +C+C  G+ G+  G++ C  DCS      + V +   C C + Y   +  CS I+    C S CH   +C +G C C PG+ G         + C     C   Q  C+C   Y   GE+C  +  P S CP  C  +  C   +C C++GF G    I+TC     C     C      C+CK G++G 
Sbjct:  228 CVQGVCVCRAGFSGPDCSQRSCPRGCSQRGRC--EGGRCVCDPGYTGD--DCG-MRSCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSCPR--GCSQRGRCK--DGRCVCDPGYTGEDCGTRS----CPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCE--DGECICDTGYSGDD---CGVRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRAC--PRDCRGRGRC--ENGVCVCNAGY--SGEDCG--VRSCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCEDGVCVCDAGY--SGEDCS-TRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCS-----QHGVCQDGVCICWEGYVSED--CS-IR---TCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCV--QGVCLCHVGY--GGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPG--DCRGRGEC--HDGSCVCKDGYAGE 743          

HSP 6 Score: 99.3673 bits (246), Expect = 1.660e-19
Identity = 122/460 (26.52%), Postives = 176/460 (38.26%), Query Frame = 3
Query: 2088 KCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGD--GINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKSCDKICHKDALCQNSRCICKPNFEGD--GVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDK----TNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGD--GVETCFHCSQCDSNAICDQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGD--GIQCKLLPLCTPACHPQASCINGNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGD 3431
            +C C PG+ G     R    C   C     C +G C C+    GD  G+ SC     CN    C   + RC C PGYTG      ++C + C     C+N  C+C   + G+  GV  C     C    +C  ++G C C P Y G    +C T    G+C         C V+  C C   + G        DC       DC       +G C C  G+ G+   C+   C   C  + QC+DG+C+C+ G+SG+  GV  C +   C  + +C   +  CIC  G+     +      C   CH + RC  G+C+C+ G  G           C    +C+  Q  C C+ G+ G+  G +      C   C P+  C  G C C     G       DC                             ++TC   C     C +G+C C +G  G+
Sbjct:  356 RCVCWPGYTGEDCSTR---TCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPG--DCNQRGRCE--DGRCVCWPGYTGTDCGS-RACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSC--PGDCRGRGRC--ESGRCMCWPGYTG---RDCGTRACPGDC----RGRGRC-VDGRCVCNPGFTGE-------DCGSRRCPGDCRGHGLCEDGVCVCDAGYSGE--DCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVC--QDGVCICWEGYVSEDCSIR---TCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCV--QGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGP------DC----------------------------AIQTCPGDCRGRGECHDGSCVCKDGYAGE 743          

HSP 7 Score: 98.5969 bits (244), Expect = 2.681e-19
Identity = 135/502 (26.89%), Postives = 199/502 (39.64%), Query Frame = 3
Query: 1878 KCICSPGYSMINNICDKTYSNFKCVPPCHIDATCYENNMCICNSGHQGDG-XXXXXXXXXXXXAECYPEISKCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGD--GINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKSCDKICHKDALCQNSRCICKPNFEGD--GVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDK----TNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGD--GVETCFHCSQCDSNAICDQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGD--GIQCKLLPLCTPACHPQASCINGNCKCNNNLIGD--GISSC-FDCDKCSMNARCDVSNQRCICQPGYEGN 3335
            +C+C+PGY+       +      C   C     C ++  C+C+ G+ G+          C     C     +C C PG+ G     R    C   C     C +G C C+    GD  G+ SC     CN    C   + RC C PGYTG      ++C + C     C+N  C+C   + G+  GV  C     C    +C  ++G C C P Y G    +C T    G+    C     C V+  C C   + G        DC       DC       +G C C  G+ G+   C+   C   C  + QC+DG+C+C+ G+SG+  GV  C +   C  + +C   +  CIC  G+     +      C   CH + RC  G+C+C+ G  G           C    +C+  Q  C C+ G+ G+  G +      C   C P+  C  G C C     G    I +C  DC       R +  +  C+C+ GY G 
Sbjct:  294 RCVCNPGYT------GEDCGVRSCPRGCSQRGRC-KDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCV--DGRCVCWPGYTGEDCSTR---TCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPG--DCNQRGRCE--DGRCVCWPGYTGTDCGS-RACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSC--PGDCRGRGRC--ESGRCMCWPGYTG---RDCGTRACPGD----CRGRGRC-VDGRCVCNPGFTGE-------DCGSRRCPGDCRGHGLCEDGVCVCDAGYSGE--DCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVC--QDGVCICWEGYVSEDCSIR---TCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCV--QGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDC-----RGRGECHDGSCVCKDGYAGE 743          

HSP 8 Score: 90.8929 bits (224), Expect = 7.077e-17
Identity = 168/626 (26.84%), Postives = 222/626 (35.46%), Query Frame = 3
Query: 8988 CVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDGIICRL-PDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGNGYSGCFDCSKCHANADCDESKGCT-----CKPGFEGNGCYCR--PEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNNCVCKTGYSGTGLNCKPNDQCSQNSDCPEP---NSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICITQTCYCVPGYFGD--GIKSCTSCSVCHKNAQCLPDRGCVCKSDFIGDGFNCR--PLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDGINCQRPFECGIDNPCKD--QFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGDGIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVD-KGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQLGVCVCKDGYS 10811
            CVC++ F  S   C   +C   C +   CE G C C  GY GD    R  P  C     C  EN  CV          C  G+  +                      C    C   C +   C  G C C P + G       DC       DC E   C      C PG+ G  C  R  P D C+    C D              C+C  G +      C +  CP  C++   C    CVC  GY+GT         C   + CP       RCE     N  CVC  G+  ++  C  + C   C     C +  C C PGY G   G ++C     C    +C+  R CVC   F G+    R  P D CR +  C D   +C+ +       C+ +              C   C    +C  G C C  G+ G+        +CG+     D  Q  VCQ        VC+C  G+  ++  C    CP NCH   +C+ G+C+C     G    T    + C  R  C    C C  GY G       ED  Q +         C P    +  +C C  GF   +  C+   C   C    +C  G CVCKDGY+
Sbjct:  233 CVCRAGF--SGPDCSQRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPRGCSQRGRC--ENGRCV----------CNPGYTGED---------------------CGVRSCPRGCSQRGRCKDGRCVCDPGYTGE------DCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRD-CRGRGRCED------------GECICDTGYS---GDDCGVRSCPGDCNQRGRCEDGRCVCWPGYTGT--------DCGSRA-CPRDCRGRGRCE-----NGVCVCNAGYSGED--CGVRSCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPG--DCRGRGRCVDGR-CVCNPGFTGEDCGSRRCPGD-CRGHGLCED--GVCVCDAGYSGEDCSTR-------------SCPGGCRGRGQCLDGRCVCEDGYSGE--------DCGVRQCPNDCSQHGVCQ------DGVCICWEGY--VSEDCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGG-------EDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPD--CAIQTCPGDCRGRGECHDGSCVCKDGYA 741          

HSP 9 Score: 88.9669 bits (219), Expect = 2.456e-16
Identity = 174/686 (25.36%), Postives = 274/686 (39.94%), Query Frame = 3
Query: 5376 NKCDSNALCVNRHCICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNP--MQHCFDCKKCHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPGFIGD--GIKFC-FDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGD--GIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGD--GIKTCFNCSSCSIEAICVPDQEKCICKAGFSGN--GEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCST--CPPNSDC----LPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGD--GIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDG-FRCYPVILECP-KCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCA 7370
            + C+    CV   C+C PG+TG    +      C     C+  +  C+C+ G+  +G  C      C  GC +  +C  G+C C PG  G+   M+ C   + C +   C+  N +CVC  GY G    C  +  C   C++   C + +C+C PG+ G+  G + C +DC        CV     C C   Y   +  CS       C   C    +C  G C C  G+ GD  G++ C     C++   C     RCVC P Y+G   +C        CP  C  + +C+   C C  G+SG+  G+++C     C     C  +  +C+C  G++G   G +           C      V+ +C+C PGF G+      DC +  CP   DC    L ++  C+C   Y   D        T  C   C     C+  +C C  G+ G+  G++ C   + C  +  C  +   C+C  G+       D    TC   C   G C   +C C+ G  G    +    + C    +C   V  C+C +GY G+   +  P    CP  C  R  C  G+C C  G +G          +C    +C  +   C C+ GY G+     ++   +    Q  +      + + +    G S+    ++     I  P ++L V A
Sbjct:  189 DDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV--QGVCVCRAGF--SGPDCS--QRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSC--PRGCSQRGRCE--NGRCVCNPGYTGED--CG-VRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCG---EGGRCV--DGRCVCWPGYTGED--CS----TRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPG--DCNQRGRC--EDGRCVCWPGYTGT--DCGS----RACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPG--DCRGRGRC--ESGRCMCWPGYTGRDCGTRACPG------DCRGRGRCVDGRCVCNPGFTGE------DCGSRRCP--GDCRGHGLCEDGVCVCDAGYSGEDCS------TRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQC--PNDCSQHGVC--QDGVCICWEGYVSE----DCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGV--CLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRGRGEC--HDGSCVCKDGYAGEDCGEARVPSSASAYDQRGLAPGQE-YQVTVRALRGTSWGLPASKTITTMIDGP-QDLRVVA 802          

HSP 10 Score: 84.7297 bits (208), Expect = 4.819e-15
Identity = 180/671 (26.83%), Postives = 255/671 (38.00%), Query Frame = 3
Query: 3267 CSMNARCDVSNQRCICQPGYEG--------------NGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDCSSR-----CGENAFCYNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNR----KCIC---ITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGD--GTTYC-FNCSSCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFDC------KRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGD--GINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGD--GVNFCFNCTSCH---PDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGN--PLKHC-FDCRPCHSFAVCDVENRRCICQSGFEGD--GRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGN 5138
            CS++   D+S   C C+PG+ G              +      +C   C+    C  G C C  G TG    +      C    +C+  +  C C   F G         DCS R     C +   C  G C C  G+ G+      DC +   P  C    R    +C+C    T  D   R+ C   C    +C  GRC C     G+  GT  C ++C    R  D +     C C  GY   G +CS  +  C  +C    +C +G+C C  G  G+      DC        C+Q   C+  + RCVC  GY G   T      C   C   G CEN  C C  G  G+  G+  C     C     CE  + RC+C  G+T  G+ C   A   C   C  + +CV G+C C PG  G+   S      C  + +C  +   CVC+ GY G+  +    ++ C   C    +C++ +C C +   G+  GV  C N  S H    D +C        C   +V +   C++R   C   C     C  G+C C  G  G     + C  DCR      V  V    C+C  G+ G+  G+       C   C    +C    CVC+  + G           C    +C  H+  C C  G+ G 
Sbjct:  143 CSLHGVFDLSRCTCSCEPGWGGPTCSDPTDAEIPPSSPPSASGSCPDDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV--QGVCVCRAGFSGP--------DCSQRSCPRGCSQRGRCEGGRCVCDPGYTGD------DCGMRSCPRGCSQRGRCENGRCVCNPGYTGEDCGVRS-CPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGR-----CVCWPGYT--GEDCSTRT--CPRDCRGRGRCEDGECICDTGYSGD------DCGVRSCPGDCNQRGRCE--DGRCVCWPGYTG---TDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSC--PGDCRGRGRCE--SGRCMCWPGYT--GRDCGTRA---CPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLC--EDGVCVCDAGYSGEDCS----TRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCSQHGVCQDGVCI-------CWEGYVSE--DCSIR--TCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCR-GRGRCVQGV----CLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRGRGEC--HDGSCVCKDGYAGE 743          

HSP 11 Score: 83.1889 bits (204), Expect = 1.462e-14
Identity = 164/618 (26.54%), Postives = 244/618 (39.48%), Query Frame = 3
Query: 5997 CHKNAKCLKGNCECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGD--GIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGD--GKNFC-FDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGD--GIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGD--GVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGD--GFRCYPVILECP-KCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGN--GVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSG------------DGKNYCF-------------DCKR-----------CDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGD 7700
            C+   +C++G C C PG+ G           C     C   Q  CVC+  +SG   +C     +  CP  C ++ +C+  +C C  G++GD  G+++C     CS    C  +  +C+C  G++G  E C   +      C       + +C+C PG+ G+  G   C +DC        C+  + RC+C   Y   D        T  C   C     C   +C C  G+ GD  G++ C     C+    C  E  +CVC  G+ G     D     C   C   G C N  C CN+G  G+  GV SC     C    +C     +C+C  GY G   G R       CP  C  R +CV G+C C  G  G+         +C  +  C      C C  GY   G++C     C   C     C++  C C   Y+G   GV  C N   C  + +C+  + +C+C +G+     + +    +C +NCH    C +  C+C  G +G             G+  C              DC +           C    +CR  +  CVC   FRG    CA+    TC  DC       +  C CK+G+ G+
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV--QGVCVCRAGFSG--PDCS----QRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPR--GCSQRGRC--ENGRCVCNPGYTG--EDC--GVRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGE---GGRCV--DGRCVCWPGYTGEDCS------TRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSC--PGDCNQRGRC--EDGRCVCWPGYTGT----DCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPG--DCRGRGRC--ESGRCMCWPGYTGRDCGTRA------CPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCEDGV--CVCDAGY--SGEDC-STRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVCQ--DGVCICWEGYVSEDCSIR----TCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQ--CVCVEGFRGP--DCAIQ---TCPGDCRGRGECHDGSCVCKDGYAGE 743          

HSP 12 Score: 82.4185 bits (202), Expect = 2.462e-14
Identity = 167/670 (24.93%), Postives = 225/670 (33.58%), Query Frame = 3
Query: 8157 CHPKAVCVKGKCICNRNLVGD--GYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGD--GMTTCTDCSGCDKNAICTEKQGCICKSGFIGDG-------RQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRI-EDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDGIICRL-PDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGN--------------------------GYSGCFDCSK------CHANADCDESKGCTCKPGFEGNGCYCR--PEDKCKFNSDCNDPLKICVQ---SPD----------------TSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNNCVCKTGYSGTGLNCKPNDQCSQN----SDCPE---PNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICITQTCYCVPGYFGD 9947
            C+ +  CV+G+C+C     G   G+    P +C     CVQ              +C C+ G        C + +C   C  +  C        RC+C PG+ GD  GM +C    GC +   C E   C+C  G+ G+        R C     C D                      +C C  G+   +  C   SC + C +   C+  +C C PG  G      T   +C  +  C D   C+C  GYSGD    R     C+    C D             RCVC   +  ++  C    C   C     CENGVC C  GY G+    R  P +C+    C+            S  C C  G+  +                      C    C   C     CV G C C P F G                           GYSG  DCS       C     C + + C C+ G+ G  C  R  P D C  +  C D + IC +   S D                    C+C PG T  T   C    CP  C     C+   C+C  GY G        + C Q     S CP    P   C   +     CVC+ GF+  +  C+ + C   C     C   +C C  GY G+
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPS-CPGDCQGRGRCVQ-------------GVCVCRAGFSGP---DCSQRSCPRGCSQRGRCEGG-----RCVCDPGYTGDDCGMRSCP--RGCSQRGRC-ENGRCVCNPGYTGEDCGVRSCPRGCSQRGRCKDG---------------------RCVCDPGYTGED--CGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCEDGE-CICDTGYSGDDCGVRSCPGDCNQRGRCED------------GRCVCWPGYTGTD--CGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCRGRGRCE------------SGRCMCWPGYTGRD---------------------CGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCEDGVCVCDAGYSG-EDCSTRSCPGGCRGRGQCLDGR-CVCEDGYSGEDCGVRQCPND-CSQHGVCQDGVCICWEGYVSEDCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPT---CATRMCPADCRGRGRCVQGVCLCHVGYGG--------EDCGQEEPPASACPGGCGPRELCRAGQ-----CVCVEGFRGPD--CAIQTCPGDCRGRGECHDGSCVCKDGYAGE 743          

HSP 13 Score: 81.6481 bits (200), Expect = 4.548e-14
Identity = 182/794 (22.92%), Postives = 270/794 (34.01%), Query Frame = 3
Query: 10209 CHKNAKCEGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGD--GIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQT-EDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNFAYCRQKVCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPINCYQPCHKNAYCNIGVCTCNPDYIGDGITS------CKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCDPNAVCVLGECICKVGFTGN--GLQCMPTSKCNPLSGCSDTNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVCEPSCHPKAACIIGSCICMKPLIGNGITEC--KLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNV---DCPTRKICVNSKCICPEQYTSSPDGKLCELPMIMVVPSKLDVPETKDVEVLCFFENGIGNVNYLSWRRISPLMTMNFIRQPASVKLIIQKATVGDSGIYQ 12542
            C+   +C  G C C  G+ G          CG  +   D    CQ      + VCVC  GF      C    CP  C    +C+ G+CVC     GD  G+R+C +   C  R  C    C C PGY G     ++    C     C+D             +C C PG++ E+  C   +C   CG+  +C  G CVC  GY+    G  CS          CP     C   G  +   C+C  G+   S   C   +CP  C+    C    C C  G+ G       DC                          R+C P+D CR    C +   VC   Y    C  +               C   C     C  G+C C PG+      T   P DC       C                CVC  GF  +   C    C   C  +  C  GVC C+  Y G+  ++      C+ +  CL+                   C C  GY  ++  C  ++C   C  + VC  G CIC  G+      ++  P S C+    C +               C+C PGY   +    C   +C   C  +  C+ G C+C    +G G  +C  + P   +    C  +   C+       +C+C  GF+          +C +     DC  R  C +  C+C + Y     G+         VPS     + + +     ++  +  +   SW   +       I  P  ++++    T  + G  +
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGP--------SCGWPSCPGD----CQGRGRCVQGVCVCRAGFS--GPDCSQRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPR--GCSQRGRCENGRCVCNPGYTGEDCGVRSCPRGCSQRGRCKD------------GRCVCDPGYTGED--CGTRSCPWDCGEGGRCVDGRCVCWPGYT----GEDCS-------TRTCP---RDCRGRGRCEDGECICDTGY---SGDDCGVRSCPGDCNQRGRCEDGRCVCWPGYTGT------DCGS------------------------RAC-PRD-CRGRGRCENGVCVCNAGYSGEDCGVRS--------------CPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGDC--RGRGRC------------VDGRCVCNPGFTGED--CGSRRCPGDCRGHGLCEDGVCVCDAGYSGEDCSTRSCPGGCRGRGQCLDGR-----------------CVCEDGYSGED--CGVRQCPNDCSQHGVCQDGVCICWEGYVSEDCSIRTCP-SNCHGRGRCEEGR-------------CLCDPGYTGPT----CATRMCPADCRGRGRCVQGVCLCH---VGYGGEDCGQEEPPASACPGGCGPRE-LCRAG-----QCVCVEGFR--------GPDCAIQTCPGDCRGRGECHDGSCVCKDGYAGEDCGE-------ARVPSSASAYDQRGLAPGQEYQVTVRALRGTSWGLPASKTITTMIDGPQDLRVVAVTPTTLELGWLR 814          

HSP 14 Score: 80.4925 bits (197), Expect = 1.011e-13
Identity = 176/702 (25.07%), Postives = 248/702 (35.33%), Query Frame = 3
Query: 5787 CNENALCVNQKCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGD--GIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCST--CPPNSDCLP----QEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGD--GIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNG-------------NKCDKIESTCEPPCA---------PG-----GFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGFRCYPVILECPK-CHYRAQCVIGKCQCKNGLQGD--GINFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTG-------------------NGVSFCF------NCAQCDANAI-----CKPDE----NLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGDG---KNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRV 7661
            CN+   CV  +C+C PG+ G    +      C     CV  +  C C   +   +  CS       C   C +  +C  G C C PG+ GD  G++ C     C +   C     RCVC P Y+G  E+C                                 G+++C     CS    C     +C+C  G++G  E C          C      V+ +C+C PG+ G+      DCST  CP   DC      ++  CIC   Y  +D           C   C+    C   +C C PG+ G   G + C +   C     C  E   CVC  G+ G                +C+     C P            PG     G C + +C CN G  G+   S      C  +  C   V  C+C  GY G+          CP  C  R QC+ G+C C++G  G+  G+  C N  +C ++  C      C C +GY  +  +C  I  C   CH    C    C C P YTG                    GV  C       +C Q +  A      C P E      CVC +GF G     +    +C  +C     C   SC+CK G +G+              DQ  +  P ++  V     RG  +    +   T   D  P  +RV
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV--QGVCVCRAGFSGPD--CSQRS----CPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPR--GCSQRGRC--ENGRCVCNPGYTG--EDC---------------------------------GVRSCPR--GCSQRGRC--KDGRCVCDPGYTG--EDC--GTRSCPWDCGEGGRCVDGRCVCWPGYTGE------DCSTRTCP--RDCRGRGRCEDGECICDTGYSGDDCGVR------SCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRACPR--DCRGRGRC--ENGVCVCNAGYSGEDCGVRSCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCEDGV--CVCDAGYSGEDC----STRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVC--QDGVCICWEGYVSE--DC-SIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQ----TCPGDCRGRGECHDGSCVCKDGYAGEDCGEARVPSSASAYDQRGLA-PGQEYQVTVRALRGTSWGLPASKTITTMID-GPQDLRV 800          

HSP 15 Score: 79.7221 bits (195), Expect = 1.501e-13
Identity = 172/627 (27.43%), Postives = 243/627 (38.76%), Query Frame = 3
Query: 5586 CGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPGFIGD--GIKFCFDCSACPANSNCVPEKKECKCAKDYFMNE-KICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGD--GIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGD--GIKTCFNCSSCSIEAICVPDQEKCICKAGFSGN---GEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCS--TCPPNSDCLPQEQ----RCICKKDYFMNDTQCIHTGR---TPQCVPKCHHYASCVQDKCECLPGFIGD--GIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGD--GVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGFRCYPVILECPK-CHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGD--GKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGN 7388
            C +  +CV G+C C PG  G           C     C      CVC+ G+  +G  C+    C   C++   C   +C+C PG+ GD  G++ C     C     C  E   C C   Y   +  + S       C   C +  +C  G C C PG+ G+  G + C     C +   C     RCVC P Y+G  E+C        CP  C  + +C+  +C C  G+SGD  G+++C     C+    C  +  +C+C  G++G       C  +  G   +C       N  C+C  G+ G+      DC   +CP   DC  + +    RC+C   Y         TGR   T  C   C     CV  +C C PGF G+  G + C     C  +  C  E   CVC  G+ G     D    +C   C   G C + +C C  G  G+  GV  C N   C  +  C   V  CIC  GY  +       I  CP  CH R +C  G+C C  G  G      M  ++C    +C      C C  GY G+  G+       C   C    +C    C C+  + G   +       C     C   +  CVC  G+ G 
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRC--VQGVCVCRAGF--SGPDCS-QRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSC--PRGCSQRGRC--ENGRCVCNPGYTGEDCGVRS-------CPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSC--PWDCGEGGRCV--DGRCVCWPGYTG--EDCST----RTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPG--DCNQRGRC--EDGRCVCWPGYTGTDCGSRACPRDCRGRG-RCE------NGVCVCNAGYSGE------DCGVRSCP--GDCRGRGRCESGRCMCWPGY---------TGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRC--PGDCRGHGLC--EDGVCVCDAGYSGE----DCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVCQDGV--CICWEGYVSEDC----SIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGV--CLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRGRGECH--DGSCVCKDGYAGE 743          

HSP 16 Score: 78.1814 bits (191), Expect = 5.077e-13
Identity = 230/1004 (22.91%), Postives = 319/1004 (31.77%), Query Frame = 3
Query: 9582 SRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNNCVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNR-KCVCLPGFQDDNGKCS-PKECQ--------------PKCHMFAICITQTCYCVPGYFGD--GIKSCTSCSVCHKNAQCLPDRGCVCKSDFIGDGFNCRPLDECRINEDCRDPN--KMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDGINCQR-PFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGD--GIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDS---DCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNFAYCRQKVCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPINCYQPCHKNAYCNIGVCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCDPNAVCVLGECICKVGFTGN--GLQCMPTSKCNPLSGCSDTNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVCEPSCHPKAACIIGSCICMKPLIGNGITECKLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVDCPTRKICVNSKCICPEQYTSSPDGKLCELPMIMVVPS----KLDVPETKDVEVLCFFENGIGNVNYLSWRRISPLMTMNFIRQPASVK 12497
            S  C C PGT P       +L   VQ  +  + +    V       TG  C  + Q                + D +R  C C PG+      CS P + +                C+    C+   C C PGY G   G  SC     C    +C+    CVC++ F G               DC   +  + C      +  +C C P +    + C  + C   C +  +CE G C C  G+ G+    +  P  C     CKD               CVC  G+      C    CP +C    +C  G+CVC     G+    RTC +   C  R  C    C C  GY G        D C   S   DC  R   C  G     +C C PG++   + C   AC   C    +C+ GVCVC  GYS    G+   P D              C   G  +  RCMC  G+  +    C    CP  C     C    C C  GF G+      DC                CPG               CR    C D   VC   Y    C  +               C   C    +CL G+C C+ G+          PNDC  +          VC        +C+C +G++++   C    C   CH    C  G C C+P Y G                                              C  + C   C     CV G C+C VG+ G   G +  P S C    GC     +C          C+C  G+        C    C   C  +  C  GSC+C     G    E ++P   SA      +        +  ++ +    + L  SK I+       +D P     V       E     P  ++    +  V       +L+VP   D  +L     G+  V  ++  R         +  PASV+
Sbjct:   82 STGCGCPPGTEPP------VLASEVQALRVRLEILEELVKGLKEQCTGGCCPASAQAGTGQTDVRTLCSLHGVFDLSRCTCSCEPGWGGPT--CSDPTDAEIPPSSPPSASGSCPDDCNDQGRCVRGRCVCFPGYTGPSCGWPSCP--GDCQGRGRCVQGV-CVCRAGFSG--------------PDCSQRSCPRGCSQRGRCEGGRCVCDPGY--TGDDCGMRSCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSCPRGCSQRGRCKDGR-------------CVCDPGY--TGEDCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPR--DCRGRGRCEDGECICDTGYSG--------DDCGVRSCPGDCNQR-GRCEDG-----RCVCWPGYT--GTDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGD--------------CRGRGRCESGRCMCWPGYTGRD---CGTRACPGDCRGRGRCVDGRCVCNPGFTGE------DCGSRR------------CPG--------------DCRGHGLCEDGVCVCDAGYSGEDCSTRS--------------CPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCSQHG---------VC-----QDGVCICWEGYVSED--CSIRTCPSNCHGRGRCEEGRCLCDPGYTG--------------------------------------------PTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACP--GGCG-PRELC------RAGQCVCVEGFRGPD----CAIQTCPGDCRGRGECHDGSCVCKDGYAGEDCGEARVPSSASAY---DQRGLAPGQEYQVTVRALRGTSWGLPASKTITTM-----IDGPQDLRVVAVTPTTLELGWLRPQAEVDRFVVSYVSAGNQRVRLEVPPEADGTLLTDLMPGVEYVVTVTAER------GRAVSYPASVR 875          

HSP 17 Score: 75.485 bits (184), Expect = 3.282e-12
Identity = 174/694 (25.07%), Postives = 251/694 (36.17%), Query Frame = 3
Query: 7359 CVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKR------CDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGD--GFSFCFNCSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDC-RKCHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICNRNLVGDGYQCRA-PEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLV-RDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGD--GMTTCT-DCSGCDKNAICTEKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSGDG-------IQCRIEDQCSL----------NSDCTD-------------PNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDG-IICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYS 9305
            CVC  G+TG   +C    PSC  +C     C +  C+C++G SG       DC +      C Q   C     RCVC P + GD   C +    +C   C       N  C C  G+ G+  G   C     CS    C     +C C   +TG    C  + C   C E    C+  +C C PG  G+  +   C R C  +  C     +C C  GY G+  +C  + SC    DC   N+       +C+C            C +  C   C  +  C  G C+CN    G+    R+ P +C     C   +             C C  G   RD    C   AC G C  +  CV     + RC+C PGF G+  G   C  DC G   + +C E   C+C +G+ G+        +C+  S     RGR  +C+       +C C  G+   +  C    C   C+++ VC    C C  G V       T  S CH +  C + R C+C  GY+G           CR   +C              DC               P ++C        +CVC   F   +  C   TC   C     C +G C C  GY G+     R+P    +     Y+ +      +  +      G  W    S  +   +   + +R  +
Sbjct:  202 CVCFPGYTGP--SCGW--PSCPGDCQGRGRCVQGVCVCRAGFSGP------DCSQRSCPRGCSQRGRCE--GGRCVCDPGYTGD--DCGMR---SCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSCPR--GCSQRGRC--KDGRCVCDPGYTGE--DCGTRSCPWDCGEG-GRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCE--DGECICDTGYSGD--DC-GVRSC--PGDC---NQRGRCEDGRCVCWPGY----TGTDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCRGRGRCESGR-------------CMCWPGYTGRD----CGTRACPGDCRGRGRCV-----DGRCVCNPGFTGEDCGSRRCPGDCRG---HGLC-EDGVCVCDAGYSGE--------DCSTRSCPGGCRGRG-QCLDG-----RCVCEDGYSGED--CGVRQCPNDCSQHGVCQDGVCICWEGYVSEDCSIRTCPSNCHGRGRCEEGR-CLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELC-----RAGQCVCVEGFRGPD--CAIQTCPGDCRGRGECHDGSCVCKDGYAGEDCGEARVPSSASA-----YDQRGLAPGQEYQVTVRALRGTSWGLPASKTITTMIDGPQDLRVVA 802          

HSP 18 Score: 60.077 bits (144), Expect = 1.634e-7
Identity = 152/611 (24.88%), Postives = 213/611 (34.86%), Query Frame = 3
Query: 7770 CQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDC-RKCHEKATCNIRSMKCECLPGYIGNGFECIS-ITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICNRNLVGDGYQCRA-PEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGD--GMTTC-TDCSGCDK--NAICTEKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCECLPGLVGN--GFIKCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRI-EDQCSLNSDCTDPNKIC---ITSTDTVKR----------------CVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDGIICRL-PDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKG------------NGYSGCFD----CSKCHANADCDESK 9461
            C C+  F+G    C ++ C   CS+    C   +C C PG  GD      C R C ++  C   + +C C PGY G      S    C+Q   C            +C+C+         + C   +C   C     CV G+C+C     G+    R  P +C     C   +             C C  G   D    C   +C G C+ +  C      + RC+C PG+ G   G   C  DC G  +  N +C      +C +G+ G+        +C   S     RGR     R   G  +C C  G+   +  C   +C   C     C+  +C C PG  G   G  +C    +C    LC D   CVC  GYSG+    R     C     C D   +C    +  D   R                C+C   ++S +  C   TC S CH    CE G C C  GY G     R+ P +C+    C               +C C  G+  +              +     S C P  C P+     LC  G C C   F+G             G   C D    C   +A  DC E++
Sbjct:  233 CVCRAGFSGP--DCSQRSCPRGCSQ-RGRCEGGRCVCDPGYTGDDCGMRSCPRGCSQRGRCE--NGRCVCNPGYTGEDCGVRSCPRGCSQRGRC---------KDGRCVCDPGY----TGEDCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCEDGE-------------CICDTGYSGD---DCGVRSCPGDCNQRGRCE-----DGRCVCWPGYTGTDCGSRACPRDCRGRGRCENGVC------VCNAGYSGE--------DCGVRSCPGDCRGRG----RCESG--RCMCWPGYTGRD--CGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPG--DCRGHGLCEDGV-CVCDAGYSGEDCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCSQHGVCQDGVCICWEGYVSED--CSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRC------------VQGVCLCHVGYGGED-----------CGQEEPPASAC-PGGCGPR----ELCRAGQCVCVEGFRGPDCAIQTCPGDCRGRGECHDGSCVCKDGYAGEDCGEAR 749          
BLAST of Neurogenic locus notch-like protein protein 1 vs. Ensembl Human
Match: TNXB (tenascin XB [Source:HGNC Symbol;Acc:HGNC:11976])

HSP 1 Score: 107.842 bits (268), Expect = 4.885e-22
Identity = 193/690 (27.97%), Postives = 273/690 (39.57%), Query Frame = 3
Query: 3888 CTCKRGYVKDGNNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGD--GINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSI------CDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNP--LKHC-FDCRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPH----NNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNP--LQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICLPGFTGD--GTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKC---QPIVHECRPGCGENAKCVNGKCECLPGLQGN--PMQHC-FDCK---KCHKFADCDVWNKKCVCKNGYFGN--GYMCTPINGCNLKCNENALCVNQKCICLPGFIGDGIKFCF 5867
            C C  GY   G +C   S  C  +C    +C+ G C C AG  G    Q    + CSQ   C+    RCVC  GY G+   C  + +C   C   G CEN  C C PG  G+  G+  C     C     C+  + RCVC  G+T  G+ C      +C   C +  +CV G+C C PG  G+      DCS       C     C  +  +C+C+ GY GD   C + S  C   C+   +C + +C                        +C+P      C S               C   C     C NG C C +G  G    ++ C  DCR       C  E+ RC+C  G+   GR+C   + C   C     C++  CVC P + G+      +C S     DC  H    +  C C  G++G   +  +    C   C    +C++G+C C  G  G    ++ C N   C +   C   +  C+C  GY+     C S+  C + C     C    C+C PG+TG    TR C   + C     C+  +  C+C  GY   G  C   +P    C  GCG    C  G+C C+ G +G    +Q C  DC+   +CH        +  CVCK+GY G   G     I G  +   E    V  +    PG + D  +  F
Sbjct:  202 CVCFPGYT--GPSCGWPS--CPGDCQGRGRCVQGVCVCRAGFSGPDCSQRSCPRGCSQRGRCE--GGRCVCDPGYTGD--DC-GMRSCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSC--PRGCSQRGRCK--DGRCVCDPGYT--GEDCGTR---SCPWDCGEGGRCVDGRCVCWPGYTGE------DCSTRTCPRDCRGRGRC--EDGECICDTGYSGD--DCGVRS--CPGDCNQRGRCEDGRC------------------------VCWPGYTGTDCGSR-------------ACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCR---GRGRC--ESGRCMCWPGYT--GRDC-GTRACPGDCRGRGRCVDGRCVCNPGFTGE------DCGSRRCPGDCRGHGLCEDGVCVCDAGYSGEDCSTRS----CPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVCQ--DGVCICWEGYVSE--DC-SIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMC--PADCRGRGRCV--QGVCLCHVGY--GGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRGRGECH--------DGSCVCKDGYAGEDCGEEVPTIEGMRMHLLEET-TVRTEWTPAPGPV-DAYEIQF 783          

HSP 2 Score: 102.064 bits (253), Expect = 3.242e-20
Identity = 190/726 (26.17%), Postives = 276/726 (38.02%), Query Frame = 3
Query: 2253 CNTEADCSPYENRCYCRPGYTGN--GFTCIKSCDKICHKDALCQNSRCICKPNFEGDGVNYCFDCSK------CHKLAQCHPKTGNCTCRPPYVGD--GVSECETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDC--SKCHTDSDCDKTNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGDGVETCFHCSQCDSNAICDQNNKACICKSGFEGN--GINCLRAINCKQKCHKQARCLLGKCICNKGLNGN--GVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGD--GIQCKLLPLCTPACHPQASCINGNCKCNNNLIGD--GISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSL------CDKNAKCLINEEKCECMERFEGDGFTCQD--KVDCSSRCGENAFCYNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGDGTTYCFNCSSCARNSDCKPE----QQTCTCKRGYVKDGNNC---SIISARCHPECGVNAQCINGKCECLAGLQGN--PFQQC-FDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCEN---QECKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCSV 4307
            CN +  C     RC C PGYTG   G+    SC   C     C    C+C+  F G       DCS+      C +  +C  + G C C P Y GD  G+  C    P+G     C+    C     C C   Y G   E C +      C     C   +G C C  G+ G+   C    C   C E  +CVDG+C+C PG++G+   T      C     C+     CIC +G+ G+  G+      +C   C+++ RC  G+C+C  G  G   G   C     C    +C      C CN+G+ G+  G++      C   C  +  C +G C C     G   G  +C     C    RC   + RC+C PG+ G      + C   C    +C++G C C  G +G+      +CS       C    +CL  + +C C      DG++ +D     C + C ++  C +G C C  G+         DC +                        RT C  +CH   +C +GRC C     G        C++    +DC+      Q  C C  GY   G +C      ++ C   CG    C  G+C C+ G +G     Q C  DC+   +  D       CVC+ GY G    C + +  +    ++   E     E    PG + D     F  +T        PF  R   S 
Sbjct:  191 CNDQGRC--VRGRCVCFPGYTGPSCGW---PSCPGDCQGRGRCVQGVCVCRAGFSGP------DCSQRSCPRGCSQRGRC--EGGRCVCDPGYTGDDCGMRSC----PRG-----CSQRGRCE-NGRCVCNPGYTG---EDCGVRSCPRGCSQRGRC--KDGRCVCDPGYTGE--DCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCEDGE--CICDTGYSGDDCGVR-----SCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRACPR--DCRGRGRC--ENGVCVCNAGYSGEDCGVRS-----CPGDCRGRGRCESGRCMCWPGYTGRDCGTRAC--PGDCRGRGRC--VDGRCVCNPGFTGEDCGS-RRCPGDCRGHGLCEDGVCVCDAGYSGE------DCSTRSCPGGCRGRGQCL--DGRCVCE-----DGYSGEDCGVRQCPNDCSQHGVCQDGVCICWEGYVSE------DCSI------------------------RT-CPSNCHGRGRCEEGRCLCDPGYTGP------TCATRMCPADCRGRGRCVQGVCLCHVGY--GGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRGRGECHDGS-----CVCKDGYAGE--DCGEEVPTIEGMRMHLLEETTVRTEWTPAPGPV-DAYEIQFIPTT---EGASPPFTARVPSSA 802          

HSP 3 Score: 101.679 bits (252), Expect = 3.932e-20
Identity = 168/611 (27.50%), Postives = 235/611 (38.46%), Query Frame = 3
Query: 4161 CHVNGFCENQECKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGD--GVQSCFDCSICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCFDC------RPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIG-------------------DGI---NFCFNCSSCDRNA---DCEP----HNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRCDKFADCDVW----NKKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICLPGFTGD--GTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNK----KCVCKNGYFGN--GYMCTPINGCNLKCNENALCVNQKCICLPGFIG 5846
            C+  G C    C C PG  G    +      C     C      CVC  GF+G    CS  +   C R C ++ +C  G+C C PG  GD  G++SC     C     C  +  +CVCNPGY G+   C + S  C   C    +C + +C C+    G                      ++C  +S               C   CGE   CV+G+C C  G  G       DC      R C     C  E+  CIC +G+ GD  +C  ++ C   C++   C +  CVC P Y G                   +G+   N  ++   C   +   DC       + RC C+ G+TG      A    C   C    +CV+G+C C PG  G   + C   +RC    DC       +  CVC  GY G    C S   C   C     C++  C+C  G++G+  G R C   + C ++  C  ++  CIC EGY+     C   +  C   C    +C  G+C C PG  G        C      ADC    +     C+C  GY G   G    P + C   C    LC   +C+C+ GF G
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRC--VQGVCVCRAGFSG--PDCSQRS---CPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSC--PRGCSQRGRC--ENGRCVCNPGYTGE--DCGVRS--CPRGCSQRGRCKDGRCVCDPGYTG----------------------EDCGTRS---------------CPWDCGEGGRCVDGRCVCWPGYTGE------DCSTRTCPRDCRGRGRC--EDGECICDTGYSGD--DC-GVRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCRGRGRCESGRCMCWPGYTGRDCGTRA----CPGDCRGRGRCVDGRCVCNPGFTG---EDC-GSRRCP--GDCRGHGLCEDGVCVCDAGYSGE--DC-STRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQC--PNDCSQHGVC--QDGVCICWEGYVSE--DCS--IRTCPSNCHGRGRCEEGRCLCDPGYTGP------TCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRG 711          

HSP 4 Score: 98.2117 bits (243), Expect = 4.518e-19
Identity = 164/603 (27.20%), Postives = 237/603 (39.30%), Query Frame = 3
Query: 1878 KCICSPGYSMINNICDKTYSNFKCVPPCHIDATCYENNMCICNSGHQGDGXXXXXXXXXXXXAECYPEISKCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGD--GINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTC-IKSCDKICHKDALCQNSRCICKPNFEGD--GVNYC-FDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDK----TNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGD--GVETCFHCSQCDSNAICDQNNKACICKSGFEGNGINC-LRAINCKQKCHKQARCLLGKCICNKGLNGN--GVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGNCKCNNNLIGD--GISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEEKCECMERFEGD--GFTCQDKVDCSSRCGENAFCYNGTCKCKLGFQG 3629
            +C+C PGY+     C          P C  D  C     C+     QG                       C C+ GF  SG +C +  +C   C +   C  G C C+    GD  G+ SC     C+    C     RC C PGYTG    C ++SC + C +   C++ RC+C P + G+  G   C +DC +  +        G C C P Y G+   +C T      C   C     C  +  C C   Y G+       DC       DC++     +G C C  G+   G  C    C   C  + +C +G C+C  G+SG+  GV +C     C     C+     C+C  G+ G   +C  RA  C   C  + RC+ G+C+CN G  G   G   C     C  +  C      C C++G+ G+    +    C   C  +  C++G C C +   G+  G+  C   + CS +  C   +  CIC  GY       ++TC  +CH    C+EG C C  G TG         + C    +C+  +  C C   + G+  G        C   CG    C  G C C  GF+G
Sbjct:  201 RCVCFPGYT--GPSCG--------WPSCPGD--CQGRGRCV-----QG----------------------VCVCRAGF--SGPDCSQR-SCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSC--PRGCSQRGRCE--NGRCVCNPGYTGE--DCGVRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVD-----GRCVCWPGYTGE---DCSTR----TCPRDCRGRGRCE-DGECICDTGYSGD-------DCGVRSCPGDCNQRGRCEDGRCVCWPGY--TGTDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSC--PGDCRGRGRCESGR--CMCWPGYTGR--DCGTRA--CPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPG--DCRGHGLC--EDGVCVCDAGYSGEDCSTR---SCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQC--PNDCSQHGVC--QDGVCICWEGYVSEDC-SIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCV--QGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRG 711          

HSP 5 Score: 96.2857 bits (238), Expect = 1.788e-18
Identity = 170/584 (29.11%), Postives = 237/584 (40.58%), Query Frame = 3
Query: 4794 CVNGQCQCQSGLQGNPLKHCFDCRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGD--GINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNP------LQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICLPGFTGD--GTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQG-------------------------NPMQHCFDCKK------CHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPGFIGD--GIKFCF-DCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENC-VKIGPESICPNXXXXXXXXXXXXXXXLQGFSGD--GIKTCFNCSSCSIEAICVPDQEKCICKAGFSGN--GEQCVENIEG 6398
            CV G C C++G  G         R C     C  E  RC+C  G+ GD  +C  ++ C   C +   C N  CVC P Y G+  G+  C     C +   C+  + RC C  G+TG      +    C   CGE  +CV+G+C C PG  G         + C    RC+        + +C+C  GY G+   C  V  C   C+    C +  C+C PG+TG   G+R C     C     C  E   C+C  GY  +G  C   V  C   C    +C +G+C C PG  G                         NP     DC        C     C+  +  CVC  GY  +G  C+    C   C     C++ +C+C  G+ G+  G++ C  DCS      + V +   C C + Y   +  CS I+    C S CH   +C +G C C PG+ G         + C     C   Q  C+C   Y   GE+C  +  P S CP  C  +  C   +C C++GF G    I+TC     C     C      C+CK G++G   GE+ V  IEG
Sbjct:  228 CVQGVCVCRAGFSGPDCSQRSCPRGCSQRGRC--EGGRCVCDPGYTGD--DCG-MRSCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSCPR--GCSQRGRCK--DGRCVCDPGYTGEDCGTRS----CPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCE--------DGECICDTGYSGD--DC-GVRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRAC--PRDCRGRGRC--ENGVCVCNAGY--SGEDCG--VRSCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCE--DGVCVCDAGY--SGEDCS-TRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCS-----QHGVCQDGVCICWEGYVSED--CS-IR---TCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCV--QGVCLCHVGY--GGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTC--PGDCRGRGEC--HDGSCVCKDGYAGEDCGEE-VPTIEG 754          

HSP 6 Score: 93.5893 bits (231), Expect = 1.104e-17
Identity = 122/460 (26.52%), Postives = 176/460 (38.26%), Query Frame = 3
Query: 2088 KCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGD--GINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKSCDKICHKDALCQNSRCICKPNFEGD--GVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDK----TNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGD--GVETCFHCSQCDSNAICDQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGD--GIQCKLLPLCTPACHPQASCINGNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGD 3431
            +C C PG+ G     R    C   C     C +G C C+    GD  G+ SC     CN    C   + RC C PGYTG      ++C + C     C+N  C+C   + G+  GV  C     C    +C  ++G C C P Y G    +C T    G+C         C V+  C C   + G        DC       DC       +G C C  G+ G+   C+   C   C  + QC+DG+C+C+ G+SG+  GV  C   + C  + +C   +  CIC  G+     +      C   CH + RC  G+C+C+ G  G           C    +C+  Q  C C+ G+ G+  G +      C   C P+  C  G C C     G       DC                             ++TC   C     C +G+C C +G  G+
Sbjct:  356 RCVCWPGYTGEDCSTR---TCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPG--DCNQRGRCE--DGRCVCWPGYTGTDCGS-RACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSC--PGDCRGRGRC--ESGRCMCWPGYTG---RDCGTRACPGDC----RGRGRC-VDGRCVCNPGFTGE-------DCGSRRCPGDCRGHGLCEDGVCVCDAGYSGE--DCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQC--PNDCSQHGVC--QDGVCICWEGYVSEDCSIR---TCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCV--QGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGP------DC----------------------------AIQTCPGDCRGRGECHDGSCVCKDGYAGE 743          

HSP 7 Score: 90.8929 bits (224), Expect = 7.292e-17
Identity = 136/502 (27.09%), Postives = 199/502 (39.64%), Query Frame = 3
Query: 1878 KCICSPGYSMINNICDKTYSNFKCVPPCHIDATCYENNMCICNSGHQGDG-XXXXXXXXXXXXAECYPEISKCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGD--GINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKSCDKICHKDALCQNSRCICKPNFEGD--GVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDK----TNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGD--GVETCFHCSQCDSNAICDQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGD--GIQCKLLPLCTPACHPQASCINGNCKCNNNLIGD--GISSC-FDCDKCSMNARCDVSNQRCICQPGYEGN 3335
            +C+C+PGY+     C        C   C     C ++  C+C+ G+ G+          C     C     +C C PG+ G     R    C   C     C +G C C+    GD  G+ SC     CN    C   + RC C PGYTG      ++C + C     C+N  C+C   + G+  GV  C     C    +C  ++G C C P Y G    +C T    G+    C     C V+  C C   + G        DC       DC       +G C C  G+ G+   C+   C   C  + QC+DG+C+C+ G+SG+  GV  C   + C  + +C   +  CIC  G+     +      C   CH + RC  G+C+C+ G  G           C    +C+  Q  C C+ G+ G+  G +      C   C P+  C  G C C     G    I +C  DC       R +  +  C+C+ GY G 
Sbjct:  294 RCVCNPGYT--GEDC----GVRSCPRGCSQRGRC-KDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCV--DGRCVCWPGYTGEDCSTR---TCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPG--DCNQRGRCE--DGRCVCWPGYTGTDCGS-RACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSC--PGDCRGRGRC--ESGRCMCWPGYTG---RDCGTRACPGD----CRGRGRC-VDGRCVCNPGFTGE-------DCGSRRCPGDCRGHGLCEDGVCVCDAGYSGE--DCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQC--PNDCSQHGVC--QDGVCICWEGYVSEDCSIR---TCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCV--QGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDC-----RGRGECHDGSCVCKDGYAGE 743          

HSP 8 Score: 79.7221 bits (195), Expect = 1.843e-13
Identity = 171/641 (26.68%), Postives = 228/641 (35.57%), Query Frame = 3
Query: 8988 CVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDGIICRL-PDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGNGYSGCFDCSKCHANADCDESKGCT-----CKPGFEGNGCYCR--PEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNNCVCKTGYSGTGLNCKPNDQCSQNSDCPEP---NSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICITQTCYCVPGYFGD--GIKSCTSCSVCHKNAQCLPDRGCVCKSDFIGDGFNCR--PLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDGINCQRPFECGI---DNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGDGIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVD-KGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQLGVCVCKDGYS--------PSVNGL 10829
            CVC++ F  S   C   +C   C +   CE G C C  GY GD    R  P  C     C  EN  CV          C  G+  +                      C    C   C +   C  G C C P + G       DC       DC E   C      C PG+ G  C  R  P D C+    C D              C+C  G +      C +  CP  C++   C    CVC  GY+GT         C   + CP       RCE     N  CVC  G+  ++  C  + C   C     C +  C C PGY G   G ++C     C    +C+  R CVC   F G+    R  P D CR +  C D   +C+ +       C+ +              C   C    +C  G C C  G+ G+        +CG+    N C  Q  VCQ        VC+C  G+  ++  C    CP NCH   +C+ G+C+C     G    T    + C  R  C    C C  GY G       ED  Q +         C P    +  +C C  GF   +  C+   C   C    +C  G CVCKDGY+        P++ G+
Sbjct:  233 CVCRAGF--SGPDCSQRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPRGCSQRGRC--ENGRCV----------CNPGYTGED---------------------CGVRSCPRGCSQRGRCKDGRCVCDPGYTGE------DCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRD-CRGRGRCED------------GECICDTGYS---GDDCGVRSCPGDCNQRGRCEDGRCVCWPGYTGT--------DCGSRA-CPRDCRGRGRCE-----NGVCVCNAGYSGED--CGVRSCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGD--CRGRGRCVDGR-CVCNPGFTGEDCGSRRCPGD-CRGHGLCED--GVCVCDAGYSGEDCSTR-------------SCPGGCRGRGQCLDGRCVCEDGYSGE--------DCGVRQCPNDCS-QHGVCQ------DGVCICWEGY--VSEDCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGG-------EDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPD--CAIQTCPGDCRGRGECHDGSCVCKDGYAGEDCGEEVPTIEGM 755          

HSP 9 Score: 77.0258 bits (188), Expect = 1.064e-12
Identity = 186/734 (25.34%), Postives = 270/734 (36.78%), Query Frame = 3
Query: 3267 CSMNARCDVSNQRCICQPGYEG--------------NGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDCSSR-----CGENAFCYNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGD--GTTYCFNCSSCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFDC------KRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGD--GINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGD--GVQSCFDCSICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNP--LKHCFDCRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPH----NNRCTCYQGFTGNGLTCNAIEL---KCEPSCGENAKCVNGKCECLPGLQGN--PLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGN 5342
            CS++   D+S   C C+PG+ G              +      +C   C+    C  G C C  G TG    +      C    +C+  +  C C   F G         DCS R     C +   C  G C C  G+ G+      DC +                           C   C    +C  GRC C     G+  G   C     C++   CK     C C  GY   G +C   S  C  +CG   +C++G+C C  G  G       DC      + C     C+  +  C+C +GY G+   C  + +C   C+  G CE+  C C PG  G   G   C     C     CE  N  CVC+ G++  G+ C +    +C   C  + +C  G+C C PG  G   G ++C     C     C     +CVCNPG+ G+                    C +R+C  +                C    LC  +   C C + +   G+ C+ R+  C   C     C++G+C C+ G  G    ++ C +   C    VC  ++  CIC  G+  +  +C  I+ C   CH    C    C+C P Y G        C++    ADC          C C+ G+ G    C   E     C   CG    C  G+C C+ G +G    +Q C     C    +C   +  CVCK+GY G 
Sbjct:  143 CSLHGVFDLSRCTCSCEPGWGGPTCSDPTDAEIPPSSPPSASGSCPDDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV--QGVCVCRAGFSGP--------DCSQRSCPRGCSQRGRCEGGRCVCDPGYTGD------DCGMRS-------------------------CPRGCSQRGRCENGRCVCNPGYTGEDCGVRSCPR--GCSQRGRCK--DGRCVCDPGYT--GEDCGTRS--CPWDCGEGGRCVDGRCVCWPGYTGE------DCSTRTCPRDCRGRGRCE--DGECICDTGYSGD--DC-GVRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRAC--PRDCRGRGRCE--NGVCVCNAGYS--GEDCGVR---SCPGDCRGRGRCESGRCMCWPGYTGRDCGTRAC--PGDCRGRGRCV--DGRCVCNPGFTGE-------------------DCGSRRCPGD----------------CRGHGLC--EDGVCVCDAGY--SGEDCSTRS--CPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPND--CSQHGVC--QDGVCICWEGYVSE--DC-SIRTCPSNCHGRGRCEEGRCLCDPGYTGP------TCATRMCPADCRGRGRCVQGVCLCHVGYGGE--DCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPG--DCRGRGECH--DGSCVCKDGYAGE 743          

HSP 10 Score: 75.485 bits (184), Expect = 3.165e-12
Identity = 168/627 (26.79%), Postives = 256/627 (40.83%), Query Frame = 3
Query: 5376 NKCDSNALCVNRHCICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNP--MQHCFDCKKCHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPGFIGD--GIKFC-FDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGD--GIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGD--GIKTCFNCSSCSIEAICVPDQEKCICKAGFSGN--GEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCST--CPPNSDC----LPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGD--GIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDG-FRCYPVILECP-KCHYRAQCVIGKCQCKNGLQGD--GINFCMNCSECDKNAQCFPNFSKCECRQGYRGD 7187
            + C+    CV   C+C PG+TG    +      C     C+  +  C+C+ G+  +G  C      C  GC +  +C  G+C C PG  G+   M+ C   + C +   C+  N +CVC  GY G    C  +  C   C++   C + +C+C PG+ G+  G + C +DC        CV     C C   Y   +  CS       C   C    +C  G C C  G+ GD  G++ C     C++   C     RCVC P Y+G   +C        CP  C  + +C+   C C  G+SG+  G+++C     C     C  +  +C+C  G++G   G +           C      V+ +C+C PGF G+      DC +  CP   DC    L ++  C+C   Y   D        T  C   C     C+  +C C  G+ G+  G++ C   + C  +  C  +   C+C  G+       D    TC   C   G C   +C C+ G  G    +    + C    +C   V  C+C +GY G+   +  P    CP  C  R  C  G+C C  G +G    I  C    +C    +C  +   C C+ GY G+
Sbjct:  189 DDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV--QGVCVCRAGF--SGPDCS--QRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSC--PRGCSQRGRCE--NGRCVCNPGYTGED--CG-VRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCG---EGGRCV--DGRCVCWPGYTGED--CSTRT----CPRDCRGRGRCEDGECICDTGYSGDDCGVRSC--PGDCNQRGRC--EDGRCVCWPGYTGT--DCGS----RACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSC--PGDCRGRGRC--ESGRCMCWPGYTGRDCGTRACPG------DCRGRGRCVDGRCVCNPGFTGE------DCGSRRCP--GDCRGHGLCEDGVCVCDAGYSGEDCS------TRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQC--PNDCSQHGVC--QDGVCICWEGYVSE----DCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGV--CLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPG--DCRGRGEC--HDGSCVCKDGYAGE 743          

HSP 11 Score: 75.0998 bits (183), Expect = 4.352e-12
Identity = 171/673 (25.41%), Postives = 248/673 (36.85%), Query Frame = 3
Query: 6621 CHHYASCVQDKCECLPGFIGDGIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGD--GVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGD--GFRCYPVILECPK-CHYRAQCVIGKCQCKNGLQGD--GINFC-MNCSE----CDKNAQCFPNFS----------------------KCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGN--GVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGD--GKNYC-FDCK---RCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGDGFSFCFNCSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDC-RKCHEKATCNIRSMKCECLPGYIGNG-------FECISITSCTQS----------SDCIR-------------PNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSS 8420
            C+    CV+ +C C PG+ G    +      C     CV  Q  CVC+ GF G     D  + +C   C+  G C   +C C+ G  GD  G+ SC     C    +C     +C+C  GY G+  G R       CP+ C  R +C  G+C C  G  G+  G   C  +C E     D    C+P ++                      +C C  GY GD  +C  +  C   C+Q   C +  C C P YTG   G   C     C     C  +  +CVC  G++G     +    SC  +C     C    C+C  G +G   G   C  DC+   RC         + RCVC P F G+   C       C  DC  + +  +  C C  G+ G+  S       C     C     +C C++ ++G    C  ++C   CS+   +C    C C  G + +  +   C   CH +  C     +C C PGY G          +C     C Q            DC +             P E+C     QC+C    F  P    C    C   C  +  C  G C+C      DGY   A E+C  +   ++   +   ++++++       G V   + Q   P   GA       V SS
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV--QGVCVCRAGFSGP----DCSQRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPR--GCSQRGRC--ENGRCVCNPGYTGEDCGVRS------CPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCEDGECICDTGYSGD--DC-GVRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRACPR--DCRGRGRC--ENGVCVCNAGYSGEDCGVR----SCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGDCRGRGRC--------VDGRCVCNPGFTGE--DCG---SRRCPGDCRGHGLCEDGVCVCDAGYSGEDCSTRSCPGGCRGRGQCLD--GRCVCEDGYSGED--CGVRQCPNDCSQH-GVCQDGVCICWEGYVSEDCSIRTCPSNCHGRGRCE--EGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAG--QCVC-VEGFRGPD---CAIQTCPGDCRGRGECHDGSCVCK-----DGY---AGEDCGEEVPTIEGMRMHLLEETTVRTEWTPAPGPVDAYEIQF-IPTTEGASPPFTARVPSS 801          

HSP 12 Score: 72.0182 bits (175), Expect = 3.341e-11
Identity = 169/622 (27.17%), Postives = 251/622 (40.35%), Query Frame = 3
Query: 5997 CHKNAKCLKGNCECLPGFVGD--GIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGD--GIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGD--GKNFC-FDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGD--GIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGN--GNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGD--GVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGD--GFRCYPVILECP-KCHYRAQCVIGKCQCKNGLQGD--GINFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGN--GVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGD------------GKNYCF-------------DCKRCDQNAI-----CRPTE----QRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGD 7700
            C+   +C++G C C PG+ G   G   C     C     C   Q  CVC+  +SG   +C     +  CP  C ++ +C+  +C C  G++GD  G+++C     CS    C  +  +C+C  G++G  E C   +      C       + +C+C PG+ G+  G   C +DC        C+  + RC+C   Y   D        T  C   C     C   +C C  G+ GD  G++ C     C+    C  E  +CVC  G+ G   G++       C   C   G C N  C CN+G  G+  GV SC     C    +C     +C+C  GY G   G R       CP  C  R +CV G+C C  G  G+  G   C    +C  +  C      C C  GY   G++C     C   C     C++  C C   Y+G   GV  C N   C  + +C+  + +C+C +G+     + +    +C +NCH    C +  C+C  G +G             G+  C              DC + +  A      C P E     +CVC   FRG    CA+    TC  DC       +  C CK+G+ G+
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPSC--PGDCQGRGRCV--QGVCVCRAGFSG--PDCS----QRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPR--GCSQRGRC--ENGRCVCNPGYTG--EDC--GVRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGE---GGRCV--DGRCVCWPGYTGEDCS------TRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSC--PGDCNQRGRC--EDGRCVCWPGYTGTDCGSRA------CPRDCRGRGRCENGVCVCNAGYSGEDCGVRSC--PGDCRGRGRC--ESGRCMCWPGYTGRDCGTRA------CPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPG--DCRGHGLC--EDGVCVCDAGY--SGEDC-STRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVCQ--DGVCICWEGYVSEDCSIR----TCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGP--DCAIQ---TCPGDCRGRGECHDGSCVCKDGYAGE 743          

HSP 13 Score: 70.8626 bits (172), Expect = 7.537e-11
Identity = 167/670 (24.93%), Postives = 224/670 (33.43%), Query Frame = 3
Query: 8157 CHPKAVCVKGKCICNRNLVGD--GYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGD--GMTTCTDCSGCDKNAICTEKQGCICKSGFIGDG-------RQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRI-EDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDGIICRL-PDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGN--------------------------GYSGCFDCSK------CHANADCDESKGCTCKPGFEGNGCYCR--PEDKCKFNSDCNDPLKICVQ---SPD----------------TSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNNCVCKTGYSGTGLNCKPNDQCSQN----SDCPE---PNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICITQTCYCVPGYFGD 9947
            C+ +  CV+G+C+C     G   G+    P +C     CVQ              +C C+ G        C + +C   C  +  C        RC+C PG+ GD  GM +C    GC +   C E   C+C  G+ G+        R C     C D                      +C C  G+      C   SC + C +   C+  +C C PG  G      T   +C  +  C D   C+C  GYSGD    R     C+    C D             RCVC   +  ++  C    C   C     CENGVC C  GY G+    R  P +C+    C+            S  C C  G+  +                      C    C   C     CV G C C P F G                           GYSG  DCS       C     C + + C C+ G+ G  C  R  P D C  +  C D + IC +   S D                    C+C PG T  T   C    CP  C     C+   C+C  GY G        + C Q     S CP    P   C   +     CVC+ GF+  +  C+ + C   C     C   +C C  GY G+
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPS-CPGDCQGRGRCVQ-------------GVCVCRAGFSGP---DCSQRSCPRGCSQRGRCEGG-----RCVCDPGYTGDDCGMRSCP--RGCSQRGRC-ENGRCVCNPGYTGEDCGVRSCPRGCSQRGRCKDG---------------------RCVCDPGYT--GEDCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCEDGE-CICDTGYSGDDCGVRSCPGDCNQRGRCED------------GRCVCWPGYTGTD--CGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCRGRGRCE------------SGRCMCWPGYTGRD---------------------CGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCEDGVCVCDAGYSG-EDCSTRSCPGGCRGRGQCLDGR-CVCEDGYSGEDCGVRQCPND-CSQHGVCQDGVCICWEGYVSEDCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPT---CATRMCPADCRGRGRCVQGVCLCHVGYGG--------EDCGQEEPPASACPGGCGPRELCRAGQ-----CVCVEGFRGPD--CAIQTCPGDCRGRGECHDGSCVCKDGYAGE 743          

HSP 14 Score: 69.3218 bits (168), Expect = 2.630e-10
Identity = 166/643 (25.82%), Postives = 232/643 (36.08%), Query Frame = 3
Query: 5787 CNENALCVNQKCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGD--GIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCST--CPPNSDCLP----QEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGD--GIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNG-------------NKCDKIESTCEPPCA---------PG-----GFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGFRCYPVILECPK-CHYRAQCVIGKCQCKNGLQGD--GINFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTG-------------------NGVSFCF------NCAQCDANAI-----CKPDE----NLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGD 7493
            CN+   CV  +C+C PG+ G    +      C     CV  +  C C   +   +  CS       C   C +  +C  G C C PG+ GD  G++ C     C +   C     RCVC P Y+G  E+C                                 G+++C     CS    C     +C+C  G++G  E C          C      V+ +C+C PG+ G+      DCST  CP   DC      ++  CIC   Y  +D           C   C+    C   +C C PG+ G   G + C +   C     C  E   CVC  G+ G                +C+     C P            PG     G C + +C CN G  G+   S      C  +  C   V  C+C  GY G+   C      CP  C  R QC+ G+C C++G  G+  G+  C N  +C ++  C      C C +GY  +  +C  I  C   CH    C    C C P YTG                    GV  C       +C Q +  A      C P E      CVC +GF G     +    +C  +C     C   SC+CK G +G+
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV--QGVCVCRAGFSGPD--CSQRS----CPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPRG--CSQRGRC--ENGRCVCNPGYTG--EDC---------------------------------GVRSCPR--GCSQRGRC--KDGRCVCDPGYTG--EDC--GTRSCPWDCGEGGRCVDGRCVCWPGYTGE------DCSTRTCP--RDCRGRGRCEDGECICDTGYSGDDCGVR------SCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRACPR--DCRGRGRC--ENGVCVCNAGYSGEDCGVRSCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCEDGV--CVCDAGYSGE--DCS--TRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVC--QDGVCICWEGYVSE--DC-SIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQ----TCPGDCRGRGECHDGSCVCKDGYAGE 743          

HSP 15 Score: 67.781 bits (164), Expect = 7.255e-10
Identity = 174/631 (27.58%), Postives = 247/631 (39.14%), Query Frame = 3
Query: 5586 CGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNK----KCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPGFIGD--GIKFCFDCSACPANSNCVPEKKECKCAKDYFMNE-KICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGD--GIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGD--GIKTCFNCSSCSIEAICVPDQEKCICKAGFSGN---GEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCS--TCPPNSDCLPQEQ----RCICKKDYFMNDTQCIHTGR---TPQCVPKCHHYASCVQDKCECLPGFIGD--GIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGD--GVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGFRCYPVILECPK-CHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGD--GKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGN 7388
            C +  +CV G+C C PG  G        C       DC    +     CVC+ G+  +G  C+    C   C++   C   +C+C PG+ GD  G++ C     C     C  E   C C   Y   +  + S       C   C +  +C  G C C PG+ G+  G + C     C +   C     RCVC P Y+G  E+C        CP  C  + +C+  +C C  G+SGD  G+++C     C+    C  +  +C+C  G++G       C  +  G   +C       N  C+C  G+ G+      DC   +CP   DC  + +    RC+C   Y         TGR   T  C   C     CV  +C C PGF G+  G + C     C  +  C  E   CVC  G+  +G  C     +C   C   G C + +C C  G  G+  GV  C N   C  +  C   V  CIC  GY  +   C   I  CP  CH R +C  G+C C  G  G      M  ++C    +C      C C  GY G+  G+       C   C    +C    C C+  + G   +       C     C   +  CVC  G+ G 
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGP------SCGWPSCPGDCQGRGRCVQGVCVCRAGF--SGPDCS-QRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSC--PRGCSQRGRC--ENGRCVCNPGYTGEDCGVRS-------CPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSC--PWDCGEGGRCV--DGRCVCWPGYTG--EDCST----RTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSC--PGDCNQRGRC--EDGRCVCWPGYTGTDCGSRACPRDCRGRG-RCE------NGVCVCNAGYSGE------DCGVRSCP--GDCRGRGRCESGRCMCWPGY---------TGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRC--PGDCRGHGLC--EDGVCVCDAGY--SGEDCST--RSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVCQDGV--CICWEGYVSE--DCS--IRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGV--CLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRGRGECH--DGSCVCKDGYAGE 743          

HSP 16 Score: 63.929 bits (154), Expect = 1.036e-8
Identity = 175/714 (24.51%), Postives = 247/714 (34.59%), Query Frame = 3
Query: 10209 CHKNAKCEGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGD--GIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQT-EDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNFAYCRQKVCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPINCYQPCHKNAYCNIGVCTCNPDYIGDGITS------CKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCDPNAVCVLGECICKVGFTGN--GLQCMPTSKCNPLSGCSDTNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVCEPSCHPKAACIIGSCICMKPLIGNGITECKLPDECSASV---HCKNKNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNV---DCPTRKICVNSKCICPEQY 12299
            C+   +C  G C C  G+ G   +C  P  C  D         CQ      + VCVC  GF      C    CP  C    +C+ G+CVC     GD  G+R+C +   C  R  C    C C PGY G     ++    C     C+D             +C C PG++ E+  C   +C   CG+  +C  G CVC  GY+    G  CS          CP     C   G  +   C+C  G+   S   C   +CP  C+    C    C C  G+ G       DC                          R+C P+D CR    C +   VC   Y    C  +               C   C     C  G+C C PG+      T   P DC       C                CVC  GF  +   C    C   C  +  C  GVC C+  Y G+  ++      C+ +  CL+                   C C  GY  ++  C  ++C   C  + VC  G CIC  G+      ++  P S C+    C +               C+C PGY   +    C   +C   C  +  C+ G C+C    +G G  +C   +E  AS     C  +   C+       +C+C  GF+          +C +     DC  R  C +  C+C + Y
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGP--SCGWP-SCPGD---------CQGRGRCVQGVCVCRAGFS--GPDCSQRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPR--GCSQRGRCENGRCVCNPGYTGEDCGVRSCPRGCSQRGRCKD------------GRCVCDPGYTGED--CGTRSCPWDCGEGGRCVDGRCVCWPGYT----GEDCS-------TRTCP---RDCRGRGRCEDGECICDTGY---SGDDCGVRSCPGDCNQRGRCEDGRCVCWPGYTGT------DCG------------------------SRAC-PRD-CRGRGRCENGVCVCNAGYSGEDCGVRS--------------CPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGDC--RGRGRC------------VDGRCVCNPGFTGED--CGSRRCPGDCRGHGLCEDGVCVCDAGYSGEDCSTRSCPGGCRGRGQCLDGR-----------------CVCEDGYSGED--CGVRQCPNDCSQHGVCQDGVCICWEGYVSEDCSIRTCP-SNCHGRGRCEEGR-------------CLCDPGYTGPT----CATRMCPADCRGRGRCVQGVCLCH---VGYGGEDCGQ-EEPPASACPGGCGPRE-LCRAG-----QCVCVEGFR--------GPDCAIQTCPGDCRGRGECHDGSCVCKDGY 740          

HSP 17 Score: 62.003 bits (149), Expect = 3.613e-8
Identity = 169/630 (26.83%), Postives = 233/630 (36.98%), Query Frame = 3
Query: 7359 CVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKR------CDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGD--GFSFCFNCSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDC-RKCHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICNRNLVGDGYQCRA-PEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLV-RDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGD--GMTTCT-DCSGCDKNAICTEKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSGDG-------IQCRIEDQCSL----------NSDCTD-------------PNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGD 9116
            CVC  G+TG   +C    PSC  +C     C +  C+C++G SG       DC +      C Q   C     RCVC P + GD   C +    +C   C       N  C C  G+ G+  G   C     CS    C     +C C   +TG    C  + C   C E    C+  +C C PG  G+  +   C R C  +  C     +C C  GY G+  +C  + SC    DC   N+       +C+C            C +  C   C  +  C  G C+CN    G+    R+ P +C     C    E  R         C C  G   RD    C   AC G C  +  CV     + RC+C PGF G+  G   C  DC G   + +C E   C+C +G+ G+        +C+  S     RGR  +C+       +C C  G+      C    C   C+++ VC    C C  G V       T  S CH +  C + R C+C  GY+G           CR   +C              DC               P ++C        +CVC   F   +  C   TC   C     C +G C C  GY G+
Sbjct:  202 CVCFPGYTGP--SCGW--PSCPGDCQGRGRCVQGVCVCRAGFSGP------DCSQRSCPRGCSQRGRCE--GGRCVCDPGYTGD--DCGMR---SCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSCPR--GCSQRGRC--KDGRCVCDPGYTGED--CGTRSCPWDCGEG-GRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCE--DGECICDTGYSGD--DC-GVRSC--PGDC---NQRGRCEDGRCVCWPGY----TGTDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCRGRGRC----ESGR---------CMCWPGYTGRD----CGTRACPGDCRGRGRCV-----DGRCVCNPGFTGEDCGSRRCPGDCRG---HGLC-EDGVCVCDAGYSGE--------DCSTRSCPGGCRGRG-QCLDG-----RCVCEDGYS--GEDCGVRQCPNDCSQHGVCQDGVCICWEGYVSEDCSIRTCPSNCHGRGRCEEGR-CLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELC-----RAGQCVCVEGFRGPD--CAIQTCPGDCRGRGECHDGSCVCKDGYAGE 743          

HSP 18 Score: 57.7658 bits (138), Expect = 8.748e-7
Identity = 191/802 (23.82%), Postives = 266/802 (33.17%), Query Frame = 3
Query: 9582 SRNCVCKPGTTP--------STNGKCIILG--------------CPV-------QCDKNAVC-------LSN-NCVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNR----KCVCLPGFQDDNGKCSPKECQPKCHMFAICITQTCYCVPGYFGDGIKSCTSCSVCHKNAQCLPDRGCVCKSDFIGDGFNCRPLDECRINEDC--RDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDGINCQR-PFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGD--GIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDS---DCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNFAYCRQKVCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEECLFGQCQCKPGFIHN--SNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPINCYQPCHKNAYCNIGVCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCDPNAVCVLGECICKVGFTG 11834
            S  C C PGT P        +   +  IL               CP        Q D   +C       LS   C C+ G+ G   +   + +   +S      S  +   D  R    +CVC PG+   +  C    C   C     C+   C C  G+ G      +    C +  +C   R CVC   + GD              DC  R   + C      +N +C C P +      C  + C   C +  +C+ G C C  G+ G+    +  P++CG    C D               CVC  G+      C    CP +C    +C+ G+C+C     GD  G+R+C     C+ R  C    C C PGY G          C   +   DCR R   C  GV     C C  G+S E+  C   +C   C    +C+ G C+C  GY+    G    P D C+    C D              RC+C  GF  +    C    CP  C     C   VC C  G+ G+      DCS              +CPG               CR    C D   VC   Y    C  +               C   C ++  C  G C C  G++    S +TC  P++C  +    C+            +  C+C  G+      C    C   C     C  GVC C+  Y G+               DC         +  P +  CP G                C P  +C  G+C+C  GF G
Sbjct:   82 STGCGCPPGTEPPVLASEVQALRVRLEILEELVKGLKEQCTGGCCPASAQAGTGQTDVRTLCSLHGVFDLSRCTCSCEPGWGGPTCSDPTDAEIPPSSPPSASGSCPDDCNDQGRCVRGRCVCFPGYTGPS--CGWPSCPGDCQGRGRCVQGVCVCRAGFSGPDCSQRSCPRGCSQRGRCEGGR-CVCDPGYTGD--------------DCGMRSCPRGCSQRGRCENGRCVCNPGY--TGEDCGVRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGR-------------CVCWPGY--TGEDCSTRTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSC--PGDCNQRGRCEDGRCVCWPGYTGT--------DCGSRACPRDCRGR-GRCENGV-----CVCNAGYSGED--CGVRSCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGD-CRGRGRCVDG-------------RCVCNPGFTGED---CGSRRCPGDCRGHGLCEDGVCVCDAGYSGE------DCST------------RSCPG--------------GCRGRGQCLDGRCVCEDGYSGEDCGVRQ--------------CPNDCSQHGVCQDGVCICWEGYVSEDCSIRTC--PSNC--HGRGRCE------------EGRCLCDPGYTGP--TCATRMCPADCRGRGRCVQGVCLCHVGYGGE---------------DC--------GQEEPPASACPGG----------------CGPRELCRAGQCVCVEGFRG 711          
BLAST of Neurogenic locus notch-like protein protein 1 vs. Ensembl Human
Match: TNXB (tenascin XB [Source:HGNC Symbol;Acc:HGNC:11976])

HSP 1 Score: 98.9821 bits (245), Expect = 2.717e-19
Identity = 199/708 (28.11%), Postives = 281/708 (39.69%), Query Frame = 3
Query: 3888 CTCKRGYVKDGNNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGD--GINFCFDCSTCDINAFCEPFNERCVCSVGFTGN--GKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSI------CDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNP--LKHC-FDCRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPH----NNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNP--LQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICLPGFTGD--GTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKC---QPIVHECRPGCGENAKCVNGKCECLPGLQGN--PMQHC-FDCK---KCHKFADCDVWNKKCVCKNGYFGN--GYMCTPINGCNLKCNENALCVNQKCICLPGFIGDGIKFCFDCS---ACPANSNCVP 5906
            C C  GY   G +C   S  C  +C    +C+ G C C AG  G    Q    + CSQ   C+    RCVC  GY G+   C  + +C   C   G CEN  C C PG  G+  G+  C     C     C+  + RCVC  G+TG   G +       +C   C +  +CV G+C C PG  G+      DCS       C     C  +  +C+C+ GY GD   C + S  C   C+   +C + +C                        +C+P      C S           RA  C   C     C NG C C +G  G    ++ C  DCR       C  E+ RC+C  G+   GR+C   + C   C     C++  CVC P + G+      +C S     DC  H    +  C C  G++G   +  +    C   C    +C++G+C C  G  G    ++ C N   C +   C   +  C+C  GY+     C S+  C + C     C    C+C PG+TG    TR C   + C     C+  +  C+C  GY   G  C   +P    C  GCG    C  G+C C+ G +G    +Q C  DC+   +CH        +  CVCK+GY G   G     I G  +   E    V  +    PG + D  +  F  +   A P  +  VP
Sbjct:  202 CVCFPGYT--GPSCGWPS--CPGDCQGRGRCVQGVCVCRAGFSGPDCSQRSCPRGCSQRGRCE--GGRCVCDPGYTGD--DC-GMRSCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSC--PRGCSQRGRCK--DGRCVCDPGYTGEDCGTR-------SCPWDCGEGGRCVDGRCVCWPGYTGE------DCSTRTCPRDCRGRGRC--EDGECICDTGYSGD--DCGVRS--CPGDCNQRGRCEDGRC------------------------VCWPGYTGTDCGS-----------RA--CPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCR---GRGRC--ESGRCMCWPGYT--GRDC-GTRACPGDCRGRGRCVDGRCVCNPGFTGE------DCGSRRCPGDCRGHGLCEDGVCVCDAGYSGEDCSTRS----CPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVCQ--DGVCICWEGYVSE--DC-SIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMC--PADCRGRGRCV--QGVCLCHVGY--GGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRGRGECH--------DGSCVCKDGYAGEDCGEEVPTIEGMRMHLLEET-TVRTEWTPAPGPV-DAYEIQFIPTTEGASPPFTARVP 799          

HSP 2 Score: 94.3597 bits (233), Expect = 7.675e-18
Identity = 193/726 (26.58%), Postives = 277/726 (38.15%), Query Frame = 3
Query: 2253 CNTEADCSPYENRCYCRPGYTGN--GFTCIKSCDKICHKDALCQNSRCICKPNFEGDGVNYCFDCSK------CHKLAQCHPKTGNCTCRPPYVGD--GVSECETFLPKGNCFPPCANHAICTVEN-TCQCRKNYYGNPLEKCNIDC--SKCHTDSDCDKTNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGDGVETCFHCSQCDSNAICDQNNKACICKSGFEGN--GINCLRAINCKQKCHKQARCLLGKCICNKGLNGN--GVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGD--GIQCKLLPLCTPACHPQASCINGNCKCNNNLIGD--GISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSL------CDKNAKCLINEEKCECMERFEGDGFTCQD--KVDCSSRCGENAFCYNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGDGTTYCFNCSSCARNSDCKPE----QQTCTCKRGYVKD--GNNCSIISARCHPECGVNAQCINGKCECLAGLQGN--PFQQC-FDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCEN---QECKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCSV 4307
            CN +  C     RC C PGYTG   G+    SC   C     C    C+C+  F G       DCS+      C +  +C  + G C C P Y GD  G+  C    P+G     C+    C  EN  C C   Y G   E C +      C     C   +G C C  G+ G+   C    C   C E  +CVDG+C+C PG++G+   T      C     C+     CIC +G+ G+  G+      +C   C+++ RC  G+C+C  G  G   G   C     C    +C      C CN+G+ G+  G++      C   C  +  C +G C C     G   G  +C     C    RC   + RC+C PG+ G      + C   C    +C++G C C  G +G+      +CS       C    +CL  + +C C      DG++ +D     C + C ++  C +G C C  G+         DC +                        RT C  +CH   +C +GRC C     G        C++    +DC+      Q  C C  GY  +  G      SA C   CG    C  G+C C+ G +G     Q C  DC+   +  D       CVC+ GY G    C + +  +    ++   E     E    PG + D     F  +T        PF  R   S 
Sbjct:  191 CNDQGRC--VRGRCVCFPGYTGPSCGW---PSCPGDCQGRGRCVQGVCVCRAGFSGP------DCSQRSCPRGCSQRGRC--EGGRCVCDPGYTGDDCGMRSC----PRG-----CSQRGRC--ENGRCVCNPGYTG---EDCGVRSCPRGCSQRGRCK--DGRCVCDPGYTGE--DCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCEDGE--CICDTGYSGDDCGVR-----SCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRAC--PRDCRGRGRC--ENGVCVCNAGYSGEDCGVRS-----CPGDCRGRGRCESGRCMCWPGYTGRDCGTRAC--PGDCRGRGRC--VDGRCVCNPGFTGEDCGS-RRCPGDCRGHGLCEDGVCVCDAGYSGE------DCSTRSCPGGCRGRGQCL--DGRCVCE-----DGYSGEDCGVRQCPNDCSQHGVCQDGVCICWEGYVSE------DCSI------------------------RT-CPSNCHGRGRCEEGRCLCDPGYTGP------TCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASA-CPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRGRGECHDGS-----CVCKDGYAGE--DCGEEVPTIEGMRMHLLEETTVRTEWTPAPGPV-DAYEIQFIPTT---EGASPPFTARVPSSA 802          

HSP 3 Score: 88.9669 bits (219), Expect = 2.717e-16
Identity = 136/471 (28.87%), Postives = 190/471 (40.34%), Query Frame = 3
Query: 4794 CVNGQCQCQSGLQGNPLKHCFDC------RPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGD--GINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNP------LQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICLPGFTGD--GTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQG-------------------------NPMQHCFDCKK------CHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPGFIGD--GIKFCF-DCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVG 6056
            CV G C C++G  G       DC      R C     C  E  RC+C  G+ GD  +C  ++ C   C +   C N  CVC P Y G+  G+  C     C +   C+  + RC C  G+TG      +    C   CGE  +CV+G+C C PG  G         + C    RC+        + +C+C  GY G+   C  V  C   C+    C +  C+C PG+TG   G+R C     C     C  E   C+C  GY  +G  C   V  C   C    +C +G+C C PG  G                         NP     DC        C     C+  +  CVC  GY  +G  C+    C   C     C++ +C+C  G+ G+  G++ C  DCS      + V +   C C + Y   +  CS I+    C S CH   +C +G C C PG+ G
Sbjct:  228 CVQGVCVCRAGFSGP------DCSQRSCPRGCSQRGRC--EGGRCVCDPGYTGD--DCG-MRSCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSC--PRGCSQRGRCK--DGRCVCDPGYTGEDCGTRS----CPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCE--------DGECICDTGYSGD--DC-GVRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRAC--PRDCRGRGRC--ENGVCVCNAGY--SGEDCG--VRSCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCE--DGVCVCDAGY--SGEDCS-TRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCS-----QHGVCQDGVCICWEGYVSED--CS-IR---TCPSNCHGRGRCEEGRCLCDPGYTG 644          

HSP 4 Score: 87.4261 bits (215), Expect = 8.629e-16
Identity = 161/605 (26.61%), Postives = 235/605 (38.84%), Query Frame = 3
Query: 1878 KCICSPGYSMINNICDKTYSNFKCVPPCHIDATCYENNMCICNSGHQGDGXXXXXXXXXXXXAECYPEISKCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGD--GINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTC-IKSCDKICHKDALCQNSRCICKPNFEGD--GVNYC-FDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDK----TNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGD--GVETCFHCSQCDSNAICDQNNKACICKSGFEGNGINC-LRAINCKQKCHKQARCLLGKCICNKGLNGN--GVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGNCKCNNNLIGD--GISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGD--GVNFCFNCSLCDKNAKCLINEEKCECMERFEGD--GFTCQDKVDCSSRCGENAFCYNGTCKCKLGFQG 3629
            +C+C PGY+     C        C   C     C +  +C+C +G  G                  P+ S+  C  G                 C +   C  G C C+    GD  G+ SC     C+    C     RC C PGYTG    C ++SC + C +   C++ RC+C P + G+  G   C +DC +  +        G C C P Y G+   +C T      C   C     C  +  C C   Y G+       DC       DC++     +G C C  G+   G  C    C   C  + +C +G C+C  G+SG+  GV +C     C     C+     C+C  G+ G   +C  RA  C   C  + RC+ G+C+CN G  G   G   C     C  +  C      C C++G+ G+    +    C   C  +  C++G C C +   G+  G+  C   + CS +  C   +  CIC  GY       ++TC  +CH    C+EG C C  G TG       C   + C    +C+  +  C C   + G+  G        C   CG    C  G C C  GF+G
Sbjct:  201 RCVCFPGYT--GPSCGWP----SCPGDCQGRGRCVQ-GVCVCRAGFSG------------------PDCSQRSCPRG-----------------CSQRGRCEGGRCVCDPGYTGDDCGMRSC--PRGCSQRGRCE--NGRCVCNPGYTGE--DCGVRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVD-----GRCVCWPGYTGE---DCSTR----TCPRDCRGRGRCE-DGECICDTGYSGD-------DCGVRSCPGDCNQRGRCEDGRCVCWPGY--TGTDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSC--PGDCRGRGRCESGR--CMCWPGYTGR--DCGTRA--CPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPG--DCRGHGLC--EDGVCVCDAGYSGEDCSTR---SCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQC--PNDCSQHGVC--QDGVCICWEGYVSEDC-SIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMC--PADCRGRGRCV--QGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRG 711          

HSP 5 Score: 86.2705 bits (212), Expect = 1.928e-15
Identity = 125/462 (27.06%), Postives = 180/462 (38.96%), Query Frame = 3
Query: 2088 KCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGD--GINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTC-IKSCDKICHKDALCQNSRCICKPNFEGD--GVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDK----TNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGD--GVETCFHCSQCDSNAICDQNNKACICKSGFEGNGINC-LRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGD--GIQCKLLPLCTPACHPQASCINGNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGD 3431
            +C C PG+ G     R    C   C     C +G C C+    GD  G+ SC     CN    C   + RC C PGYTG    C  ++C + C     C+N  C+C   + G+  GV  C     C    +C  ++G C C P Y G    +C T    G+C         C V+  C C   + G        DC       DC       +G C C  G+ G+   C+   C   C  + QC+DG+C+C+ G+SG+  GV  C   + C  + +C   +  CIC  G+     +C +R   C   CH + RC  G+C+C+ G  G           C    +C+  Q  C C+ G+ G+  G +      C   C P+  C  G C C     G       DC                             ++TC   C     C +G+C C +G  G+
Sbjct:  356 RCVCWPGYTGEDCSTR---TCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPG--DCNQRGRCE--DGRCVCWPGYTGT--DCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSC--PGDCRGRGRC--ESGRCMCWPGYTG---RDCGTRACPGDC----RGRGRC-VDGRCVCNPGFTGE-------DCGSRRCPGDCRGHGLCEDGVCVCDAGYSGE--DCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQC--PNDCSQHGVC--QDGVCICWEGYVSE--DCSIR--TCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCV--QGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGP------DC----------------------------AIQTCPGDCRGRGECHDGSCVCKDGYAGE 743          

HSP 6 Score: 81.2629 bits (199), Expect = 5.969e-14
Identity = 139/504 (27.58%), Postives = 203/504 (40.28%), Query Frame = 3
Query: 1878 KCICSPGYSMINNICDKTYSNFKCVPPCHIDATCYENNMCICNSGHQGDG-XXXXXXXXXXXXAECYPEISKCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGD--GINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTC-IKSCDKICHKDALCQNSRCICKPNFEGD--GVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDK----TNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGD--GVETCFHCSQCDSNAICDQNNKACICKSGFEGNGINC-LRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGD--GIQCKLLPLCTPACHPQASCINGNCKCNNNLIGD--GISSC-FDCDKCSMNARCDVSNQRCICQPGYEGN 3335
            +C+C+PGY+     C        C   C     C ++  C+C+ G+ G+          C     C     +C C PG+ G     R    C   C     C +G C C+    GD  G+ SC     CN    C   + RC C PGYTG    C  ++C + C     C+N  C+C   + G+  GV  C     C    +C  ++G C C P Y G    +C T    G+    C     C V+  C C   + G        DC       DC       +G C C  G+ G+   C+   C   C  + QC+DG+C+C+ G+SG+  GV  C   + C  + +C   +  CIC  G+     +C +R   C   CH + RC  G+C+C+ G  G           C    +C+  Q  C C+ G+ G+  G +      C   C P+  C  G C C     G    I +C  DC       R +  +  C+C+ GY G 
Sbjct:  294 RCVCNPGYT--GEDC----GVRSCPRGCSQRGRC-KDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCV--DGRCVCWPGYTGEDCSTR---TCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPG--DCNQRGRCE--DGRCVCWPGYTGT--DCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSC--PGDCRGRGRC--ESGRCMCWPGYTG---RDCGTRACPGD----CRGRGRC-VDGRCVCNPGFTGE-------DCGSRRCPGDCRGHGLCEDGVCVCDAGYSGE--DCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQC--PNDCSQHGVC--QDGVCICWEGYVSE--DCSIR--TCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCV--QGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDC-----RGRGECHDGSCVCKDGYAGE 743          

HSP 7 Score: 68.1662 bits (165), Expect = 6.014e-10
Identity = 172/641 (26.83%), Postives = 229/641 (35.73%), Query Frame = 3
Query: 8988 CVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDGIICRL-PDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGNGYSGCFDCSKCHANADCDESKGCT-----CKPGFEGNGCYCR--PEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNNCVCKTGYSGTGLNCKPNDQCSQNSDCPEP---NSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICITQTCYCVPGYFGD--GIKSCTSCSVCHKNAQCLPDRGCVCKSDFIGDGFNCR--PLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDGINCQRPFECGI---DNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGDGIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVD-KGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQLGVCVCKDGYS--------PSVNGL 10829
            CVC++ F  S   C   +C   C +   CE G C C  GY GD    R  P  C     C  EN  CV          C  G+  +                      C    C   C +   C  G C C P + G       DC       DC E   C      C PG+ G  C  R  P D C+    C D              C+C  G    +   C +  CP  C++   C    CVC  GY+GT         C   + CP       RCE     N  CVC  G+  ++  C  + C   C     C +  C C PGY G   G ++C     C    +C+  R CVC   F G+    R  P D CR +  C D   +C+ +       C+ +              C   C    +C  G C C  G+ G+        +CG+    N C  Q  VCQ   D    VC+C  G+  ++  C    CP NCH   +C+ G+C+C     G    T    + C  R  C    C C  GY G       ED  Q +         C P    +  +C C  GF   +  C+   C   C    +C  G CVCKDGY+        P++ G+
Sbjct:  233 CVCRAGF--SGPDCSQRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPRGCSQRGRC--ENGRCV----------CNPGYTGED---------------------CGVRSCPRGCSQRGRCKDGRCVCDPGYTGE------DCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRD-CRGRGRCED------------GECICDTG---YSGDDCGVRSCPGDCNQRGRCEDGRCVCWPGYTGT--------DCGSRA-CPRDCRGRGRCE-----NGVCVCNAGYSGED--CGVRSCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGD--CRGRGRCVDGR-CVCNPGFTGEDCGSRRCPGD-CRGHGLCED--GVCVCDAGYSGEDCSTR-------------SCPGGCRGRGQCLDGRCVCEDGYSGE--------DCGVRQCPNDCS-QHGVCQ---DG---VCICWEGY--VSEDCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGG-------EDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPD--CAIQTCPGDCRGRGECHDGSCVCKDGYAGEDCGEEVPTIEGM 755          

HSP 8 Score: 67.3958 bits (163), Expect = 1.108e-9
Identity = 175/687 (25.47%), Postives = 252/687 (36.68%), Query Frame = 3
Query: 5787 CNENALCVNQKCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGD--GIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGD--GIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGN--GNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGD--GVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGD--GFRCYPVILECP-KCHYRAQCVIGKCQCKNGLQGD--GINFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGN--GVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGD------------GKNYCF-------------DCKRCDQNAI-----CRPTE----QRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGD 7700
            CN+   CV  +C+C PG+ G    +      C     CV  +  C C   +   +  CS       C   C +  +C  G C C PG+ GD  G++ C     C +   C     RCVC P Y+  GE+C                                 G+++C     CS    C     +C+C  G++G  E C          C      V+ +C+C PG+ G+      DCST               C +D                    C     C   +C C  G+ GD  G++ C     C+    C  E  +CVC  G+ G   G++       C   C   G C N  C CN+G  G+  GV SC     C    +C     +C+C  GY G   G R       CP  C  R +CV G+C C  G  G+  G   C    +C  +  C      C C  GY   G++C     C   C     C++  C C   Y+G   GV  C N   C  + +C+  + +C+C +G+     + +    +C +NCH    C +  C+C  G +G             G+  C              DC + +  A      C P E     +CVC   FRG    CA+    TC  DC       +  C CK+G+ G+
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV--QGVCVCRAGFSGPD--CSQRS----CPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPRG--CSQRGRC--ENGRCVCNPGYT--GEDC---------------------------------GVRSC--PRGCSQRGRC--KDGRCVCDPGYTG--EDC--GTRSCPWDCGEGGRCVDGRCVCWPGYTGE------DCSTR-------------TCPRD--------------------CRGRGRCEDGECICDTGYSGDDCGVRSC--PGDCNQRGRC--EDGRCVCWPGYTGTDCGSRA------CPRDCRGRGRCENGVCVCNAGYSGEDCGVRSC--PGDCRGRGRC--ESGRCMCWPGYTGRDCGTRA------CPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRC--PGDCRGHGLC--EDGVCVCDAGY--SGEDC-STRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVCQ--DGVCICWEGYVSEDCSIR----TCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGP--DCAIQ---TCPGDCRGRGECHDGSCVCKDGYAGE 743          

HSP 9 Score: 67.3958 bits (163), Expect = 1.117e-9
Identity = 186/738 (25.20%), Postives = 271/738 (36.72%), Query Frame = 3
Query: 3267 CSMNARCDVSNQRCICQPGYEG--------------NGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDCSSR-----CGENAFCYNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGD--GTTYCFNCSSCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFDC------KRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCST------CDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGD--GVQSCFDCSICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNP--LKHCFDCRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPH----NNRCTCYQGFTGNGLTCNAIEL---KCEPSCGENAKCVNGKCECLPGLQGN--PLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGN 5342
            CS++   D+S   C C+PG+ G              +      +C   C+    C  G C C  G TG    +      C    +C+  +  C C   F G         DCS R     C +   C  G C C  G+ G+      DC +                           C   C    +C  GRC C     G+  G   C     C++   CK     C C  GY   G +C   S  C  +CG   +C++G+C C  G  G       DC      + C     C+  +  C+C +GY G+   C  + +C   C+  G CE+  C C PG  G       DC +      C     CE  N  CVC+ G+  +G+ C + +   C   C  + +C  G+C C PG  G   G ++C     C     C     +CVCNPG+ G+                    C +R+C  +                C    LC  +   C C + +   G+ C+ R+  C   C     C++G+C C+ G  G    ++ C +   C    VC  ++  CIC  G+  +  +C  I+ C   CH    C    C+C P Y G        C++    ADC          C C+ G+ G    C   E     C   CG    C  G+C C+ G +G    +Q C     C    +C   +  CVCK+GY G 
Sbjct:  143 CSLHGVFDLSRCTCSCEPGWGGPTCSDPTDAEIPPSSPPSASGSCPDDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV--QGVCVCRAGFSGP--------DCSQRSCPRGCSQRGRCEGGRCVCDPGYTGD------DCGMRS-------------------------CPRGCSQRGRCENGRCVCNPGYTGEDCGVRSC--PRGCSQRGRCK--DGRCVCDPGYT--GEDCGTRS--CPWDCGEGGRCVDGRCVCWPGYTGE------DCSTRTCPRDCRGRGRCE--DGECICDTGYSGD--DC-GVRSCPGDCNQRGRCEDGRCVCWPGYTGT------DCGSRACPRDCRGRGRCE--NGVCVCNAGY--SGEDCGVRS---CPGDCRGRGRCESGRCMCWPGYTGRDCGTRAC--PGDCRGRGRCV--DGRCVCNPGFTGE-------------------DCGSRRCPGD----------------CRGHGLC--EDGVCVCDAGY--SGEDCSTRS--CPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPND--CSQHGVC--QDGVCICWEGYVSE--DC-SIRTCPSNCHGRGRCEEGRCLCDPGYTGP------TCATRMCPADCRGRGRCVQGVCLCHVGYGGE--DCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTC--PGDCRGRGECH--DGSCVCKDGYAGE 743          

HSP 10 Score: 65.0846 bits (157), Expect = 5.172e-9
Identity = 173/678 (25.52%), Postives = 249/678 (36.73%), Query Frame = 3
Query: 6621 CHHYASCVQDKCECLPGFIGDGIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGD--GVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGD--GFRCYPVILECPK-CHYRAQCVIGKCQCKNGLQGD--GINFC-MNCSE----CDKNAQCFPNFS----------------------KCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGN--GVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGD--GKNYC-FDCK---RCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGDGFSFCFNCSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCR------KCHEKATCNIRSMKCECLPGYIGNG-------FECISITSCTQS----------SDCIR-------------PNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSS 8420
            C+    CV+ +C C PG+ G    +      C     CV  Q  CVC+ GF  +G  C   + +C   C+  G C   +C C+ G  GD  G+ SC     C    +C     +C+C  GY G+  G R       CP+ C  R +C  G+C C  G  G+  G   C  +C E     D    C+P ++                      +C C  GY GD  +C  +  C   C+Q   C +  C C P YTG   G   C     C     C  +  +CVC  G++G     +    SC  +C     C    C+C  G +G   G   C  DC+   RC         + RCVC P F G+   C       C  DC  + +  +  C C  G+ G+  S       C     C     +C C++ ++G    C  ++C   CS+   +C    C C      +GY   DC        CH +  C     +C C PGY G          +C     C Q            DC +             P E+C     QC+C    F  P    C    C   C  +  C  G C+C      DGY   A E+C  +   ++   +   ++++++       G V   + Q   P   GA       V SS
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV--QGVCVCRAGF--SGPDCS--QRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSC--PRGCSQRGRC--ENGRCVCNPGYTGEDCGVRS------CPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCEDGECICDTGYSGD--DC-GVRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRAC--PRDCRGRGRC--ENGVCVCNAGYSGEDCGVR----SCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGDCRGRGRC--------VDGRCVCNPGFTGE--DCG---SRRCPGDCRGHGLCEDGVCVCDAGYSGEDCSTRSCPGGCRGRGQCLD--GRCVCEDGYSGED--CGVRQCPNDCSQH-GVCQDGVCICW-----EGYVSEDCSIRTCPSNCHGRGRCE--EGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAG--QCVC-VEGFRGPD---CAIQTCPGDCRGRGECHDGSCVCK-----DGY---AGEDCGEEVPTIEGMRMHLLEETTVRTEWTPAPGPVDAYEIQF-IPTTEGASPPFTARVPSS 801          

HSP 11 Score: 62.3882 bits (150), Expect = 3.155e-8
Identity = 169/629 (26.87%), Postives = 257/629 (40.86%), Query Frame = 3
Query: 5376 NKCDSNALCVNRHCICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNP--MQHCFDCKKCHKFADCDVWNKKCVCKNGYFGN--GYMCTPINGCNLKCNENALCVNQKCICLPGFIGD--GIKFC-FDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGD--GIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGD--GIKTCFNCSSCSIEAICVPDQEKCICKAGFSGN--GEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCST--CPPNSDC----LPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGD--GIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDG-FRCYPVILECP-KCHYRAQCVIGKCQCKNGLQGD--GINFCMNCSECDKNAQCFPNFSKCECRQGYRGD 7187
            + C+    CV   C+C PG+TG    +      C     C+  +  C+C+ G+  +G  C      C  GC +  +C  G+C C PG  G+   M+ C   + C +   C+  N +CVC  GY G   G     +  C   C++   C + +C+C PG+ G+  G + C +DC        CV     C C   Y   +  CS       C   C    +C  G C C  G+ GD  G++ C     C++   C     RCVC P Y+G   +C        CP  C  + +C+   C C  G+SG+  G+++C     C     C  +  +C+C  G++G   G +           C      V+ +C+C PGF G+      DC +  CP   DC    L ++  C+C   Y   D  C     T  C   C     C+  +C C  G+ G+  G++ C   + C  +  C  +   C+C  G+       D    TC   C   G C   +C C+ G  G    +    + C    +C   V  C+C +GY G+   +  P    CP  C  R  C  G+C C  G +G    I  C    +C    +C  +   C C+ GY G+
Sbjct:  189 DDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV--QGVCVCRAGF--SGPDCS--QRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSC--PRGCSQRGRCE--NGRCVCNPGYTGEDCG-----VRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCG---EGGRCV--DGRCVCWPGYTGED--CSTRT----CPRDCRGRGRCEDGECICDTGYSGDDCGVRSC--PGDCNQRGRC--EDGRCVCWPGYTGT--DCGS----RACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSC--PGDCRGRGRC--ESGRCMCWPGYTGRDCGTRACPG------DCRGRGRCVDGRCVCNPGFTGE------DCGSRRCP--GDCRGHGLCEDGVCVCDAGYSGED--C----STRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQC--PNDCSQHGVC--QDGVCICWEGYVSE----DCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGV--CLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTC--PGDCRGRGEC--HDGSCVCKDGYAGE 743          

HSP 12 Score: 59.6918 bits (143), Expect = 1.861e-7
Identity = 167/670 (24.93%), Postives = 224/670 (33.43%), Query Frame = 3
Query: 8157 CHPKAVCVKGKCICNRNLVGD--GYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGD--GMTTCTDCSGCDKNAICTEKQGCICKSGFIGDG-------RQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRI-EDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDGIICRL-PDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGN--------------------------GYSGCFDCSK------CHANADCDESKGCTCKPGFEGNGCYCR--PEDKCKFNSDCNDPLKICVQ---SPD----------------TSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNNCVCKTGYSGTGLNCKPNDQCSQN----SDCPE---PNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICITQTCYCVPGYFGD 9947
            C+ +  CV+G+C+C     G   G+    P +C     CVQ              +C C+ G        C + +C   C  +  C        RC+C PG+ GD  GM +C    GC +   C E   C+C  G+ G+        R C     C D                      +C C  G+      C   SC + C +   C+  +C C PG  G      T   +C  +  C D   C+C  GYSGD    R     C+    C D             RCVC   +  ++  C    C   C     CENGVC C  GY G+    R  P +C+    C+            S  C C  G+  +                      C    C   C     CV G C C P F G                           GYSG  DCS       C     C + + C C+ G+ G  C  R  P D C  +  C D + IC +   S D                    C+C PG T  T   C    CP  C     C+   C+C  GY G        + C Q     S CP    P   C   +     CVC+ GF+  +  C+ + C   C     C   +C C  GY G+
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPS-CPGDCQGRGRCVQ-------------GVCVCRAGFSGP---DCSQRSCPRGCSQRGRCEGG-----RCVCDPGYTGDDCGMRSCP--RGCSQRGRC-ENGRCVCNPGYTGEDCGVRSCPRGCSQRGRCKDG---------------------RCVCDPGYT--GEDCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCEDGE-CICDTGYSGDDCGVRSCPGDCNQRGRCED------------GRCVCWPGYTGTD--CGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCRGRGRCE------------SGRCMCWPGYTGRD---------------------CGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCEDGVCVCDAGYSGE-DCSTRSCPGGCRGRGQCLDGR-CVCEDGYSGEDCGVRQCPND-CSQHGVCQDGVCICWEGYVSEDCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPT---CATRMCPADCRGRGRCVQGVCLCHVGYGG--------EDCGQEEPPASACPGGCGPRELCRAGQ-----CVCVEGFRGPD--CAIQTCPGDCRGRGECHDGSCVCKDGYAGE 743          

HSP 13 Score: 56.6102 bits (135), Expect = 1.908e-6
Identity = 179/664 (26.96%), Postives = 259/664 (39.01%), Query Frame = 3
Query: 5586 CGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNK----KCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPGFIGD--GIKFCFDCSACPANSNCVPEKKECKCAKDYFMNE-KICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGD--GIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGD--GIKTCFNCSSCSIEAICVPDQEKCICKAGFSGN---GEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCS--TCPPNSDCLPQEQ----RCICKKDYFMNDTQCIHTGR---TPQCVPKCHHYASCVQDKCECLPGFIGD--GIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGD--GVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGFRCYPVILECPK-CHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGD 7493
            C +  +CV G+C C PG  G        C       DC    +     CVC+ G+  +G  C+    C   C++   C   +C+C PG+ GD  G++ C     C     C  E   C C   Y   +  + S       C   C +  +C  G C C PG+ G+  G + C     C +   C     RCVC P Y+G  E+C        CP  C  + +C+  +C C  G+SGD  G+++C     C+    C  +  +C+C  G++G       C  +  G   +C       N  C+C  G+ G+      DC   +CP   DC  + +    RC+C   Y         TGR   T  C   C     CV  +C C PGF G+  G + C     C  +  C  E   CVC  G+  +G  C     +C   C   G C + +C C  G  G+  GV  C N   C  +  C   V  CIC  GY  +   C   I  CP  CH R +C  G+C C  G  G      M  ++C    +C      C C  GY   G++C + +  +  C                              C    +C+  +  CVC +GF G     +    +C  +C     C   SC+CK G +G+
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGP------SCGWPSCPGDCQGRGRCVQGVCVCRAGF--SGPDCS-QRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSC--PRGCSQRGRC--ENGRCVCNPGYTGEDCGVRS-------CPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSC--PWDCGEGGRCV--DGRCVCWPGYTG--EDCST----RTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSC--PGDCNQRGRC--EDGRCVCWPGYTGTDCGSRACPRDCRGRG-RCE------NGVCVCNAGYSGE------DCGVRSCP--GDCRGRGRCESGRCMCWPGY---------TGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRC--PGDCRGHGLC--EDGVCVCDAGY--SGEDCST--RSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVCQDGV--CICWEGYVSE--DC--SIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGV--CLCHVGY--GGEDCGQEEPPASAC---------------------------PGGCGPRELCRAGQ--CVCVEGFRGPDCAIQ----TCPGDCRGRGECHDGSCVCKDGYAGE 743          
BLAST of Neurogenic locus notch-like protein protein 1 vs. Ensembl Human
Match: TNXB (tenascin XB [Source:HGNC Symbol;Acc:HGNC:11976])

HSP 1 Score: 98.9821 bits (245), Expect = 2.810e-19
Identity = 199/708 (28.11%), Postives = 281/708 (39.69%), Query Frame = 3
Query: 3888 CTCKRGYVKDGNNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGD--GINFCFDCSTCDINAFCEPFNERCVCSVGFTGN--GKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSI------CDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNP--LKHC-FDCRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPH----NNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNP--LQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICLPGFTGD--GTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKC---QPIVHECRPGCGENAKCVNGKCECLPGLQGN--PMQHC-FDCK---KCHKFADCDVWNKKCVCKNGYFGN--GYMCTPINGCNLKCNENALCVNQKCICLPGFIGDGIKFCFDCS---ACPANSNCVP 5906
            C C  GY   G +C   S  C  +C    +C+ G C C AG  G    Q    + CSQ   C+    RCVC  GY G+   C  + +C   C   G CEN  C C PG  G+  G+  C     C     C+  + RCVC  G+TG   G +       +C   C +  +CV G+C C PG  G+      DCS       C     C  +  +C+C+ GY GD   C + S  C   C+   +C + +C                        +C+P      C S           RA  C   C     C NG C C +G  G    ++ C  DCR       C  E+ RC+C  G+   GR+C   + C   C     C++  CVC P + G+      +C S     DC  H    +  C C  G++G   +  +    C   C    +C++G+C C  G  G    ++ C N   C +   C   +  C+C  GY+     C S+  C + C     C    C+C PG+TG    TR C   + C     C+  +  C+C  GY   G  C   +P    C  GCG    C  G+C C+ G +G    +Q C  DC+   +CH        +  CVCK+GY G   G     I G  +   E    V  +    PG + D  +  F  +   A P  +  VP
Sbjct:  202 CVCFPGYT--GPSCGWPS--CPGDCQGRGRCVQGVCVCRAGFSGPDCSQRSCPRGCSQRGRCE--GGRCVCDPGYTGD--DC-GMRSCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSC--PRGCSQRGRCK--DGRCVCDPGYTGEDCGTR-------SCPWDCGEGGRCVDGRCVCWPGYTGE------DCSTRTCPRDCRGRGRC--EDGECICDTGYSGD--DCGVRS--CPGDCNQRGRCEDGRC------------------------VCWPGYTGTDCGS-----------RA--CPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCR---GRGRC--ESGRCMCWPGYT--GRDC-GTRACPGDCRGRGRCVDGRCVCNPGFTGE------DCGSRRCPGDCRGHGLCEDGVCVCDAGYSGEDCSTRS----CPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVCQ--DGVCICWEGYVSE--DC-SIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMC--PADCRGRGRCV--QGVCLCHVGY--GGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRGRGECH--------DGSCVCKDGYAGEDCGEEVPTIEGMRMHLLEET-TVRTEWTPAPGPV-DAYEIQFIPTTEGASPPFTARVP 799          

HSP 2 Score: 93.9745 bits (232), Expect = 8.276e-18
Identity = 193/726 (26.58%), Postives = 277/726 (38.15%), Query Frame = 3
Query: 2253 CNTEADCSPYENRCYCRPGYTGN--GFTCIKSCDKICHKDALCQNSRCICKPNFEGDGVNYCFDCSK------CHKLAQCHPKTGNCTCRPPYVGD--GVSECETFLPKGNCFPPCANHAICTVEN-TCQCRKNYYGNPLEKCNIDC--SKCHTDSDCDKTNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGDGVETCFHCSQCDSNAICDQNNKACICKSGFEGN--GINCLRAINCKQKCHKQARCLLGKCICNKGLNGN--GVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGD--GIQCKLLPLCTPACHPQASCINGNCKCNNNLIGD--GISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSL------CDKNAKCLINEEKCECMERFEGDGFTCQD--KVDCSSRCGENAFCYNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGDGTTYCFNCSSCARNSDCKPE----QQTCTCKRGYVKD--GNNCSIISARCHPECGVNAQCINGKCECLAGLQGN--PFQQC-FDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCEN---QECKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCSV 4307
            CN +  C     RC C PGYTG   G+    SC   C     C    C+C+  F G       DCS+      C +  +C  + G C C P Y GD  G+  C    P+G     C+    C  EN  C C   Y G   E C +      C     C   +G C C  G+ G+   C    C   C E  +CVDG+C+C PG++G+   T      C     C+     CIC +G+ G+  G+      +C   C+++ RC  G+C+C  G  G   G   C     C    +C      C CN+G+ G+  G++      C   C  +  C +G C C     G   G  +C     C    RC   + RC+C PG+ G      + C   C    +C++G C C  G +G+      +CS       C    +CL  + +C C      DG++ +D     C + C ++  C +G C C  G+         DC +                        RT C  +CH   +C +GRC C     G        C++    +DC+      Q  C C  GY  +  G      SA C   CG    C  G+C C+ G +G     Q C  DC+   +  D       CVC+ GY G    C + +  +    ++   E     E    PG + D     F  +T        PF  R   S 
Sbjct:  191 CNDQGRC--VRGRCVCFPGYTGPSCGW---PSCPGDCQGRGRCVQGVCVCRAGFSGP------DCSQRSCPRGCSQRGRC--EGGRCVCDPGYTGDDCGMRSC----PRG-----CSQRGRC--ENGRCVCNPGYTG---EDCGVRSCPRGCSQRGRCK--DGRCVCDPGYTGE--DCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCEDGE--CICDTGYSGDDCGVR-----SCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRAC--PRDCRGRGRC--ENGVCVCNAGYSGEDCGVRS-----CPGDCRGRGRCESGRCMCWPGYTGRDCGTRAC--PGDCRGRGRC--VDGRCVCNPGFTGEDCGS-RRCPGDCRGHGLCEDGVCVCDAGYSGE------DCSTRSCPGGCRGRGQCL--DGRCVCE-----DGYSGEDCGVRQCPNDCSQHGVCQDGVCICWEGYVSE------DCSI------------------------RT-CPSNCHGRGRCEEGRCLCDPGYTGP------TCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASA-CPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDCRGRGECHDGS-----CVCKDGYAGE--DCGEEVPTIEGMRMHLLEETTVRTEWTPAPGPV-DAYEIQFIPTT---EGASPPFTARVPSSA 802          

HSP 3 Score: 88.9669 bits (219), Expect = 2.930e-16
Identity = 136/471 (28.87%), Postives = 190/471 (40.34%), Query Frame = 3
Query: 4794 CVNGQCQCQSGLQGNPLKHCFDC------RPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGD--GINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNP------LQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICLPGFTGD--GTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQG-------------------------NPMQHCFDCKK------CHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPGFIGD--GIKFCF-DCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVG 6056
            CV G C C++G  G       DC      R C     C  E  RC+C  G+ GD  +C  ++ C   C +   C N  CVC P Y G+  G+  C     C +   C+  + RC C  G+TG      +    C   CGE  +CV+G+C C PG  G         + C    RC+        + +C+C  GY G+   C  V  C   C+    C +  C+C PG+TG   G+R C     C     C  E   C+C  GY  +G  C   V  C   C    +C +G+C C PG  G                         NP     DC        C     C+  +  CVC  GY  +G  C+    C   C     C++ +C+C  G+ G+  G++ C  DCS      + V +   C C + Y   +  CS I+    C S CH   +C +G C C PG+ G
Sbjct:  228 CVQGVCVCRAGFSGP------DCSQRSCPRGCSQRGRC--EGGRCVCDPGYTGD--DCG-MRSCPRGCSQRGRCENGRCVCNPGYTGEDCGVRSC--PRGCSQRGRCK--DGRCVCDPGYTGEDCGTRS----CPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCE--------DGECICDTGYSGD--DC-GVRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRAC--PRDCRGRGRC--ENGVCVCNAGY--SGEDCG--VRSCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCE--DGVCVCDAGY--SGEDCS-TRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPNDCS-----QHGVCQDGVCICWEGYVSED--CS-IR---TCPSNCHGRGRCEEGRCLCDPGYTG 644          

HSP 4 Score: 87.4261 bits (215), Expect = 9.461e-16
Identity = 161/605 (26.61%), Postives = 235/605 (38.84%), Query Frame = 3
Query: 1878 KCICSPGYSMINNICDKTYSNFKCVPPCHIDATCYENNMCICNSGHQGDGXXXXXXXXXXXXAECYPEISKCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGD--GINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTC-IKSCDKICHKDALCQNSRCICKPNFEGD--GVNYC-FDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDK----TNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGD--GVETCFHCSQCDSNAICDQNNKACICKSGFEGNGINC-LRAINCKQKCHKQARCLLGKCICNKGLNGN--GVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGNCKCNNNLIGD--GISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGD--GVNFCFNCSLCDKNAKCLINEEKCECMERFEGD--GFTCQDKVDCSSRCGENAFCYNGTCKCKLGFQG 3629
            +C+C PGY+     C        C   C     C +  +C+C +G  G                  P+ S+  C  G                 C +   C  G C C+    GD  G+ SC     C+    C     RC C PGYTG    C ++SC + C +   C++ RC+C P + G+  G   C +DC +  +        G C C P Y G+   +C T      C   C     C  +  C C   Y G+       DC       DC++     +G C C  G+   G  C    C   C  + +C +G C+C  G+SG+  GV +C     C     C+     C+C  G+ G   +C  RA  C   C  + RC+ G+C+CN G  G   G   C     C  +  C      C C++G+ G+    +    C   C  +  C++G C C +   G+  G+  C   + CS +  C   +  CIC  GY       ++TC  +CH    C+EG C C  G TG       C   + C    +C+  +  C C   + G+  G        C   CG    C  G C C  GF+G
Sbjct:  201 RCVCFPGYT--GPSCGWP----SCPGDCQGRGRCVQ-GVCVCRAGFSG------------------PDCSQRSCPRG-----------------CSQRGRCEGGRCVCDPGYTGDDCGMRSC--PRGCSQRGRCE--NGRCVCNPGYTGE--DCGVRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVD-----GRCVCWPGYTGE---DCSTR----TCPRDCRGRGRCE-DGECICDTGYSGD-------DCGVRSCPGDCNQRGRCEDGRCVCWPGY--TGTDCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSC--PGDCRGRGRCESGR--CMCWPGYTGR--DCGTRA--CPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPG--DCRGHGLC--EDGVCVCDAGYSGEDCSTR---SCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQC--PNDCSQHGVC--QDGVCICWEGYVSEDC-SIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMC--PADCRGRGRCV--QGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRG 711          

HSP 5 Score: 86.2705 bits (212), Expect = 2.079e-15
Identity = 125/462 (27.06%), Postives = 180/462 (38.96%), Query Frame = 3
Query: 2088 KCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGD--GINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTC-IKSCDKICHKDALCQNSRCICKPNFEGD--GVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDK----TNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGD--GVETCFHCSQCDSNAICDQNNKACICKSGFEGNGINC-LRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGD--GIQCKLLPLCTPACHPQASCINGNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGD 3431
            +C C PG+ G     R    C   C     C +G C C+    GD  G+ SC     CN    C   + RC C PGYTG    C  ++C + C     C+N  C+C   + G+  GV  C     C    +C  ++G C C P Y G    +C T    G+C         C V+  C C   + G        DC       DC       +G C C  G+ G+   C+   C   C  + QC+DG+C+C+ G+SG+  GV  C   + C  + +C   +  CIC  G+     +C +R   C   CH + RC  G+C+C+ G  G           C    +C+  Q  C C+ G+ G+  G +      C   C P+  C  G C C     G       DC                             ++TC   C     C +G+C C +G  G+
Sbjct:  356 RCVCWPGYTGEDCSTR---TCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPG--DCNQRGRCE--DGRCVCWPGYTGT--DCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSC--PGDCRGRGRC--ESGRCMCWPGYTG---RDCGTRACPGDC----RGRGRC-VDGRCVCNPGFTGE-------DCGSRRCPGDCRGHGLCEDGVCVCDAGYSGE--DCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQC--PNDCSQHGVC--QDGVCICWEGYVSE--DCSIR--TCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCV--QGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGP------DC----------------------------AIQTCPGDCRGRGECHDGSCVCKDGYAGE 743          

HSP 6 Score: 81.2629 bits (199), Expect = 6.599e-14
Identity = 139/504 (27.58%), Postives = 203/504 (40.28%), Query Frame = 3
Query: 1878 KCICSPGYSMINNICDKTYSNFKCVPPCHIDATCYENNMCICNSGHQGDG-XXXXXXXXXXXXAECYPEISKCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGD--GINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTC-IKSCDKICHKDALCQNSRCICKPNFEGD--GVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDK----TNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGD--GVETCFHCSQCDSNAICDQNNKACICKSGFEGNGINC-LRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGD--GIQCKLLPLCTPACHPQASCINGNCKCNNNLIGD--GISSC-FDCDKCSMNARCDVSNQRCICQPGYEGN 3335
            +C+C+PGY+     C        C   C     C ++  C+C+ G+ G+          C     C     +C C PG+ G     R    C   C     C +G C C+    GD  G+ SC     CN    C   + RC C PGYTG    C  ++C + C     C+N  C+C   + G+  GV  C     C    +C  ++G C C P Y G    +C T    G+    C     C V+  C C   + G        DC       DC       +G C C  G+ G+   C+   C   C  + QC+DG+C+C+ G+SG+  GV  C   + C  + +C   +  CIC  G+     +C +R   C   CH + RC  G+C+C+ G  G           C    +C+  Q  C C+ G+ G+  G +      C   C P+  C  G C C     G    I +C  DC       R +  +  C+C+ GY G 
Sbjct:  294 RCVCNPGYT--GEDC----GVRSCPRGCSQRGRC-KDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCV--DGRCVCWPGYTGEDCSTR---TCPRDCRGRGRCEDGECICDTGYSGDDCGVRSCPG--DCNQRGRCE--DGRCVCWPGYTGT--DCGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSC--PGDCRGRGRC--ESGRCMCWPGYTG---RDCGTRACPGD----CRGRGRC-VDGRCVCNPGFTGE-------DCGSRRCPGDCRGHGLCEDGVCVCDAGYSGE--DCSTRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQC--PNDCSQHGVC--QDGVCICWEGYVSE--DCSIR--TCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCV--QGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTCPGDC-----RGRGECHDGSCVCKDGYAGE 743          

HSP 7 Score: 68.1662 bits (165), Expect = 6.431e-10
Identity = 172/641 (26.83%), Postives = 229/641 (35.73%), Query Frame = 3
Query: 8988 CVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDGIICRL-PDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGNGYSGCFDCSKCHANADCDESKGCT-----CKPGFEGNGCYCR--PEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNNCVCKTGYSGTGLNCKPNDQCSQNSDCPEP---NSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICITQTCYCVPGYFGD--GIKSCTSCSVCHKNAQCLPDRGCVCKSDFIGDGFNCR--PLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDGINCQRPFECGI---DNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGDGIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVD-KGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQLGVCVCKDGYS--------PSVNGL 10829
            CVC++ F  S   C   +C   C +   CE G C C  GY GD    R  P  C     C  EN  CV          C  G+  +                      C    C   C +   C  G C C P + G       DC       DC E   C      C PG+ G  C  R  P D C+    C D              C+C  G    +   C +  CP  C++   C    CVC  GY+GT         C   + CP       RCE     N  CVC  G+  ++  C  + C   C     C +  C C PGY G   G ++C     C    +C+  R CVC   F G+    R  P D CR +  C D   +C+ +       C+ +              C   C    +C  G C C  G+ G+        +CG+    N C  Q  VCQ   D    VC+C  G+  ++  C    CP NCH   +C+ G+C+C     G    T    + C  R  C    C C  GY G       ED  Q +         C P    +  +C C  GF   +  C+   C   C    +C  G CVCKDGY+        P++ G+
Sbjct:  233 CVCRAGF--SGPDCSQRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPRGCSQRGRC--ENGRCV----------CNPGYTGED---------------------CGVRSCPRGCSQRGRCKDGRCVCDPGYTGE------DCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRD-CRGRGRCED------------GECICDTG---YSGDDCGVRSCPGDCNQRGRCEDGRCVCWPGYTGT--------DCGSRA-CPRDCRGRGRCE-----NGVCVCNAGYSGED--CGVRSCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGD--CRGRGRCVDGR-CVCNPGFTGEDCGSRRCPGD-CRGHGLCED--GVCVCDAGYSGEDCSTR-------------SCPGGCRGRGQCLDGRCVCEDGYSGE--------DCGVRQCPNDCS-QHGVCQ---DG---VCICWEGY--VSEDCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGG-------EDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPD--CAIQTCPGDCRGRGECHDGSCVCKDGYAGEDCGEEVPTIEGM 755          

HSP 8 Score: 67.3958 bits (163), Expect = 1.108e-9
Identity = 186/738 (25.20%), Postives = 271/738 (36.72%), Query Frame = 3
Query: 3267 CSMNARCDVSNQRCICQPGYEG--------------NGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDCSSR-----CGENAFCYNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGD--GTTYCFNCSSCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFDC------KRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCST------CDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGD--GVQSCFDCSICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNP--LKHCFDCRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPH----NNRCTCYQGFTGNGLTCNAIEL---KCEPSCGENAKCVNGKCECLPGLQGN--PLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGN 5342
            CS++   D+S   C C+PG+ G              +      +C   C+    C  G C C  G TG    +      C    +C+  +  C C   F G         DCS R     C +   C  G C C  G+ G+      DC +                           C   C    +C  GRC C     G+  G   C     C++   CK     C C  GY   G +C   S  C  +CG   +C++G+C C  G  G       DC      + C     C+  +  C+C +GY G+   C  + +C   C+  G CE+  C C PG  G       DC +      C     CE  N  CVC+ G+  +G+ C + +   C   C  + +C  G+C C PG  G   G ++C     C     C     +CVCNPG+ G+                    C +R+C  +                C    LC  +   C C + +   G+ C+ R+  C   C     C++G+C C+ G  G    ++ C +   C    VC  ++  CIC  G+  +  +C  I+ C   CH    C    C+C P Y G        C++    ADC          C C+ G+ G    C   E     C   CG    C  G+C C+ G +G    +Q C     C    +C   +  CVCK+GY G 
Sbjct:  143 CSLHGVFDLSRCTCSCEPGWGGPTCSDPTDAEIPPSSPPSASGSCPDDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV--QGVCVCRAGFSGP--------DCSQRSCPRGCSQRGRCEGGRCVCDPGYTGD------DCGMRS-------------------------CPRGCSQRGRCENGRCVCNPGYTGEDCGVRSC--PRGCSQRGRCK--DGRCVCDPGYT--GEDCGTRS--CPWDCGEGGRCVDGRCVCWPGYTGE------DCSTRTCPRDCRGRGRCE--DGECICDTGYSGD--DC-GVRSCPGDCNQRGRCEDGRCVCWPGYTGT------DCGSRACPRDCRGRGRCE--NGVCVCNAGY--SGEDCGVRS---CPGDCRGRGRCESGRCMCWPGYTGRDCGTRAC--PGDCRGRGRCV--DGRCVCNPGFTGE-------------------DCGSRRCPGD----------------CRGHGLC--EDGVCVCDAGY--SGEDCSTRS--CPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPND--CSQHGVC--QDGVCICWEGYVSE--DC-SIRTCPSNCHGRGRCEEGRCLCDPGYTGP------TCATRMCPADCRGRGRCVQGVCLCHVGYGGE--DCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTC--PGDCRGRGECH--DGSCVCKDGYAGE 743          

HSP 9 Score: 67.3958 bits (163), Expect = 1.117e-9
Identity = 175/689 (25.40%), Postives = 254/689 (36.87%), Query Frame = 3
Query: 5787 CNENALCVNQKCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGD--GIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGN--GEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGD--GIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGN--GNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGD--GVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGD--GFRCYPVILECP-KCHYRAQCVIGKCQCKNGLQGD--GINFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGN--GVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGD------------GKNYCF-------------DCKRCDQNAI-----CRPTE----QRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGD 7700
            CN+   CV  +C+C PG+ G    +      C     CV  +  C C   +   +  CS       C   C +  +C  G C C PG+ GD  G++ C     C +   C     RCVC P Y+G  E+C                                 G+++C     CS    C     +C+C  G++G   G +      G   +C      V+ +C+C PG+ G+      DCST               C +D                    C     C   +C C  G+ GD  G++ C     C+    C  E  +CVC  G+ G   G++       C   C   G C N  C CN+G  G+  GV SC     C    +C     +C+C  GY G   G R       CP  C  R +CV G+C C  G  G+  G   C    +C  +  C      C C  GY   G++C     C   C     C++  C C   Y+G   GV  C N   C  + +C+  + +C+C +G+     + +    +C +NCH    C +  C+C  G +G             G+  C              DC + +  A      C P E     +CVC   FRG    CA+    TC  DC       +  C CK+G+ G+
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV--QGVCVCRAGFSGPD--CSQRS----CPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSCPRG--CSQRGRC--ENGRCVCNPGYTG--EDC---------------------------------GVRSC--PRGCSQRGRC--KDGRCVCDPGYTGEDCGTRSCPWDCGEGGRC------VDGRCVCWPGYTGE------DCSTR-------------TCPRD--------------------CRGRGRCEDGECICDTGYSGDDCGVRSC--PGDCNQRGRC--EDGRCVCWPGYTGTDCGSRA------CPRDCRGRGRCENGVCVCNAGYSGEDCGVRSC--PGDCRGRGRC--ESGRCMCWPGYTGRDCGTRA------CPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRC--PGDCRGHGLC--EDGVCVCDAGY--SGEDC-STRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVCQ--DGVCICWEGYVSEDCSIR----TCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGP--DCAIQ---TCPGDCRGRGECHDGSCVCKDGYAGE 743          

HSP 10 Score: 65.0846 bits (157), Expect = 5.393e-9
Identity = 173/678 (25.52%), Postives = 249/678 (36.73%), Query Frame = 3
Query: 6621 CHHYASCVQDKCECLPGFIGDGIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGD--GVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGD--GFRCYPVILECPK-CHYRAQCVIGKCQCKNGLQGD--GINFC-MNCSE----CDKNAQCFPNFS----------------------KCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGN--GVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGD--GKNYC-FDCK---RCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGDGFSFCFNCSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCR------KCHEKATCNIRSMKCECLPGYIGNG-------FECISITSCTQS----------SDCIR-------------PNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSS 8420
            C+    CV+ +C C PG+ G    +      C     CV  Q  CVC+ GF  +G  C   + +C   C+  G C   +C C+ G  GD  G+ SC     C    +C     +C+C  GY G+  G R       CP+ C  R +C  G+C C  G  G+  G   C  +C E     D    C+P ++                      +C C  GY GD  +C  +  C   C+Q   C +  C C P YTG   G   C     C     C  +  +CVC  G++G     +    SC  +C     C    C+C  G +G   G   C  DC+   RC         + RCVC P F G+   C       C  DC  + +  +  C C  G+ G+  S       C     C     +C C++ ++G    C  ++C   CS+   +C    C C      +GY   DC        CH +  C     +C C PGY G          +C     C Q            DC +             P E+C     QC+C    F  P    C    C   C  +  C  G C+C      DGY   A E+C  +   ++   +   ++++++       G V   + Q   P   GA       V SS
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV--QGVCVCRAGF--SGPDCS--QRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSC--PRGCSQRGRC--ENGRCVCNPGYTGEDCGVRS------CPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCEDGECICDTGYSGD--DC-GVRSCPGDCNQRGRCEDGRCVCWPGYTGTDCGSRAC--PRDCRGRGRC--ENGVCVCNAGYSGEDCGVR----SCPGDCRGRGRCESGRCMCWPGYTGRDCGTRACPGDCRGRGRC--------VDGRCVCNPGFTGE--DCG---SRRCPGDCRGHGLCEDGVCVCDAGYSGEDCSTRSCPGGCRGRGQCLD--GRCVCEDGYSGED--CGVRQCPNDCSQH-GVCQDGVCICW-----EGYVSEDCSIRTCPSNCHGRGRCE--EGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGVCLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAG--QCVC-VEGFRGPD---CAIQTCPGDCRGRGECHDGSCVCK-----DGY---AGEDCGEEVPTIEGMRMHLLEETTVRTEWTPAPGPVDAYEIQF-IPTTEGASPPFTARVPSS 801          

HSP 11 Score: 62.3882 bits (150), Expect = 3.317e-8
Identity = 169/629 (26.87%), Postives = 257/629 (40.86%), Query Frame = 3
Query: 5376 NKCDSNALCVNRHCICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNP--MQHCFDCKKCHKFADCDVWNKKCVCKNGYFGN--GYMCTPINGCNLKCNENALCVNQKCICLPGFIGD--GIKFC-FDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGD--GIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGD--GIKTCFNCSSCSIEAICVPDQEKCICKAGFSGN--GEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCST--CPPNSDC----LPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGD--GIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDG-FRCYPVILECP-KCHYRAQCVIGKCQCKNGLQGD--GINFCMNCSECDKNAQCFPNFSKCECRQGYRGD 7187
            + C+    CV   C+C PG+TG    +      C     C+  +  C+C+ G+  +G  C      C  GC +  +C  G+C C PG  G+   M+ C   + C +   C+  N +CVC  GY G   G     +  C   C++   C + +C+C PG+ G+  G + C +DC        CV     C C   Y   +  CS       C   C    +C  G C C  G+ GD  G++ C     C++   C     RCVC P Y+G   +C        CP  C  + +C+   C C  G+SG+  G+++C     C     C  +  +C+C  G++G   G +           C      V+ +C+C PGF G+      DC +  CP   DC    L ++  C+C   Y   D  C     T  C   C     C+  +C C  G+ G+  G++ C   + C  +  C  +   C+C  G+       D    TC   C   G C   +C C+ G  G    +    + C    +C   V  C+C +GY G+   +  P    CP  C  R  C  G+C C  G +G    I  C    +C    +C  +   C C+ GY G+
Sbjct:  189 DDCNDQGRCVRGRCVCFPGYTGPSCGWPSCPGDCQGRGRCV--QGVCVCRAGF--SGPDCS--QRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSC--PRGCSQRGRCE--NGRCVCNPGYTGEDCG-----VRSCPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSCPWDCG---EGGRCV--DGRCVCWPGYTGED--CSTRT----CPRDCRGRGRCEDGECICDTGYSGDDCGVRSC--PGDCNQRGRC--EDGRCVCWPGYTGT--DCGS----RACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSC--PGDCRGRGRC--ESGRCMCWPGYTGRDCGTRACPG------DCRGRGRCVDGRCVCNPGFTGE------DCGSRRCP--GDCRGHGLCEDGVCVCDAGYSGED--C----STRSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQC--PNDCSQHGVC--QDGVCICWEGYVSE----DCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGV--CLCHVGYGGEDCGQEEPPASACPGGCGPRELCRAGQCVCVEGFRGPDCAIQTC--PGDCRGRGEC--HDGSCVCKDGYAGE 743          

HSP 12 Score: 59.6918 bits (143), Expect = 2.075e-7
Identity = 167/670 (24.93%), Postives = 224/670 (33.43%), Query Frame = 3
Query: 8157 CHPKAVCVKGKCICNRNLVGD--GYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGD--GMTTCTDCSGCDKNAICTEKQGCICKSGFIGDG-------RQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRI-EDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDGIICRL-PDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGN--------------------------GYSGCFDCSK------CHANADCDESKGCTCKPGFEGNGCYCR--PEDKCKFNSDCNDPLKICVQ---SPD----------------TSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNNCVCKTGYSGTGLNCKPNDQCSQN----SDCPE---PNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICITQTCYCVPGYFGD 9947
            C+ +  CV+G+C+C     G   G+    P +C     CVQ              +C C+ G        C + +C   C  +  C        RC+C PG+ GD  GM +C    GC +   C E   C+C  G+ G+        R C     C D                      +C C  G+      C   SC + C +   C+  +C C PG  G      T   +C  +  C D   C+C  GYSGD    R     C+    C D             RCVC   +  ++  C    C   C     CENGVC C  GY G+    R  P +C+    C+            S  C C  G+  +                      C    C   C     CV G C C P F G                           GYSG  DCS       C     C + + C C+ G+ G  C  R  P D C  +  C D + IC +   S D                    C+C PG T  T   C    CP  C     C+   C+C  GY G        + C Q     S CP    P   C   +     CVC+ GF+  +  C+ + C   C     C   +C C  GY G+
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGPSCGWPS-CPGDCQGRGRCVQ-------------GVCVCRAGFSGP---DCSQRSCPRGCSQRGRCEGG-----RCVCDPGYTGDDCGMRSCP--RGCSQRGRC-ENGRCVCNPGYTGEDCGVRSCPRGCSQRGRCKDG---------------------RCVCDPGYT--GEDCGTRSCPWDCGEGGRCVDGRCVCWPGYTGEDCSTRTCPRDCRGRGRCEDGE-CICDTGYSGDDCGVRSCPGDCNQRGRCED------------GRCVCWPGYTGTD--CGSRACPRDCRGRGRCENGVCVCNAGYSGEDCGVRSCPGDCRGRGRCE------------SGRCMCWPGYTGRD---------------------CGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRCPGDCRGHGLCEDGVCVCDAGYSGE-DCSTRSCPGGCRGRGQCLDGR-CVCEDGYSGEDCGVRQCPND-CSQHGVCQDGVCICWEGYVSEDCSIRTCPSNCHGRGRCEEGRCLCDPGYTGPT---CATRMCPADCRGRGRCVQGVCLCHVGYGG--------EDCGQEEPPASACPGGCGPRELCRAGQ-----CVCVEGFRGPD--CAIQTCPGDCRGRGECHDGSCVCKDGYAGE 743          

HSP 13 Score: 56.6102 bits (135), Expect = 1.876e-6
Identity = 179/664 (26.96%), Postives = 259/664 (39.01%), Query Frame = 3
Query: 5586 CGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNK----KCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPGFIGD--GIKFCFDCSACPANSNCVPEKKECKCAKDYFMNE-KICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGD--GIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGD--GIKTCFNCSSCSIEAICVPDQEKCICKAGFSGN---GEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCS--TCPPNSDCLPQEQ----RCICKKDYFMNDTQCIHTGR---TPQCVPKCHHYASCVQDKCECLPGFIGD--GIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGD--GVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGFRCYPVILECPK-CHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGD 7493
            C +  +CV G+C C PG  G        C       DC    +     CVC+ G+  +G  C+    C   C++   C   +C+C PG+ GD  G++ C     C     C  E   C C   Y   +  + S       C   C +  +C  G C C PG+ G+  G + C     C +   C     RCVC P Y+G  E+C        CP  C  + +C+  +C C  G+SGD  G+++C     C+    C  +  +C+C  G++G       C  +  G   +C       N  C+C  G+ G+      DC   +CP   DC  + +    RC+C   Y         TGR   T  C   C     CV  +C C PGF G+  G + C     C  +  C  E   CVC  G+  +G  C     +C   C   G C + +C C  G  G+  GV  C N   C  +  C   V  CIC  GY  +   C   I  CP  CH R +C  G+C C  G  G      M  ++C    +C      C C  GY   G++C + +  +  C                              C    +C+  +  CVC +GF G     +    +C  +C     C   SC+CK G +G+
Sbjct:  191 CNDQGRCVRGRCVCFPGYTGP------SCGWPSCPGDCQGRGRCVQGVCVCRAGF--SGPDCS-QRSCPRGCSQRGRCEGGRCVCDPGYTGDDCGMRSC--PRGCSQRGRC--ENGRCVCNPGYTGEDCGVRS-------CPRGCSQRGRCKDGRCVCDPGYTGEDCGTRSC--PWDCGEGGRCV--DGRCVCWPGYTG--EDCST----RTCPRDCRGRGRCEDGECICDTGYSGDDCGVRSC--PGDCNQRGRC--EDGRCVCWPGYTGTDCGSRACPRDCRGRG-RCE------NGVCVCNAGYSGE------DCGVRSCP--GDCRGRGRCESGRCMCWPGY---------TGRDCGTRACPGDCRGRGRCVDGRCVCNPGFTGEDCGSRRC--PGDCRGHGLC--EDGVCVCDAGY--SGEDCST--RSCPGGCRGRGQCLDGRCVCEDGYSGEDCGVRQCPN--DCSQHGVCQDGV--CICWEGYVSE--DC--SIRTCPSNCHGRGRCEEGRCLCDPGYTGPTCATRMCPADCRGRGRCVQGV--CLCHVGY--GGEDCGQEEPPASAC---------------------------PGGCGPRELCRAGQ--CVCVEGFRGPDCAIQ----TCPGDCRGRGECHDGSCVCKDGYAGE 743          
BLAST of Neurogenic locus notch-like protein protein 1 vs. Ensembl Celegans
Match: fbn-1 (FiBrilliN homolog [Source:UniProtKB/TrEMBL;Acc:I7LFE6])

HSP 1 Score: 129.798 bits (325), Expect = 5.165e-29
Identity = 272/1009 (26.96%), Postives = 385/1009 (38.16%), Query Frame = 3
Query: 2847 CFHCSQCDSNAICDQNNKACICKSGFEGN--GINCLRAINCK---QKCHKQARC--LLG--KCICNKGLNGNGVEYC--------FNCTSCHLNAKCI--PRQNTCECNSGFHGDGIQCKLLPLCTPACHPQAS----CINGNCKCNNNLIGDGISSCFDC---------------------DKCSMNARCDVSNQ--RCICQPGYEGNGIKC--VKTCFQS--CHKLAVCK--EGT--CKCSNGLTGDGVNFCFNCSLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDCSSRCGENAFCYNGT----CKCKLGFQGNPLEH-CFDCRVCHYPA-YCDIPNRKCICITEN-----------------DIFSRTPCSFSCHPNAKCIKGR----CRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQTCTCKRGYVK----DGNNCSIISARCHPECGV---NAQCINGKCECL--AGLQGNPFQQCFDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGK---------CECL-------PGLRGDGVQSCFD---------------CS--ICDNNTVCYPDQEKCVCNPGYYGDGTT---------CFLFSQLCTEKCHPNAKCVN--RKCKCNERLVGDGVNFCFNCTSCHP------DALCFPD----QQECSCKSEFVGDGKICTL---RADICRPTCGENAICVNG-QCQCQSGLQGNPL---KHCFDCRP----CHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPK---CHRNAVCI-NQNCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNP----------LQHCFN-CKRCDKFADC--DVWNKKCVCKNGYMGNGLTCI 5357
            C    +C  +A+C++    C C+ GFEG     +C+    C      CH+ ARC   +G   C C  G        C         N T C  NAKC+  P   +CEC +GF GDG QC  +P     C    S    C   N  C  + + DG   C +C                       CS+NA C   N    C C+ GY G+G  C  +  C +   CH  A C   EG+  C+C +G  GDG+  C N             E  CE +E+F G      D V C S        YNG+    C+C+ GF+     + C D   C      CD  +  C+    +                 DI         C   A CI       C+C++   GDG T C            +P+     C   + +    +   C++      P+CG        ING C+ L  +GL      Q  DC + ++  D  P +  C C  G+IG+G  C    + V +C+  G C+++  KC    IG      F+C  C +  F +  +E+CV       N +K  I    +      ++    KGK          E         P   G G ++  +               CS   C +   C      C+C  G+ GDGTT         C     LC +K    AKC N  R C+C+   +GDG    + C S HP      D LC P+     + C C   F GDG  C     RA  C   C  NA CV G  C+C  G  GN L       DC      CH  AVC+ E+R+C C SGF G+G +C   K C      C +NA+C+   +C+C   + GD     + CSS       EP N +              + +     P       C++G+C C  G + N           +  C     +CD+ A C     +  C C +G++G+G+TC+
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQC--VPTTKKPCDSTQSSKSHCSESNMSCEVDTV-DGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDVEKFCGR----VDHVSCLS-----VRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGAT-CIKIEE-------EPKSDKTACTDEWSRLCELEKKQCTVDEEEV-PQCGACLPGHHPINGTCQSLQISGL----CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMIC----DDVDECNNAGMCDDENTKC-ENTIGS-----FNC-VC-LEGF-KKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKGKRGPPSIQPPAEMFTTPAPPPPSNGGYGEETNQEEEQVTSTTTTEAPSLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADK----AKCDNSTRSCECDAGYIGDG----YVC-SPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCS-QCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPF---YKCSSL---VSKEPANQQ------------DLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCV 2326          

HSP 2 Score: 129.028 bits (323), Expect = 8.056e-29
Identity = 235/903 (26.02%), Postives = 343/903 (37.98%), Query Frame = 3
Query: 3921 NNCSIISARC--HPECGVNAQC--INGKCECLAGLQGNPFQQ-CFDCKRCSQF-ADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCST--CDINAFC--EPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDC--------SICDNNTVCYPDQE---------------KCVCNPGYYGDGTTCFLFSQLCTEK--CHPNAKCVNR----KCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGD-GKICTLRADICRPTCGENAICVNGQCQCQSGLQ-GNPLKHCFD----------CRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECS---PKCHRNAVCINQ----NCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCE------PSCGE---NAKCVNGKCECL--PGLQGNPLQHCFNCKRCDKFADC-DVWNKK--CVCKNGYMGNGLTCISVNGCNNKC---DSNALCVNR----HCICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCIC----QEGYIMNGAKCQPIVHECR----------PGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCVCKNG------------------------------------------YFGNGYMCTP-INGCNLK---CNENALCVNQKCICLPGFIGDGIK------FCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLC---TSKCHKNAKC--LKGNCECLPGFVGDGIQVCF-------NCSTCDKNANCFPYQERCVCKPRYSGN 6158
            N+ S+ + +C    ECG++A C    G C C  G +G P ++ C D   C+    +C   +E   CQ+ Y+G G+ C              FC     K   G   D I+ C + ++  C  NA C  +P    C C  GF G+G +C       C      K+ C +    C      DG   C +C         +C++   C  ++                 C C  GY GDG  C   ++ C E+  CHP+A+C N     KC+C+    GDG+  C N           P ++ C    +F G    +  L   I   +       ++  C+C+ G +       C D          C P  +  V    + RC C  G+EG+G  C  I EC      C   A+CIN+     C C+  Y GDG   C            EP +++  C   ++     C   + +C       P CG        +NG C+ L   GL       C     C+K A+C D+      C C +G++G+G+ C  V+ CNN     D N  C N     +C+CL GF     +   D    P       +E+        QE     G +  P +              P  G   +  N + E +                CH  A C+     C+C++G                                          Y G+GY+C+P    C L+   C+  A+C N++C CLPGF GDG+K         +CS C AN++CV     CKC   YF N   C P   P+ C   T  CH NA C      C+C  GF G+G+  CF       + S C KNA C P    C+C+  + G+
Sbjct: 1386 NDSSVENTKCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNC---HESARCQN-YVG-GYAC--------------FCPTGFRKADDGSCQD-IDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTV-DGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINE-CDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDVEKFCGRVDHVSCLSVRIYNGS-------LSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGAT-CIKIEE-------EPKSDKTACTDEWS---RLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGL-------CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKGKRGPPSIQPPAEMFTTPAPPPPSNGGYGEETNQEEEQVTSTTTTEAPSLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVG-GTTCKCNPGYFGNGLCCVP--DPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLPTG-SCICRHGFKGD 2225          

HSP 3 Score: 125.176 bits (313), Expect = 1.250e-27
Identity = 263/1032 (25.48%), Postives = 367/1032 (35.56%), Query Frame = 3
Query: 2430 CFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFP----PCANHAICTVENTCQCRKNYYGN-----PLEKCNIDCSKCHTDSDCDKTNGY----------------CKCRYGFFGDGFTC-------------NKTCCVEKCHE-QAQCVDGKCLCKP---GFSGDGV------ETCFHCSQCDSNAICDQNNK--ACICKSGFEGNGINCLRAINCKQK--CHKQARC--LLG--KCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFHG--DGIQCKLLPLCTPACHPQASCINGNCKCNNNLIGDGIS-SCFDCDKCSMNA-RCDVSNQ---------RCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTG-DGVNFCFNCSLCDKNAKCLINEEKCECMERFEGDGFTC--------QDKVDCSSRCGENAFCYNGTCKCKLGFQGNPLEHCFDCRVCHYP--AYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQ---------TCTCKRGYVKDGNNCSIISARCHP-------ECGVNAQCINGKCE-CLAGLQGNPFQQCFDCKRCSQFADCDP-------WNERCVCQSGYIGNGFTCTKIINCVT-KCHVNGFCENQE--CKCLPGLIGDGINFCFDCSTCD---------INAFCEPFNERCVCSVGFTGNGKKCSILAP--ITCKRACHKKAKCVKGKCECLPGLRGDGV------QSCFDCSICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLC---TEKCHPNAKC--VNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICV-NGQCQCQSGLQGNPLKHCFDC---RPCHSFAVCDVE--------------NRRCICQSGFEGD-----GRNCKKIKECSPKCH---RNAVCIN----QNCVCIPEYIGDGIN 5048
            C    +C   A C  +TG C C P + G          PK +C         +H  C     CQ   NY G      P      D   C    +C + N                  C+C  GF GDG+ C             +K+ C E     +   VDG   CK    G+   G       E     + C  NA C   N   +C CK G+ G+G  C     C ++  CH  A C  L G  KC C+ G  G+G++ C N           P + +CE    F G  D + C  + +   +       ++  C+C      +  S SC D D+C  +   CD ++          RC C  GYEG G  C                   +C  G+ G D +  C N     +   C      C+CM  + GDG TC         DK  C+     +  C     +C +  +  P   C  C   H+P    C       +C  +ND      C    HP++      C C    IGDG   C +   C     C  E            C C  G+ K    C ++  +  P       +   ++   +G+ +    G +G P  Q         F    P       + E    +   + +  T      C T  CH    CE     C C  G IGDG   C   ST D           A C+     C C  G+ G+G  CS      +     C  +A C   +C+CLPG  GDGV      +   +CS CD N  C      C CNPGY+G+G  C      C   T  CHPNA C   +R+C+C+    G+GV+             CFP +   SC+++               +  C +NAIC+  G C C+ G +G+P   C       P +   + DV               +  CIC+SGF  +        C  I EC+ K H   R A C N      C C   ++GDGI 
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGFEG--------APPKKSCVDVDECATGDHN-CHESARCQ---NYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDVEKFCGRVDHVSCLSVRIYNGS-------LSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTD---------------IDECDRGMAGCDSMAMCIN-----RMGSC-----GCKCMAGYTGDGATCIKIEEEPKSDKTACTDEW--SRLCELEKKQCTVDEEEVP--QCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAEC-IDIHPDSHF----CSCPDGFIGDG-MICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKC-VVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKGKRGPPSIQ----PPAEMFTTPAPPPPSNGGYGEETNQEEEQVTSTTTTEAPSLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCV-GGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-------------CFPQK---SCRTD---------------KSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGIT 2324          

HSP 4 Score: 120.168 bits (300), Expect = 3.828e-26
Identity = 265/981 (27.01%), Postives = 359/981 (36.60%), Query Frame = 3
Query: 5052 CFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIEL----KCEPSCGENAKCVN----GKCECLPGLQGNPLQHCFNCKRCDKF-ADCDVWNKKCV---------CKNGYMGNGLTCISVNG--CNNKCDSNALCVNRHCICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPI---VHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLK--CNENALCVNQ----KCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGDG-IQVCFNCSTCDKNA-NCFPYQE---------RCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICK--AGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPK--CHHYASCVQDK-----CECLPGFIGDGIKFCFKCSSCDPNADCVPEQQK---------CVCKTGFYGNGNKC----------DKIE-----------------------------------STCEPPCAPGGF---CNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGFRCYPVILECPKCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGDG-------KNCVKIDE-CSPKCHQNAVCINSNCHCLPMYTGNGV------SFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSC---NTNCHKDALCFKDS--CICKSGLSGDGKNYCF-------DCKRCDQNAICRPTEQRCVCKPEFRGDGF 7598
            C +   C  +A CE     C C  GF G     + +++      + +C E+A+C N      C C  G +      C +   C +  + C   N KCV         C+NG++G+G  C+      C++   S + C   +  C    T DG+  C +C                    GY  +G  C+ I   V E  P C  NA CVN             M   F C                 CK GY G+G+MCT IN C+ +  C+ +A C N     KC C  GF GDGIK C +           P ++ C+        EK C  +   V C S    N   L   CEC PGF  +     C +   C+++  NC P            RC C   Y G G  C  I                     +C +G +G           C   A+C+     C CK  AG++G+G  C++  E   PK    A       +C      + K    D    P    CLP          + +N T C     +  C  K  C+ +A C+        C C  GFIGDG+  C     C+    C  E  K         CVC  GF     KC          +KIE                                   +   PP + GG+    N  + Q  S    +  + C   + C   A C  S   CIC  G+ GDG                         C      D I+    C++    A+C  +   CEC  GY GDG       ++CV  D  CSP+    AVC N  C CLP +TG+GV          NC+QCDANA C      C C  G+ GNG+ C      C      CH +A+C  +S  C C SG SG+G + CF       D   C +NAIC PT   C+C+  F+GD F
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVD-TVDGSVECKECMG------------------GYKKSGKVCEDINECVAEKAP-CSLNANCVN-------------MNGTFSCS----------------CKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDV------EKFCGRVDH-VSCLSVRIYNGS-LSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDI--------------------DECDRGMAG-----------CDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEE--EPKSDKTACTDEWSRLCEL----EKKQCTVDEEEVPQCGACLPGH--------HPINGT-CQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGM-ICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKGKRGPPSIQPPAEMFTTPAPPPPSNGGYGEETNQEEEQVTSTTTTEAPSLCSTVT-CHSLATCEQSTGVCICRDGFIGDGTTA----------------------CSKKSTADCISLPSLCAD---KAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPE----AVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGG-TTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLPT-GSCICRHGFKGDPF 2227          

HSP 5 Score: 118.242 bits (295), Expect = 1.514e-25
Identity = 252/966 (26.09%), Postives = 368/966 (38.10%), Query Frame = 3
Query: 2235 CFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKSC---------DKICHKDALCQNS----RCICKPNFEGDGVNYCFDCSKCHKL--------AQC--HPKTGNCTCRPPYVGDGVS-------ECE-TFLPKGNCFPPCANHAICTVENTCQCRKNYYG--------NPLEKCNIDCSKCHTDSDCDKTNGY--CKCRYGFFGDGFTCNKTC-CVEK--CHEQAQC--VDG--KCLCKPGFSGDGVETCF------------------HCSQCDSNAICDQNNKACICKSGF--EGNGINCLRAINCKQKCH----KQARCLLG----KCICNKGLNGNG-----VEYC-FNCTSCHLNAKCIPRQNTC--ECNSGFHGDGIQC---------------------------------KLLPLCTPACHPQASCINGNCKCNNNLIGDGISSCFDCDKCSMNARC-DV--SNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNC----SLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDCSSRCGENAFCYNGTCKCKLGFQG-NPLEHCFDCRVCHYPA---YCDIPNRKCICITENDIFSRTPC---SFSCHPNAKCIK--GRCRCLSNLIGDGTTYCFNCSS---------CARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPE--------CGVNAQCINGKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCV------CQSGYIGNGFTCT-KIINCV---TKCHVNGFC--ENQECKCLPGLIGDGINFCF-------DCSTCDINAFCEPFNERCVCSVGFTGNG-KKCSILAP------------ITCKRACHKKAK-CVKGKCECLPGLRGD----GVQSCFDCS-------ICDNNTVCYPD--QEKCVCNPGYYGDGTTCF 4544
            C    +C  +A C      C C PG+   G    KSC         D  CH+ A CQN      C C   F       C D  +C +         A+C   P T +C C   ++GDG          C+ T   K +C     +  + TV+ + +C++   G          + +C  + + C  +++C   NG   C C+ G+ GDGF C     C E+  CH  A+C  ++G  KC C  GF GDG++ C                   H S           +  C C+ GF  E    +C+    C++  +      A C+      +C C +G  G G     ++ C      C   A CI R  +C  +C +G+ GDG  C                                 + +P C  AC P    ING C+   +L   G+  C   + C+ +A C D+   +  C C  G+ G+G+ C       C+   +C +   KC N +        FNC         + KC+++E+K    E+ E         +D  +    N+     T K K G     P    F       P+   Y +  N++   +T     +  P    + +CH  A C +  G C C    IGDGTT C   S+         CA  + C    ++C C  GY+ DG  CS      HP+        C   A C N +C+CL G  G+  +     +R S  + CD  N  CV      C  GY GNG  C    ++CV     CH N  C  E+++C+C  G  G+G++ CF       D S C  NA C P    C+C  GF G+   KCS L               +C   C    + C+ G+C C  G R +    G ++C D          CD    C        C C  G+ GDG TC 
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGF--EGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCG-ACLPGHHPINGTCQ---SLQISGL--CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDD--VDECNNAGMCDDENTKCENTI------GSFNCVCLEGFKKVDEKCVVDEKKQPNREKIE---------IDEENSSSSNSGQEKPTTKGKRGPPSIQPPAEMFTTPAPPPPSNGGYGEETNQEEEQVTST-TTTEAPSLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSP-----HPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCD-ANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLPTG-SCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCV 2326          

HSP 6 Score: 118.242 bits (295), Expect = 1.703e-25
Identity = 263/998 (26.35%), Postives = 359/998 (35.97%), Query Frame = 3
Query: 4881 AVCDVENRRCICQSGFEGD--GRNCKKIKECSP---KCHRNAVCINQNCVCIPEYIGDGINFC------FNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNG--CNNKCDSNALCVNRHCICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPI---VHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLK--CNENALCVNQ----KCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGDG-IQVCFNCSTCDKNAN-CFPYQE---------RCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICK--AGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPK--CHHYASCVQDK-----CECLPGFIGDGIKFCFKCSSCDPNADCVPEQQKC---------VCKTGFYGNGNKC----------DKIE-----------------------------------STCEPPCAPGGF---CNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGF-----RCYPVILECPK-CHYRAQC--VIGKCQCKNGLQGDGINFCMNCSECD-KNAQCFPNF----SKCECRQGYRGDGKNCVKIDECSPKCHQ---NAVCIN-SNCHCLPMYTGNG---VSFCFNCAQ----CDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTN---CHKDALCF-KDSCICKSGLSGD 7493
            A+C+     C C+ GFEG    ++C  + EC+     CH +A C N        Y+G    FC       +  SC    +C  HN+ C                       CG NAKCVN      PG                           C C+NG++G+G  C+      C++   S + C   +  C    T DG+  C +C                    GY  +G  C+ I   V E  P C  NA CVN             M   F C                 CK GY G+G+MCT IN C+ +  C+ +A C N     KC C  GF GDGIK C +           P ++ C+        EK C  +   V C S    N   L   CEC PGF  +     C +   C+++ N C P            RC C   Y G G  C  I                     +C +G +G           C   A+C+     C CK  AG++G+G  C++  E   PK    A       +C      + K    D    P    CLP          + +N T C     +  C  K  C+ +A C+        C C  GFIGDG+  C     C+    C  E  KC         VC  GF     KC          +KIE                                   +   PP + GG+    N  + Q  S    +  + C   + C   A C  S   CIC  G+ GDG      +     +  P  C  +A+C      C+C  G  GDG     +  +C  ++  C P       +C+C  G+ GDG  CV I E +  C Q   NA C+  + C C P Y GNG   V    +C      C  NA+C  +   C C+ GF+GNG++C     SC T+   C K+A+C    SCIC+ G  GD
Sbjct: 1405 ALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQN--------YVGGYACFCPTGFRKADDGSCQDIDECTEHNSTC-----------------------CGANAKCVN-----KPGTY------------------------SCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVD-TVDGSVECKECMG------------------GYKKSGKVCEDINECVAEKAP-CSLNANCVN-------------MNGTFSCS----------------CKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDV------EKFCGRVDH-VSCLSVRIYNGS-LSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDI--------------------DECDRGMAG-----------CDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEE--EPKSDKTACTDEWSRLCEL----EKKQCTVDEEEVPQCGACLPGH--------HPINGT-CQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGM-ICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKGKRGPPSIQPPAEMFTTPAPPPPSNGGYGEETNQEEEQVTSTTTTEAPSLCSTVT-CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFP-QKSCRTDKSVCAKNAICLPTGSCICRHGFKGD 2225          

HSP 7 Score: 115.546 bits (288), Expect = 1.051e-24
Identity = 260/1055 (24.64%), Postives = 394/1055 (37.35%), Query Frame = 3
Query: 7302 CFNCAQCDANAICKPDENLCVCAQGFTGN--GITCKAID--PSCNTNCHKDALCFKD----SCICKSGLSGDGKNYCFDCKRC-DQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGDGFSFCFNCSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQC-------FCRPGLIGDGYNCLDCRKC-HEKATCNIR--------SMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVC--VKG--KCICNRNLVGDGYQ-CRAPEECN-NDAD--CVQFQEV----CRKDQSSLKKICKCKDGLVRDLQG-------QCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDC-------SGCDKNAICTEKQG---CICKSGFIGDGRQCIVLNE--CADNSDCTTIRGR-----ASECIRSSEGIQKC-QCSQGFKLLNGKCEPLSCIYPCA------KNAVCI-----YQKCECLPGLVGNGFIKCTNCSECHKKALCHDQR----------GCVCSHGYSGDGIQCRIEDQCSLNSDCTD-----------------------------PNKICIT-------------STDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCE--NGVCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARL---DSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGNG------YSGCFDCSKCHANADCDESKGCTCKPGFEGNGCYCRPE--DKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQ---------CDKNAVCL-SNNCVCKTGYSG-------TGLNCKPNDQ--CSQNSDCPEP-NSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQP---------KCHMFAICI----TQTCYCVPGYFGDGI 9953
            C +  +C  +A+C+    +C C  GF G     +C  +D   + + NCH+ A C       +C C +G        C D   C + N+ C     +CV KP                               C C+NGF GDG+              C P  +K  C             +  K  CSE+   C  +          C  G    G  C D  +C  EKA C++         +  C C  GY G+GF C  I  C +                                      + PCHP A C  ++G  KC C+    GDG + C  P E +  D +  C +   V     R    SL  +C+C+ G   + +        +C++ + N    + AVCV +     RC C  G+ G+G   CTD        +GCD  A+C  + G   C C +G+ GDG  CI + E   +D + CT    R       +C    E + +C  C  G   +NG C+ L     CA      K+A CI        C C  G +G+G I C +  EC+   +C D+            CVC  G+     +C ++++   N +  +                             P ++  T              T+  +  V  ++   + S C  +TC    H  A CE   GVC C  G++GDG         KS+ DC      C  +    +S+  C C +G+       S      +++ ++          C+P+    A+C    C+C P F G+G      +    +CS+C ANA C     C C PG+ GNG  C P+  D   F   C+ P  +C      SR C C  G   S NG    + C  Q         C KNA+CL + +C+C+ G+ G       + ++ +P +Q   S  S C  P +S  ++    + +C+C  GF+ ++     + C           KC   A C     +  C C  G+ GDGI
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTY---------------------------SCECENGFLGDGYQ-------------CVP-TTKKPCD----------STQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDE--------------------------------------RHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEE-SRNNCDPASAVCVNTEG-SYRCECAEGYEGEGGV-CTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMI-CDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKGKRGPPSIQPPAEMFTTPAPPPPSNGGYGEETNQEEEQVTSTTTTEAPSLCSTVTC----HSLATCEQSTGVCICRDGFIGDGTTACSK---KSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNL----------CSPE----AVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICH-PNAVCNSE---SRQCQCSSGF--SGNG----VSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLC--ISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGI 2323          

HSP 8 Score: 114.005 bits (284), Expect = 3.152e-24
Identity = 246/985 (24.97%), Postives = 368/985 (37.36%), Query Frame = 3
Query: 5586 CGENAKCV--NGKCECLPGLQGNP-MQHCFDCKKC-------HKFADCD--VWNKKCVCKNGYF-GNGYMCTPINGCNLK----CNENALCVNQ----KCICLPGFIGDGIKFCFDCSACPANS-----------------NCVPEKKECK-CAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGN----CECLPGFVGDGIQVCFNCSTCDKNANCFPYQE--------RCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGD---------GIK------TCFNCSSCS--------IEAICVPDQE--KCICKAGFSGNGEQC--VENIEGSSPKCHSNALRVNQQ----CICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYF----MNDTQC-IHTGRTPQC---VPKCHHYASCVQDKCECLPGFIGDGIKFCFKCSSCDPNADCV---PEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNC----------SKCDVNAKCFPSVKKC--------ICVIGYK---GDGFRCYPVILECPKCH------------YRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSC---NTNCHKDALCFKDSCICKSGLSGDG------KNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLK--TTCQNDCHPNAV--RVNNCCRCKNGFFGDGFSFCF-------NCSNCSPNADCFPHLSKCQCKEEFTGNGF----------------ICQRKECKPACSEATSLCIKNQCFCRPGL-----IGDGYNCLDCRKCHEK-------ATC--NIRSMKCECLPGYIGNGFECI 8012
            CG +A C    G C C PG +G P  + C D  +C       H+ A C   V    C C  G+   +   C  I+ C       C  NA CVN+     C C  GF+GDG + C   +  P +S                 + V    ECK C   Y  + K+C  I + V   + C  NA C+  N    C C  G+ GDG  +C + + CD+   C P+ E        +C C   + G+G        E  C +      + D   C  ++ ++G          G +      +C +   C           A+CV  +   +C C  G+ G G  C  ++  +     C S A+ +N+     C C+ G+ GDG       +TC    +  P+  +  C  ++     +   QC +     PQC   +P  H     +   C+ L    G     C + + C+ +A+C+   P+   C C  GF G+G  CD ++      C   G C++   +C + +        FNC           KC V+ K  P+ +K             G +     G R  P I    +              Y  +    + Q  +    +  + C   + C   A C  +   C CR G+ GDG        CS K         ++C  LP       S C + A+CD +         C C  G+ G+G  C      C   +  C  +A+C    C C  G +GDG           +C +CD NA C      C C P + G+G  C  +          CHPNAV    +  C+C +GF G+G S CF       + S C+ NA C P  S C C+  F G+ F                +     C   C  +T LCI  +C C+ G      +     C D  +C EK       ATC     S  C C  G++G+G  C+
Sbjct: 1401 CGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQ-CVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGF-MCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDG-------ATCIKIEE-EPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHP----INGTCQSLQ-ISG----LCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDE-----CNNAGMCDDENTKCENTI------GSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKGKRGPPSIQPPAEMFTTPAPPPPSNGGYGEETNQEEEQVTSTTTTEAPSLCSTVT-CHSLATCEQSTGVCICRDGFIGDGTTA-----CSKKS-------TADCISLP-------SLCADKAKCDNST------RSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGG-TTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLPTGS-CICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCV 2326          

HSP 9 Score: 112.849 bits (281), Expect = 6.647e-24
Identity = 270/1137 (23.75%), Postives = 403/1137 (35.44%), Query Frame = 3
Query: 6267 DGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALR-VNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRT--PQCVPKCHHYASCVQ-DKCECLPGFIGDGIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSC--------FNCSKCDVNAKCF--PSVKKCICVIGYKGDGFRCYPVILE-CPKCHY-RAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPK---CHQNAVCINSN----CHCLPMYTGNGVSFCFNCAQCDANAICKPDE---NL-----CVCAQGFTGNGI---------TCKAIDPSCNTNCHKDALCFK-------DSCICKSGLSGDGK-NYCFDCKRCDQN--------AICRPTE--QRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFG-DGFSFCFN-CSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKP-----ACS-EATSLCI--KNQC-----------FCRPGLIGDGYNCL------------DCRKCHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCI-----NPNCQ---------------------------PPCHPKAVCVKGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRK---------DQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSS---NLESRCLCLPGFVGDGMT---TCTDC----SGCDKNAICTEKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKC---EPLSCIY---PCAKNAVCIYQ--KCECLPGLVGNGFIKC-------TNCSECHKKALCHDQRGCVCSHGYSGDGI-------------QCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSF-----ISSNSGCVPL-TCLSKCHK---YANCENG----VCKCILGYVGDGIIC 9128
            DG+    + ++  +           + ++G     +   E +E ++P     +      +   LP   G G++      T  P +   PQ +    +K     DT  + T  T  PQ          C   D+C  L          C     C+P  +  P ++ CV       + ++C   +  C        +     C C +G +     SC         N + C  NAKC   P    C C  G+ GDG++C P   + C      ++ C      C    + D ++  + C EC                 GY+  GK C  I+EC  +   C  NA C+N N    C C   Y G+G   C +  +CD    C P     NL     C C  GF G+GI         +C+ ++  C    H   L  +         C C+ G   + + N C D   C+++        A+C  TE   RC C   + G+G  C                    +   C  G  G D  + C N   +C            C+C   +TG+G  C + E +P     AC+ E + LC   K QC            C PG       C             DC K  E    +  S  C C  G+IG+G  C  +  C  +  C   N  C   I    C        + + C+      PN +                           P   P A           +  G G +    EE        +   +C           +QS+   +C C+DG + D    C K +        ++C   +   N    C C  G++GDG        DC    + C   A+C  ++ C C  GF GDG +C+ ++E A N  C+     A  C+    G   C+C+ G+   NG C   +PL C++    C  NAVC  +  +C+C  G  GNG + C       T+ S C K A+C     C+C HG+ GD               Q  + D  S  + C    ++CI+       C+CKS F     +S +  C  +  C  K HK    A C N     VC C  G+VGDGI C
Sbjct: 1271 DGVSPTSSATAPEVPTTSASSTPDAVEESGIPSTSKPTAEPLETTAPSTEVTSPEGSGTEESTLPPTEGSGESTTSSAPTVEPATVLPPQNRN---EKPEPTKDTFALPTTTTGAPQANDSSVENTKCTSSDEC-GLDALCERRTGVC----RCEPGFEGAPPKKSCV-------DVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSC----EVDTVDGSVECKEC---------------MGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGF-MCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCT-------------------DIDECDRGMAGCDSMAMCINRMGSCG-----------CKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKGKRGPPSIQPPAEMFTTPAPPPPSNGGYGEETNQEEEQVTSTTTTEAPSLCSTVTCHSLATCEQST--GVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRR-CQCLPGFTGDGVKCVSIHERASN--CSQCDANA-HCV----GGTTCKCNPGY-FGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNG-VSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISG-----ECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2325          

HSP 10 Score: 107.457 bits (267), Expect = 2.638e-22
Identity = 254/991 (25.63%), Postives = 354/991 (35.72%), Query Frame = 3
Query: 4500 CVCNPGYYGD--GTTCFLFSQLCT--EKCHPNAKCVNRK------CKCNERLVGDG----VNFC--FNCTSCHPDALCF--PDQQECSCKSEFVGDGKICT-LRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCFDCRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPK---CHRNAVCINQN----CVCIPEYIGDGINFCFNCSSCDRNADCEPHNN--------RCTCYQGFTGNGLT--CNAIELKCEPS---CGE-------NAKCVNGK----CECLPGLQ-GNPLQHCFNCKRCDKFAD-CDVWNKKCV---------CKNGYMGNGLTCISVNGCNNK---CDSNALCVNRH----CICLPGFTGDGTRFCFDCSSCPKNSN----------CLPEEQKCICQEGYIMNGAKCQPIVHEC---------------RPGCGENAKCVNGK-----CECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCIC-----------------------------------LPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPI--KQPVLC-TSKCHKNAKCLK--GNCECLPGFVGDGIQVCFNCSTCD---------KNANCFPYQERCVCKPRYSGNG-------ENCVKI----GPESICPNXXXXXXXXXXXXXXXLQGFSGDGIK------TCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEG---SSPKCHSNAL--RVNQQCICLPGFIGDGKNFCF-------DCSTCPPNSDCLPQEQRCIC----KKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGDGIKFCFKCSSCDPNAD-CVPEQQKCVCKTGFYGNGN-----KCDKIESTCEPP--CAPGGFCNNS----KCQCNSGLKGDGVT 6896
            C C PG+ G     +C    +  T    CH +A+C N        C    R   DG    ++ C   N T C  +A C   P    C C++ F+GDG  C       C  T    + C      C+     + +    +C+ C                 G++  G+ C+ I EC  +   C  NA C+N N    C C   Y GDG   C + + CD    C PH          +C C+ GF G+G+    N +E  CE     CG        + +  NG     CEC PG +       C +   C++  + CD  +  CV         C  GY G G  C  ++ C+     CDS A+C+NR     C C+ G+TGDG   C      PK+            C  E+++C   E  +     C P  H                 +  C ++A+C++       C C  G  G+ M  C D  +C+    CD  N KC    G F            N  C E    V++KC+                                     P        F       P+N     E  +          E++ S    + P LC T  CH  A C +  G C C  GF+GDG   C   ST D           A C      C C   Y G+G       ++CV       PE++C N+  +           L GF+GDG+K         NCS C   A CV     C C  G+ GNG  CV +       +  CH NA+    ++QC C  GF G+G + CF       D S C  N+ CLP    CIC    K D F   +  +   + P         +SCV                     + CD +   C+    +C+CK+GF  N        C  I+   E    C     C N+     C C  G  GDG+T
Sbjct: 1414 CRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEV----DTVDGSVECKEC---------------MGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGF-MCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGAT-CIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMI-CDDVDECNNAGMCDDENTKCENTIGSF------------NCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKGKRGPPSIQPPAEMFTTPAPPPPSNGGYGEETNQ--------EEEQVTSTTTTEAPSLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQC----------LPGFTGDGVKCVSIHERASNCSQCDANAHCV-GGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLPT-GSCICRHGFKGDPFYKCSSLVS--KEPANQQDLSDVSSCV---------------------TPCDSSTQLCI--SGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGIT 2324          

HSP 11 Score: 104.76 bits (260), Expect = 1.845e-21
Identity = 107/334 (32.04%), Postives = 145/334 (43.41%), Query Frame = 3
Query: 2154 IKCHENASC--VNGYCKCNRNLIGDGINSC-----FDCLK----CNTEADCSPYENRCYCRPGYTGNGFTCI---KSC---DKICHKDALCQNSRCICKPNFEGDGV------NYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGV------SECETFLPKGNCFPPCANHAICTVEN-TCQCRKNYYGN-----PLEKCNIDCSKCHTDSDCDKTNGYCKCRYGFFGDGF----------------TCNKTCCVEKCHEQAQ-CVDGKCLCKPGFSGD----GVETCFHCSQC-DSNAICDQ--------NNKACICKSGFEGNGINCLRAIN 2960
            + CH  A+C    G C C    IGDG  +C      DC+     C  +A C      C C  GY G+G+ C    + C   D +C  +A+CQN RC C P F GDGV          +CS+C   A C   T  C C P Y G+G+       +C  F   G C P    +A+C  E+  CQC   + GN     P + C  D S C  ++ C  T G C CR+GF GD F                  + + CV  C    Q C+ G+C+CK GF  +    G ETC    +C + +  CD+         +  C C  G  G+GI C+  +N
Sbjct: 2005 VTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGT-TCKCNPGYFGNGLCCVPDPLDCVHFT--GICHP----NAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPT-GSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVN 2330          

HSP 12 Score: 98.5969 bits (244), Expect = 1.396e-19
Identity = 185/689 (26.85%), Postives = 258/689 (37.45%), Query Frame = 3
Query: 8496 CDKNAICTEKQG---CICKSGFIGDGRQCIVLNECAD------NSDCTTIRGR-----------------ASECIRSSEGIQK-----------------------CQCSQGFKLLNGKCEPLSC--IYPCAK--------NAVCI----YQKCECLPGLVGNGFIKCTNCSECHK-------KALCHDQR---GCVCSHGYSGDGIQC-RIEDQC-SLNSDCTD--------PNKICITSTDTVKRC-VCKSSFISSNSGCVPLT----CLSK--CHKYANC-----ENGVCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCN--------------------PKCHRSALCVIGTCKCPPSFKGNGYSGCFDCSK-----------------CHANADCDESKG-CTCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVC--LSNNCVCKTGYSGTGLNCKPNDQ-CSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQP----KCHMFAICI-TQTCYCVPGYFGDGI------KSCTS-CSVCHKNAQCLPD-RGCVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCL 10115
            C  NA C    G   C CK G+ GDG  C  +NEC +      +++CT + G                   +   RS E ++K                       C+C  GF+    + E  SC  I  C +        +AVC+      +CEC  G  G G + CT+  EC +        A+C ++    GC C  GY+GDG  C +IE++  S  + CTD          K C    + V +C  C       N  C  L     C  K  C+K+A C     ++  C C  G++GDG+IC   DEC ++  C  EN +C   +  S  C C  GF+   EK  +V+ +    R        + ID                      P     A         PPS  G G     +  +                 CH+ A C++S G C C+ GF G+G                                 C   +T      CI L  P  C   A C   + +C C  GY G G  C P+ Q C    +   P + C+     NR+C CLPGF  D  KC     +     +C   A C+   TC C PGYFG+G+        C     +CH NA C  + R C C S F G+G +C P   CR ++     N +CL
Sbjct: 1576 CSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRF---EKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGV-CTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTI-GSFNCVCLEGFKKVDEK-CVVDEKKQPNREK------IEIDEENSSSSNSGQEKPTTKGKRGPPSIQPPAEMFTTPAPPPPSNGGYGEETNQEEEQVTSTTTTEAPSLCSTVTCHSLATCEQSTGVCICRDGFIGDG------------------------------TTACSKKST----ADCISL--PSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQ-----NRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICL 2211          

HSP 13 Score: 97.8265 bits (242), Expect = 2.553e-19
Identity = 260/1060 (24.53%), Postives = 366/1060 (34.53%), Query Frame = 3
Query: 7101 CMNCSECDKNAQCFPNFSKCECRQGYRGD--GKNCVKIDECSP---KCHQNAVCINSNCHCLPMYTGNGVSFC--------------------FNCAQCDANAIC--KPDENLCVCAQGFTGNGITC--------------KAIDPSCNTNCHKDALCFKDSCI-CKSGLSGDGK-----NYCFDCKR-CDQNAICRPTEQ--RCVCKPEFRGDGFQCALNLKTTCQNDCHPNA----VRVNNCCRCKNGFFGDGFSFCFNCSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLI--GDGYNCLDCRKCHEK--------ATC--NIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICNRNLVGDGYQC-RAPEECNNDAD---------CVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSK------AVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAICTEKQ----------GCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKN----AVCIYQKCECLPGLVGNGFIKCTNCSECHKKALCHDQRG-CVCSHGYSGDGIQC----RIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCV--PLTCLSK---CHKYANCENGVCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGNGYSGCFDCSKCHANADCD-ESKGCTCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIIL---------------GCPVQCDKNA-VCLSNNCVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKD-----YNRKCVCLPGFQDDNGKCSPKECQPKCHMF 9896
            C +  EC  +A C      C C  G+ G    K+CV +DEC+     CH++A C N        Y G    FC                     N   C ANA C  KP    C C  GF G+G  C              K+     N +C  D +     C  C  G    GK     N C   K  C  NA C        C CK  +RGDGF C    +   ++ CHP+A    +  +  C C +GF GDG   C N           P    C+  E+F G         C        SL   + C C PG     +  +C+D  +C E         A C     S +CEC  GY G G  C  I             + C+  ++ C   A         +CIN            C    C C     GDG  C +  EE  +D           C   ++ C  D+  + +   C  G    + G CQ    +G C  K      A C+        C C  GF+GDGM  C D   C+   +C ++            C+C  GF     +C+V  +   N +   I    S    S +     +  +G   +    E  +   P   +         Q+ E +            +   CH  A C    G C+C  G+ GDG          D  SL S C D  K C  ST   + C C + +I     C   P  C+ +   C   A C+N  C+C+ G+ GDG+ C    E  S+      N  CV         TCK                                 CNP    + LC +     P       ++G      CH NA C+ ES+ C C  GF GNG  C P+  C+ +        IC+     + +C+C+ G       KC  L                C   CD +  +C+S  C+CK+G+         ++ C+   +C E + +C+ +        +  C C  G   D   C P   Q K  ++
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQN--------YVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDVEKFCGR---VDHVSCLSVRIYNGSL--SSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDI-------------DECDRGMAGCDSMA---------MCIN--------RMGSC---GCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGH-HPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGM-ICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKGKRGPPSIQPPAEMFTTPAPPPPSNGGYGEETNQEEEQVTSTTTTEAPSLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAK-CDNST---RSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGT------TCK---------------------------------CNPGYFGNGLCCV-----PDPLDCVHFTGI-----CHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLP----TGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFR-RNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVNQGKLSVY 2337          

HSP 14 Score: 93.2041 bits (230), Expect = 5.310e-18
Identity = 254/1012 (25.10%), Postives = 369/1012 (36.46%), Query Frame = 3
Query: 9159 DCKYENQECVAR----LDS-----SLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALC--VIG--TCKCPPSFKGNGYSGCFDCSKCH--------ANADCDESKG---CTCKPGFEGNGCYCRPEDK------CKFNSDCNDPLKIC-VQSPDTSRNC------VCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNN----CVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQ-DDNGKCS---PKECQP--------------KCHMFAICITQTCYCVPGY-FGDGIKSCTSCSVCHKN--------AQCLPDRG---CVCKSDFIGDGFNCRPLDEC------------------------------------RINEDCRDPNKMCLLNPS----MKNLQCT-----------CKPLHILINNYCLPKECT------SKCHKNAKC-----EGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKC--------------------------QPEPC------PINCHPLAQCKS------------GKCVCQGELQGDGIRTCFKCS-----SCHARAVC--SMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVF-QCIEETCPN--KCHNFAYC-RQKVCQCRLGFQGDGV------FNC-HDCSVCHPNAIC-SPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFN----NSLCYPIP-----------CVKQCDRNEE-CLFGQCQCKPGFIHNS----NKTCVEPNDCDV-----NNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIP 11531
            D   EN +C +     LD+     + +C C+ GF+    K S V+              C   D N  CH SA C   +G   C CP  F+      C D  +C         ANA C    G   C C+ GF G+G  C P  K          S C++    C V + D S  C        K G       +C+    P  C  NA C++ N    C CK GY G G  C   ++C +   C  P++ C  + + + KC C  GF+ D   KC+    + C+                  ++   ++  C C PG+ F     SC     C ++        A C+   G   C C   + G+G  C  +DEC                                    +I E+ +     C    S    ++  QCT           C P H  IN  C   + +      + C+K+A+C     +   C C  GFIGDG+ C    EC     C D+ + C+ T     F CVC+ GF+ ++ KC                          Q +P       P +  P A+  +            G+   Q E Q     T    S     +CH+ A C  S   C C  G++G+G              C  ++ A          C   P      SLC   A + KC  +++     C C  GY    +G  CSP  H Q   DC   ++ C    + Q +RC C  GF    V    I E   N  +C   A+C     C+C  G+ G+G+       +C H   +CHPNA+C S S  C C      G+G SC P+  CR D      NA+C  T     C C+ G+        +SL    P           CV  CD + + C+ G+C CK GF  NS    ++TC + ++C       +  A+C++             +C C  G +     C+P
Sbjct: 1387 DSSVENTKCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVD-----------VDECATGDHN--CHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAP--CSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPC-HPHAECTNL-EGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENT--IGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKGKRGPPSIQPPAEMFTTPAPPPPSNGGYGEETNQEEEQVTSTTTTEAPSLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTA-----------CSKKSTA---------DCISLP------SLC---ADKAKCDNSTRS----CECDAGYIG--DGYVCSP--HPQ---DCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQC-SSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTG---SCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTF--------GSHVCTCPDGHVGDGITCVP 2327          

HSP 15 Score: 92.0485 bits (227), Expect = 1.281e-17
Identity = 105/352 (29.83%), Postives = 148/352 (42.05%), Query Frame = 3
Query: 2448 CHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPP--CANHAIC-TVENTCQCRKNYYGNPL------EKCNIDCSKCHTDSDCDKTNGYCKCRYGFFGDGFTC----NKTCCVEKCHEQAQCVDGK-CLCKPGFSGDGV------ETCFHCSQ-CDSNAICDQNNKACICKSGFEGNGINCLRAINC---KQKCHKQARCL-LGKCICNKGLNGNGVEYCFNCTSCH-LNAKCIPRQNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGNCKCNN----NLIGDGISSCFDCDKCSMNA-RCD--------VSNQRCICQPGYEGNGIKCVKTCFQSCHKLAV 3386
            CH LA C   TG C CR  ++GDG + C           P  CA+ A C     +C+C   Y G+        + C +  + C  ++ C   N  C+C  GF GDG  C     +     +C   A CV G  C C PG+ G+G+        C H +  C  NA+C+  ++ C C SGF GNG++C    +C   K  C K A CL  G CIC  G  G+    C +  S    N + +   ++C                   TP       CI+G C C +    N    G  +C D D+C+  + +CD          +  C C  G+ G+GI CV    Q   KL+V
Sbjct: 2007 CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQ--NRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSC------------------VTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVNQG--KLSV 2336          

HSP 16 Score: 88.5817 bits (218), Expect = 1.339e-16
Identity = 237/930 (25.48%), Postives = 349/930 (37.53%), Query Frame = 3
Query: 9846 DNGKCSPKECQPKCHMFAICITQT--CYCVPGYFGDGIKS--------CTSCSVCHKNAQC---LPDRGCVCKSDFI-GDGFNCRPLDEC-RINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLP---KEC----TSKCH---KNAKCEGGMC-------QCLSGFIGDGINCQRPFECGIDN-PCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQP-----EPCPINCHPLAQCK----SGKCVCQGELQGDGIRTC--------------------FKCSSCHARAVCSMDGCKCMPGY--VGNGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIAC--RPKCGKNSQC----QLGVCVCK--DGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNFAYCRQKVCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFN-----NSLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGF---PNAKAICVCRKGFINKFGYCIPINCYQPCHKNAYC--NIGVCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKS----NPYSCKCPSGYEIDNNKCI--AKKCLLP---CDPNAVCVLGECICKVGFTGNGLQCMPTSKCNPLSGCS--DTNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVC---EPSCHPKAACIIGS--CICMKPLIGNGITECKLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQ---------LENSKCISKQECRVNVDCPT-----RKICVNSKCICPEQY 12299
            +N KC+  +   +C + A+C  +T  C C PG+ G   K          T    CH++A+C   +    C C + F   D  +C+ +DEC   N  C   N  C+  P      C C+   +     C+P   K C    +SK H    N  CE           +C+ G+   G  C+   EC  +  PC    +   +      F C C  G++     C       E  P  CHP A+C     S KC C    +GDGI+ C                      C S           C+C PG+        C   D+C+   +  D  +A     +   +C+C  G+  E  +C+ I    R   G +S      ++G C CK   GY+   +G +C  I+  + ++D      +       + K+C   +  +P    QC    C    H      Q +    L  Q +      +C   HP+     S  C+CP    IGDG  C   D+C     C D N  C  T  S  C C  G+ K +     +    P     + D          Q KP          ++P       PA    P     G+    N +   V           C  +     CH  A C  + GVC C   +IGDG T+C KK+     +DC  + S C  K+    +  SC+C +GY  D   C    + C+L    C P AVC    C C  GFTG+G++C+  S     S CS  D N+ C+         C C PGY  +    +  P+ C      CHP A C   S  C C     GNG++ C     C        KNA C  +      CIC+HGF+         L + +  ++Q+      C T      ++C++ +CIC   +
Sbjct: 1391 ENTKCTSSD---ECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGT--YSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNG---TFSCSCKQGYRGDGFMCTDINECDERHP--CHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTG--DGATCIKIEE-EPKSDKTACTDEWSRLCELEKKQCTVDEEEVP----QC--GACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPD-----SHFCSCPD-GFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKGKRGPPSIQPPAEMFTTPA---PPPPSNGGYGEETNQEEEQVTSTTTTEAPSLCSTVT----CHSLATCEQSTGVCICRDGFIGDGTTACSKKST----ADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCV--SIHERASNCSQCDANAHCV-----GGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLPT----GSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGF 2272          

HSP 17 Score: 83.9593 bits (206), Expect = 3.492e-15
Identity = 262/1094 (23.95%), Postives = 385/1094 (35.19%), Query Frame = 3
Query: 8472 TTCTDCSGCDKNAICTEKQG-CICKSGFIGD--GRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGF-KLLNGKCEPL-SCIYP----CAKNAVCIYQKCECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRI------EDQCSLNSDCTDPNKICITSTDTVKRCV----CKSSFISSNSGCVPLT-CLSK---CHKYANCENG----VCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRS---MRAYSGCVP-IDC-NPKCHRSALCVIGTCKCPPSFKGNGYS-GCFDCSKCH--------ANADCDESKG---CTCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNNCVCKTGYSGTGLNCKPNDQ--CSQNSDCPEPNSR-CEMMKDYNRKCV-----------CLPGFQDDNGKCSPKECQPKCHMFAICITQTCYCVPGYFGDGIKSCTSCSVCHKNAQCL---PDRG-CVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQ---------PEPCP-INCHPLAQCK--SGKCVCQGELQGDGIRTCFKCSS-------------------------------------------------CHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLC---SPI-------ACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIE---------------ETCPNKCHNFA-YCRQKVCQCRLGFQGD----GVFNCHDCSVCHPN-------AICSPSLG---CTCPGPHLIGDGRSCKPK-DQCRIDSDCRDSNAVCTLTYDSLKCQCKL 11261
            T CT    C  +A+C  + G C C+ GF G    + C+ ++ECA          R    +    G   C C  GF K  +G C+ +  C       C  NA C+ +     PG                          C C +G+ GDG QC        +   S  S C++ N  C    DTV   V    C   +  S   C  +  C+++   C   ANC N      C C  GY GDG +C   +EC     C + + EC   L+ S  C C SGF    E   +      ++RS   +  + G V  + C + + +  +L  +  C+C P F+    S  C D  +C         A+A C  ++G   C C  G+EG G  C   D+C       D + +C+                    G C                   C C  GY+G G  C   ++   S  + C +  SR CE+ K   ++C            CLPG    NG C          +  +C  +                   + C+K+A+C+   PD   C C   FIGDG  C  +DEC     C D N  C    ++ +  C C      ++  C+  E   K     K E       S   G     ++P   G   P   Q      T+ A        +G +    + Q         P  C  + CH LA C+  +G C+C+    GDG   C K S+                                                 C   AVC    C+C+PG+ G+G+ C +  +   +    D NA C  G      C+C PG+   N LC    P+        C P    NS+ +   C C  G+S   NG+SC P   C+++      N  C+  G      C+CR GF     ++C                  +C   C +    C    C C+ GF+ +    G   C D   C          A C  + G   CTCP  H +GDG +C P  +Q ++   C        L  ++   + K+
Sbjct: 1393 TKCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYV----GGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNK-----PGTYS-----------------------CECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSC--EVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPC-HPHAECT-NLEGSFKCECHSGF----EGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSV--CECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINR-----------------MGSC------------------GCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEK---KQCTVDEEEVPQCGACLPGHHPINGTCQ------SLQISGLCAQK-------------------NDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKC--ENTIGSFNCVCLEGFKKVDEKCVVDE--KKQPNREKIEIDEENSSSSNSGQ----EKPTTKGKRGPPSIQPPAEMFTTPAPPPPSNGGYGEETNQEEEQVTSTTTTEAPSLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGT----TCKCNPGY-FGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQ--CQCSSGFSG--NGVSCFPQKSCRTDKSVCAKNAICLPTG-----SCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGH-VGDGITCVPHVNQGKLSVYCEADGMTLVLGNETADFEGKI 2358          

HSP 18 Score: 82.8037 bits (203), Expect = 8.281e-15
Identity = 94/322 (29.19%), Postives = 129/322 (40.06%), Query Frame = 3
Query: 1959 CHIDATCYENN-MCICNSGHQGDGXXXXXXXXXXX----------XAECYPEISKCKCKPGFVGSGYECREE----VNCDIKCHENASCVNGYCKCNRNLIGDGI------NSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKS------CDKICHKDALC--QNSRCICKPNFEGDGVNYCF-------DCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPK-----------GNCFPPCANHAICTVENTCQCRKNYYGNP----------LEKCNIDCSKCHTDSDCDKTNG--YCKCRYGFFGDGFTC 2747
            CH  ATC ++  +CIC  G  GDG    +                 A+C      C+C  G++G GY C       V  D  C   A C N  C+C     GDG+          +C +C+  A C      C C PGY GNG  C+           ICH +A+C  ++ +C C   F G+GV+ CF       D S C K A C P TG+C CR  + GD   +C + + K            +C  PC +     +   C C+  +  N           +++C     KC   + C  T G   C C  G  GDG TC
Sbjct: 2007 CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGG-TTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLP-TGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2325          

HSP 19 Score: 82.4185 bits (202), Expect = 1.056e-14
Identity = 101/348 (29.02%), Postives = 149/348 (42.82%), Query Frame = 3
Query: 4662 SCHPDALCFPDQQECSCKSEFVGDGKI-CTLRAD---ICRPT-CGENAICVNG--QCQCQSGLQGNPL---KHCFDC----RPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHR---NAVCI-NQNCVCIPEYIGDG-------INFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIEL-KCEPS-CGENAKCV-NGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNA-LCVNRHCICLPGF----TGDGTRFCFDCSSCPKNSNCLPE---------EQKCICQEGYIMNGAKCQPIVHECR 5579
            +CH  A C      C C+  F+GDG   C+ ++    I  P+ C + A C N    C+C +G  G+      H  DC      C   AVC  +NRRC C  GF GDG  C  I E +  C +   NA C+    C C P Y G+G       ++       C  NA C   + +C C  GF+GNG++C   +  + + S C +NA C+  G C C  G +G+P   C +    +     D+ +                  V+ C   CDS+  LC++  CIC  GF    T  G+  C D   C + S+                C C +G++ +G  C P V++ +
Sbjct: 2006 TCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVC--QNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSD------------------VSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVNQGK 2333          

HSP 20 Score: 82.0333 bits (201), Expect = 1.452e-14
Identity = 266/1074 (24.77%), Postives = 390/1074 (36.31%), Query Frame = 3
Query: 9411 CFDCSKCHANADCDESKG-CTCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPD-----TSRNCVCKPGTTPSTNGKCI-ILGCPVQ----CDKNAVCLSN----NCVCKTGYSGTGLNCKP------NDQCSQNSDCPEPNSRCEM-MKDYNRKC-VCLPGFQDDNGKCSPKECQPKCHMFAICITQTCYCVPGYFGDGIKSCTSCSVCHKNAQCLPDRG---CVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKC---EGGM-CQCLSGFIGDGIN-CQRPFECGIDNPCKDQFSVC-----------QLTSDAKRFVCVCVFGFQM---INSKCQPEPCPI---NCHPLAQC-----KSGKCVCQGELQGDG-----IRTCFK-CSSCHARAVCSMD----GCKCMPGYVGNGIVC-QTEDQCQYDSD---------CRDRNAACFPGVDKGKKC-QCKPGFSLENSLCSPI------ACRPKCGKNSQC-----QLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCI--EETCPNKCHNFAYCRQKVCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLI---GDGRSCKPKDQCRIDSDCRDSNAVC-TLTYDSLK--------CQCKLGYI--------KFNNSLCYPIPCV----KQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPI-----NCYQPCHKNAYCNIGV-CTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCDPNAVC--VLGECICKVGFTGNGLQCMPTSKCNPLSGCSDTNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVC-EPSCHPKAA---------------CIIGSCICMKPLIGN----GITECKLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCI 12215
            C    +C  +A C+   G C C+PGFEG      P+  C    +C      C +S           C C  G   + +G C  I  C       C  NA C++     +C C+ G+ G G  C P      +   S  S C E N  CE+   D + +C  C+ G++  +GK         C     C+ +                   + C  NA C+   G   C CK  + GDGF C  ++EC    D R P                                    CH +A+C   EG   C+C SGF GDGI  C  P E      C+D    C           ++ + +   VC C  GF+     NS    + C     NC P +        S +C C    +G+G     I  C +  + C + A+C       GCKCM GY G+G  C + E++ + D           C      C    ++  +C  C PG    N  C  +      A +  C K+++C         C C DG+    +G+ C  +D C +   C D N KC          C+C +GF  K   +C+  E+  PN+       + ++ +        G           P +I  P+   T P P      G G     +++    +   ++ ++C T+T  SL         C C+ G+I        K + + C  +P +     +CD +       C+C  G+I +       P DC + +  +  SP  VC         C C  GF      C+ I     NC Q C  NA+C  G  C CNP Y G+G+        C+ D               P  C   +G                C PNAVC     +C C  GF+GNG+ C P   C         N++C+   PT    C+C+ G+ K      C  +V  EP+     +               CI G CIC      N    G   C   DEC+   H  ++ A C+N T G   C C  G   +   C+
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGFEG----APPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKK-SGKV--------CEDINECVAEK------------------APCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINEC----DERHP------------------------------------CHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLE----RSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIG--DGMICDDVDECNNAGMCDDENTKC--ENTIGSFNCVCLEGF-KKVDEKCVVDEKKQPNRE------KIEIDEENSSSSNSGQEKPTTKGKRGPPSIQPPAEMFTTPAPPPPSNGGYGEETNQEEEQVTSTTTTEAPSLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTR----SCECDAGYIGDGYVCSPHPQDCVLRD--NLCSPEAVC-----QNRRCQCLPGFTGDGVKCVSIHERASNCSQ-CDANAHCVGGTTCKCNPGYFGNGL-------CCVPD---------------PLDCVHFTGI---------------CHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICL---PTG--SCICRHGF-KGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRN-TFGSHVCTCPDGHVGDGITCV 2326          

HSP 21 Score: 79.337 bits (194), Expect = 9.736e-14
Identity = 130/515 (25.24%), Postives = 189/515 (36.70%), Query Frame = 3
Query: 4764 CRPTCGENAICV----NGQCQCQSGLQGNP--LKHCFDC--RPCHSFAVCD--VENRRCICQSGFEGDGRNCKKIKECSPK----CHRNAVCIN----QNCVCIPEYI-----GDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIEL--------KCEPSCGENAKCVNGKCE------------------CLPGLQG----------------NPLQHCF-NCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNK---CDSNALCVNRHCICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKC-HKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPG--FIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGDGIQVCFNCSTC 6092
            C+ TC     C+      QC C SG  G+   L+   +C   PCH  A C   + +  C C  G+EG+G  C  I ECS K    C  ++ CIN      C C   +      G G++ C + + C+  A    HN               C+A E+        KC   C    + ++GKCE                  C+  + G                 P   C  N   CD+ A C +    C CK GY G+G+TC  +N C+ K   C     C+N           DG   C       KN     ++  CI  +G              C  GCG+NA C N  C C+ G +G+P + C D  +C    + C     +CV     FG G+ C        +C + A   +   I   G  F   G +      +   +S            KD  +           + CTS C  N++C+ G CEC+ G+ G+ +  C +   C
Sbjct:   99 CQSTCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLEHPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGA----HN---------------CDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNL----------DGGYVCC------KNGQ---DDATCIKDQGAF------------CSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCV---NLFG-GFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELT------TSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDEC 553          

HSP 22 Score: 72.0182 bits (175), Expect = 1.632e-11
Identity = 106/388 (27.32%), Postives = 155/388 (39.95%), Query Frame = 3
Query: 3366 SCHKLAVCKE--GTCKCSNGLTGDGVNFCFN---------CSLCDKNAKCLINEEKCECMERFEGDGFTC----QDKVDCSSRCGENAFCYNGTCKCKLGFQGNPL------EHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPC-----------SFSCHPNAKC--IKGRCRCLSNLIGDGTTYCF-------NCSSCARNSDCKPEQQTCTCKRGYVKDG-NNCSIISAR-------------CHPECGVNAQ-CINGKCECLAGLQGNPF----QQCFDCKRCSQFA-DCDP--------WNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCSTCDINA--FCEPFNERCVCSVGFT 4316
            +CH LA C++  G C C +G  GDG   C            SLC   AKC  +   CEC   + GDG+ C    QD V   + C   A C N  C+C  GF G+ +      E   +C  C   A+C +    C C      F    C           +  CHPNA C     +C+C S   G+G + CF       + S CA+N+ C P   +C C+ G+  D    CS + ++             C   C  + Q CI+G+C C +G + N      + C D   C++ +  CD          +  C C  G++G+G TC   +N   +  ++ +CE            DG+       T D     F +   E   CS  F+
Sbjct: 2006 TCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHC-VGGTTCKC--NPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLP-TGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVN---QGKLSVYCE-----------ADGMTLVLGNETADFEGKIFVKGQAENPYCSKSFS 2374          

HSP 23 Score: 69.707 bits (169), Expect = 7.378e-11
Identity = 141/564 (25.00%), Postives = 204/564 (36.17%), Query Frame = 3
Query: 2532 ETF-LPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDKTNGYCKCRYGFFGDGFTCNKTCCVE---------KCHEQAQC---VDG-KCLCKPGFSGDGVETCFHCSQC-DSNAICDQNNKACI---------CKSGFEGNGINCLRAIN--CKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTS---------------------CHLNAKCIPRQNT--CECNSGFHGDGIQCKLLPLCTP--ACHPQASCINGN----CKCNNNLIGDGIS--------SCFDCDK----------CSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEE---KCECMERFEGDGFTCQDKVDCS---SRCGENAFCYNGT----CKCKLGFQGNPL-------EHCFDCRVC--HYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGDGTTYCFNCSSCARNSDC---KPEQQTCTCKRGYVKDGNNCSII 3938
            +TF LP      P AN +  +VENT             KC     +C  D+ C++  G C+C  GF G      K  CV+          CHE A+C   V G  C C  GF      +C    +C + N+ C   N  C+         C++GF G+G  C+      C      ++ C      C        VE C  C                       C LNA C+    T  C C  G+ GDG  C  +  C     CHP A C N      C+C++   GDGI         SC D +K           S+       +  C C+PG+        +    SC  +  C+E                    + CD  +   +N E   +CEC E +EG+G  C D  +C    + C   A C N      CKC  G+ G+         E   D   C   +   C++  ++C    E       P   +C P    I G C+ L  + G     C   + C ++++C    P+   C+C  G++ DG  C  +
Sbjct: 1371 DTFALPTTTTGAPQANDS--SVENT-------------KC-TSSDECGLDALCERRTGVCRCEPGFEG---APPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVE-CKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFR------FEKESNSCVDIDECEESR------------------NNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEE-----EVPQCGACLPGHHPINGTCQSL-QISG----LCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDV 1880          

HSP 24 Score: 67.0106 bits (162), Expect = 4.587e-10
Identity = 117/465 (25.16%), Postives = 170/465 (36.56%), Query Frame = 3
Query: 2961 CKQKCHKQARCLLG----KCICNKGLNGNGVEY-----CFNCTSCHLNAKCIPRQNT-----CECNSGFHGDGIQCKLLPLC----TPACHPQASCIN--GNCKCN-------NNLIGDGISSCFDCDKCSMNAR-CD--------VSNQRCI--CQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTG-----------DGVN-----FCF-NCSLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDCSSR----------------------------------------CGENAFCYNGTCKCKLGFQGNPLEHCFDCRVC-HYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCI-KGRCRCLSNLIGDGTTYCFNCSSCARNSDC--KPEQQTCTCKRGYV-KDGNNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFDCKRC 4055
            C+  C  +  CL      +C C+ G +G+  E      C     CH+ A+C   QNT     C C  G+ G+G +C  +  C    T  C   + CIN  G   CN           G G+  C D ++C   A  CD        + + +C+  C PGYE    KC         KL  C +    C N + G           DG N      C  N ++CD++A C I  + C+C   + GDG TC D  +C ++                                        CG+NA C N TC C  GF+G+P + C D   C    + C     +C+     ++F    C       A+C  +      S +   G  +          S         + T  RG + KD    +     C   C  N++C+ G CEC++G  GN    C D   C
Sbjct:   99 CQSTCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLE-HPCHMMAQC---QNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKC-DVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCV-----NLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDEC 553          

HSP 25 Score: 62.7734 bits (151), Expect = 1.002e-8
Identity = 132/514 (25.68%), Postives = 194/514 (37.74%), Query Frame = 3
Query: 3243 SSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIK--CV-----KTCFQSCHKLAVCKE----GTCKCSNGL--TGDG----VNFC--FNCSLCDKNAKCL--INEEKCECMERFEGDGFTC--QDKVDCSSRCGENAFCYNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITEND-IFSRTPCSFSCHPNAKCIKG----RCRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQ--------TCTCKRGYVKDG---------NNCSIISARC----HPECGVNAQCINGK----CECLAGLQ-GNPFQQCFDCKRCSQFA-DCDPWNE---------RCVCQSGYIGNGFTCTKIINC---VTKCHVNGFCENQE----CKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCSVGFTG----NGKKCSILAPITCK-RACHKKAKCVKGKCECL--PGLRGDGVQSCFDCSICDNNTVC---YPDQEKCVCNPGYYGDGTTC 4541
            + C   D+C ++A C+     C C+PG+EG   K  CV      T   +CH+ A C+       C C  G     DG    ++ C   N + C  NAKC+       CEC   F GDG+ C    K  C S     + C      C++    + ++   +C+ C             +C   N+ +  + PCS     NA C+       C C     GDG   C + + C     C P  +         C C  G+  DG          +C  +   C    H  C ++ +  NG     CEC  G +       C D   C +   +CDP +          RC C  GY G G  CT I  C   +  C     C N+     CKC+ G  GDG       +TC I    EP +++  C+  ++       K+C++      +  AC      + G C+ L   GL       C   + C+ +  C   +PD   C C  G+ GDG  C
Sbjct: 1393 TKCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEV----DTVDGSVECKEC----MGGYKKSGKVCEDINECVAEKAPCSL----NANCVNMNGTFSCSCKQGYRGDG-FMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSC-LSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDG-------ATC-IKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGL-------CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMIC 1877          

HSP 26 Score: 60.4622 bits (145), Expect = 5.096e-8
Identity = 110/453 (24.28%), Postives = 155/453 (34.22%), Query Frame = 3
Query: 4089 RCVCQSGYIGNGFTCTKIINCVTKCHVNGFC-ENQECKCLPGLI--------------GDGINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSC---FDC--------------------------------SICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEK---CHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCFDCRPC-HSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCI--PEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLT-CNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRC 5276
             C C  GY GNG  CT I  C  K  +   C E+ +C  LPG                G G++ C D + C+  A     +E C  S+G               C   C    + + GKCE +     + +  C    DC                                +ICD +  C+   + C C  GY GDG TC   ++ C  K   C    +C+N           DG   C  C +   DA C  DQ                      C   CG+NAIC N  C C  G +G+P K C D   C  + +VC     RC+   G    G  C +      +C   A   + + +     ++   G        S   ++         T  +G     +    +  L C   C  N++CV G CEC+ G  GN L  C +   C
Sbjct:  156 ECRCLPGYEGNGHECTDIDECSDK--LTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIG------------SFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINE-CDAKDTPCSDGGRCLNL----------DGGYVC--CKNGQDDATCIKDQ-------------------GAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCVNLFG----GFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSS-----GGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDEC 553          

HSP 27 Score: 59.6918 bits (143), Expect = 7.684e-8
Identity = 127/513 (24.76%), Postives = 181/513 (35.28%), Query Frame = 3
Query: 7863 KNQCFCRPGLIG------DGYNCLDCRKCHEKATC--NIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICN-------RNLVGDGY-QCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGA-----CHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKN-AICTEKQG-------CICKSGFIGDGRQCIVLNE-------CADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSG------DGIQCRIEDQC---------SLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVP----------LTCLSKCHKYANCENGVCKCILGYVGDGII-CRLPDECKSSLDCKYENQECVARLDSSLMC 9215
            K QC+C  G  G      D   CL+   CH  A C   + S +C CLPGY GNG EC  I  C+                           D ++  C       P H K + + G   CN       +   G G  +C    EC   A      E+C     S K + KC  G    + G+C+     G+     C  +A CV +  +                 C   S C KN AIC            C CK+G+ GDG  C  +NE       C+D   C  + G    C ++ +    C   QG            C   C  NA+C    C C+ G  G+   KC + +EC +        G  C + + G         +    DQ          S  +D T   +  I  + +++     S  I+   G +P          L C S C   + C  G C+C+ GY G+ ++ C   DEC + + C  E  E    L    +C
Sbjct:  115 KPQCYCDSGFSGSACELQDKNECLE-HPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECS---------------------------DKLTSRC-------PEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYEL-IDGKCEDVNECGSEKLHKCDVRADCVNT--IGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDG-GYVCCKNGQDDATCIKDQG----------AFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGS--ITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDECITEI-CNIEANEWCVNLIGGFVC 575          

HSP 28 Score: 56.9954 bits (136), Expect = 5.107e-7
Identity = 89/331 (26.89%), Postives = 124/331 (37.46%), Query Frame = 3
Query: 5160 ELKCEPSCGENAKCV----NGKCECLPGLQGNP--LQHCFNCKR--CDKFADCD--VWNKKCVCKNGYMGNGLTCISVNGCNNK----CDSNALCVN----RHCICLPGFT-----GDGTRFCFDCSSCPKNS-NCLPEEQ--------KCI--CQEGYIMNGAKCQPI-------VHEC--RPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKK----CHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLK----------------------------------------CNENALCVNQKCICLPGFIGDGIKFCFDCSACPAN 5891
            E KC+ +C     C+      +C C  G  G+   LQ    C    C   A C   + + +C C  GY GNG  C  ++ C++K    C  ++ C+N     +C C  GFT     G G   C D + C   + NC  +E         KC+  C  GY +   KC+ +       +H+C  R  C         +CE      G   Q    C+K    C + A C +    C CK GY G+G  C  IN C+ K                                        C +NA+C N  C C+ GF GD  K C D + C  N
Sbjct:   96 EHKCQSTCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLEHPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVEN 426          

HSP 29 Score: 53.1434 bits (126), Expect = 6.472e-6
Identity = 98/353 (27.76%), Postives = 140/353 (39.66%), Query Frame = 3
Query: 6621 CHHYASCVQD----KCECLPGFIGDGIKFCFKCSSCDPNADCV----PEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAK-------CFPSVK--KCI--CVIGYKGDGFRCYPV----ILECPKCHYRAQCV--IG--KCQCKNGLQGDGIN-----FCM-NCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPK---CHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKRCDQN-AICRPTEQRCV 7568
            CH  A C       +C CLPG+ G+G     +C+  D  +D +    PE  KC+   G Y                     +CN ++     G +G G+  C + ++C+  A        C  S+   KC+  C  GY+    +C  V      +  KC  RA CV  IG  +C+C+ G +GDG N      C  N + CD++A C      C+C+ GY GDG  C  I+EC  K   C     C+N           +G   C    Q DA          C+  QG              C+  C  +A+C   +C C  G  GD    C D   C +N ++C     RCV
Sbjct:  142 CHMMAQCQNTLGSYECRCLPGYEGNG----HECTDIDECSDKLTSRCPEHSKCINLPGTY---------------------YCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNL----------DGGYVCCKNGQDDAT---------CIKDQGAF------------CSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCV 438          

HSP 30 Score: 52.7582 bits (125), Expect = 8.900e-6
Identity = 102/407 (25.06%), Postives = 154/407 (37.84%), Query Frame = 3
Query: 4701 ECSCKSEFVGDGKICTLR---ADICRPTCGENAICVN----GQCQCQSGL-----QGNPLKHCFDCRPCHSFA-------VCD--VENRRCI--CQSGFEGDGRNCKKIKEC-SPKCHR---NAVCINQ----NCVCIPEYIGDGIN-----FCF-NCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIE---------------------------------------LKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRC-DKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICLPG--FTGDGTRFCFDCSSCPKNSN-CLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKC 5681
            EC C   + G+G  CT     +D     C E++ C+N      C C  G      QG+ L  C D   C + A       +C+  + + +C+  C  G+E     C+ + EC S K H+    A C+N      C C   + GDG N      C  N + CDR+A C    + C C  G+TG+G+TC+ I                                          C   CG+NA C N  C C+ G +G+P + C +   C +  + C     +CV     +  G  C        +C   A   +   I   G  FT  G +      S   +S   +   +  I ++  +    +       C   C  N++CV G CEC+ G  GN +  C D  +C
Sbjct:  156 ECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCV----NLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLA-----CTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDEC 553          
BLAST of Neurogenic locus notch-like protein protein 1 vs. Ensembl Celegans
Match: fbn-1 (FiBrilliN homolog [Source:UniProtKB/TrEMBL;Acc:I7LFE6])

HSP 1 Score: 127.872 bits (320), Expect = 1.709e-28
Identity = 250/956 (26.15%), Postives = 348/956 (36.40%), Query Frame = 3
Query: 2847 CFHCSQCDSNAICDQNNKACICKSGFEGN--GINCLRAINCK---QKCHKQARC--LLG--KCICNKGLNGNGVEYC--------FNCTSCHLNAKCI--PRQNTCECNSGFHGDGIQCKLLPLCTPACHPQAS----CINGNCKCNNNLIGDGISSCFDC---------------------DKCSMNARCDVSNQ--RCICQPGYEGNGIKC--VKTCFQS--CHKLAVCK--EGT--CKCSNGLTGDGVNFCFNCSLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDCSSRCGENAFCYNGT----CKCKLGFQGNPLEH-CFDCRVCHYPA-YCDIPNRKCICITEN-----------------DIFSRTPCSFSCHPNAKCIKGR----CRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQTCTCKRGYVK----DGNNCSIISARCHPECGV---NAQCINGKCECL--AGLQGNPFQQCFDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSI---------------------------------------LAPITCKRACHKKAKCVK--GKCECLPGLRGDGVQSC-----FDC----SICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEK---CHPNAKCVNRKCKCNERLVGDGVN------------------FCFNCTS---------------------------CHPDALCFPDQQECSCKSEFVGDGKIC----TLRADICRPTCGENAICV-NGQCQCQSGLQGNPLKHCFDC---RPCHSFAVCDVE--------------NRRCICQSGFEGD-----GRNCKKIKECSPKCH---RNAVCIN----QNCVCIPEYIGDGIN 5048
            C    +C  +A+C++    C C+ GFEG     +C+    C      CH+ ARC   +G   C C  G        C         N T C  NAKC+  P   +CEC +GF GDG QC  +P     C    S    C   N  C  + + DG   C +C                       CS+NA C   N    C C+ GY G+G  C  +  C +   CH  A C   EG+  C+C +G  GDG+  C N             E  CE +E+F G      D V C S        YNG+    C+C+ GF+     + C D   C      CD  +  C+    +                 DI         C   A CI       C+C++   GDG T C            +P+     C   + +    +   C++      P+CG        ING C+ L  +GL      Q  DC + ++  D  P +  C C  G+IG+G  C    + V +C+  G C+++  KC    IG      F+C  C +  F +  +E+CV       N +K  I                                        A +     CH  A C +  G C C  G  GDG  +C      DC    S+C +   C      C C+ GY GDG  C    Q C  +   C P A C NR+C+C     GDGV                    C   T+                           CHP+A+C  + ++C C S F G+G  C    + R D  +  C +NAIC+  G C C+ G +G+P   C       P +   + DV               +  CIC+SGF  +        C  I EC+ K H   R A C N      C C   ++GDGI 
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQC--VPTTKKPCDSTQSSKSHCSESNMSCEVDTV-DGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDVEKFCGR----VDHVSCLS-----VRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGAT-CIKIEE-------EPKSDKTACTDEWSRLCELEKKQCTVDEEEV-PQCGACLPGHHPINGTCQSLQISGL----CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMIC----DDVDECNNAGMCDDENTKC-ENTIGS-----FNC-VC-LEGF-KKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTD--KSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGIT 2299          

HSP 2 Score: 124.405 bits (311), Expect = 2.320e-27
Identity = 260/1007 (25.82%), Postives = 378/1007 (37.54%), Query Frame = 3
Query: 3048 CFNCTSCHLNAKCIPRQNTCECNSGFHGDGIQ--CKLLPLCTPA---CHPQASCING----NCKCNNNLIGDGISSCFDCDKCS-MNARCDVSNQRCICQPG---------YEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDCSSR---CGENAFC--YNGT--CKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKC--IKG--RCRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCINGKCECLAGLQ-GNPFQQCFDCKRCSQFAD-CDPWNE---------RCVCQSGYIGNGFTCTKIINC---VTKCHVNGFCENQE----CKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCSVGFTG----NGKKCSI--------------LAPI--TC-----------KRACHKKAKCVKGK-----CECLPGLRGDGVQSCFDCSICDNNTVCYPDQEKC---------VCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVN-------------RKCKCNERLVGD---------------GVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKI-CTLRAD---ICRPT-CGENAICVNG--QCQCQSGLQGNPL---KHCFDC----RPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHR---NAVCI-NQNCVCIPEYIGDG-------INFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIEL-KCEPS-CGENAKCV-NGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNA-LCVNRHCICLPGF----TGDGTRFCFDCSSCPKNSNCLPE---------EQKCICQEGYIMNGAKCQPIVHECR 5579
            C +   C L+A C  R   C C  GF G   +  C  +  C      CH  A C N      C C          SC D D+C+  N+ C  +N +C+ +PG         + G+G +CV T  + C      K     CS        N        D + +C       ECM  ++  G  C+D  +C +    C  NA C   NGT  C CK G++G+                        +C   N+   R PC    HP+A+C  ++G  +C C S   GDG   C N           P +++C     +    ++ S +S R      +    ++  CEC  G +       C D   C +  + CDP +          RC C  GY G G  CT I  C   +  C     C N+     CKC+ G  GDG       +TC I    EP +++  C+  ++       K+C++                PI  TC           K  C+K A+C+        C C  G  GDG+  C D   C+N  +C  +  KC         VC  G+      C +      EK  PN + +               K    E L                    + C   T CH  A C      C C+  F+GDG   C+ ++    I  P+ C + A C N    C+C +G  G+      H  DC      C   AVC  +NRRC C  GF GDG  C  I E +  C +   NA C+    C C P Y G+G       ++       C  NA C   + +C C  GF+GNG++C   +  + + S C +NA C+  G C C  G +G+P   C +    +     D+ +                  V+ C   CDS+  LC++  CIC  GF    T  G+  C D   C + S+                C C +G++ +G  C P V++ +
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKS---HCSES------NMSCEVDTVDGSVECK------ECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGF----------------------MCTDINECDERHPC----HPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDVEKFCGRVDHVSCLSVR------IYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDG-------ATC-IKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMI-CDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVV-----DEKKQPNREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVT-CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVC--QNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSD------------------VSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVNQGK 2308          

HSP 3 Score: 124.02 bits (310), Expect = 2.984e-27
Identity = 252/977 (25.79%), Postives = 366/977 (37.46%), Query Frame = 3
Query: 3243 SSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIK--CV-----KTCFQSCHKLAVCKE----GTCKCSNGL--TGDG----VNFC--FNCSLCDKNAKCL--INEEKCECMERFEGDGFTC--QDKVDCSSRCGENAFCYNGTCKCKLGFQGNPLEHCFDC--------RVCHYPAYCDIPNRKCI----CITENDIFS----------------------RTPCSFSCHPNAKC--IKG--RCRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCINGKCECLAGLQ-GNPFQQCFDCKRCSQFA-DCDPWNE---------RCVCQSGYIGNGFTCTKIINC---VTKCHVNGFCENQE----CKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCSVGFTG----NGKKCSILAPITCK-RACHKKAKCVKGKCECL--PGLRGDGVQSCFDCSICDNNTVC---YPDQEKCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHP----DALCFPDQQECSCKSEF-VGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCF-DCRPCHSFAVCDVENRRCICQSGFEGDGRNC---KKIKEC---SPKCHRNAVCIN--QNCVCIPEYIGDGINFCFNCSSCD-RNADCEP----HNNRCTCYQGFTGNGLTCNAIELKCE--PSCGENAKCVNG-KCECLPGLQGN-------PLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNK---CDSNALCV-NRHCICLPGFTGDGTRFCFD-CSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPM----QHCFD-------CKKCHKFADC--DVWNKKCVCKNGYFGNGYMCTP 5765
            + C   D+C ++A C+     C C+PG+EG   K  CV      T   +CH+ A C+       C C  G     DG    ++ C   N + C  NAKC+       CEC   F GDG+ C    K  C S     + C      C++      +E C +C        +VC     C      C     C+  N  FS                      R P    CHP+A+C  ++G  +C C S   GDG   C N           P +++C     +    ++ S +S R      +    ++  CEC  G +       C D   C +   +CDP +          RC C  GY G G  CT I  C   +  C     C N+     CKC+ G  GDG       +TC I    EP +++  C+  ++       K+C++      +  AC      + G C+ L   GL       C   + C+ +  C   +PD   C C  G+ GDG  C        ++C+    C +   KC E  +G      FNC         D  C  D+++   + +  + +    +  +   +PT  E+           +  +             CHS A C+     CIC+ GF GDG      K   +C      C   A C N  ++C C   YIGDG     +   C  R+  C P     N RC C  GFTG+G+ C +I  +      C  NA CV G  C+C PG  GN       PL        C   A C+  +++C C +G+ GNG++C     C      C  NA+C+    CIC  GF GD    C    S  P N   L +   C+                    P       C++G+C C  G + N      + C D         KC + A C     +  C C +G+ G+G  C P
Sbjct: 1393 TKCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVE-CKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHP----CHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDVEKFCGRVDHVSCLSVR------IYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDG-------ATC-IKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGL-------CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDV-----DECNNAGMCDDENTKC-ENTIGS-----FNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCV-------------------TPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVP 2302          

HSP 4 Score: 123.635 bits (309), Expect = 3.356e-27
Identity = 276/1005 (27.46%), Postives = 362/1005 (36.02%), Query Frame = 3
Query: 4881 AVCDVENRRCICQSGFEGD--GRNCKKIKECSP---KCHRNAVCINQNCVCIPEYIGDGINFC------FNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNG--CNNKCDSNALCVNRHCICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPI---VHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLK--CNENALCVNQ----KCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGDG-IQVCFNCSTCDKNA-NCFPYQE---------RCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICK--AGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPK--CHHYASCVQDK-----CECLPGFIGDGIKFCFKCSSCDPNADCVPEQQK---------CVCKTGFYGNGNKC----------DKIE----------STCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCS--KCDVNAKCFPSVKKCICVIGYKGDGFRCYPVILECPKCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGDG-------KNCVKIDE-CSPKCHQNAVCINSNCHCLPMYTGNGV------SFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSC---NTNCHKDALCFKDS--CICKSGLSGDGKNYCF-------DCKRCDQNAICRPTEQRCVCKPEFRGDGF 7598
            A+C+     C C+ GFEG    ++C  + EC+     CH +A C N        Y+G    FC       +  SC    +C  HN+ C                       CG NAKCVN      PG                           C C+NG++G+G  C+      C++   S + C   +  C    T DG+  C +C                    GY  +G  C+ I   V E  P C  NA CVN             M   F C                 CK GY G+G+MCT IN C+ +  C+ +A C N     KC C  GF GDGIK C +           P ++ C+        EK C  +   V C S    N   L   CEC PGF  +     C +   C+++  NC P            RC C   Y G G  C  I                     +C +G +G           C   A+C+     C CK  AG++G+G  C++  E   PK    A       +C      + K    D    P    CLP          + +N T C     +  C  K  C+ +A C+        C C  GFIGDG+  C     C+    C  E  K         CVC  GF     KC          +KIE          S  E P               +       TS   CS   C   A C  S   CIC  G+ GDG                         C      D I+    C++    A+C  +   CEC  GY GDG       ++CV  D  CSP+    AVC N  C CLP +TG+GV          NC+QCDANA C      C C  G+ GNG+ C      C      CH +A+C  +S  C C SG SG+G + CF       D   C +NAIC PT   C+C+  F+GD F
Sbjct: 1405 ALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQN--------YVGGYACFCPTGFRKADDGSCQDIDECTEHNSTC-----------------------CGANAKCVN-----KPGTY------------------------SCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVD-TVDGSVECKECMG------------------GYKKSGKVCEDINECVAEKAP-CSLNANCVN-------------MNGTFSCS----------------CKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDV------EKFCGRVDH-VSCLSVRIYNGS-LSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDI--------------------DECDRGMAG-----------CDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEE--EPKSDKTACTDEWSRLCEL----EKKQCTVDEEEVPQCGACLPGH--------HPINGT-CQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGM-ICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTA----------------------CSKKSTADCISLPSLCAD---KAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPE----AVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGG-TTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLPT-GSCICRHGFKGDPF 2202          

HSP 5 Score: 121.709 bits (304), Expect = 1.181e-26
Identity = 258/968 (26.65%), Postives = 355/968 (36.67%), Query Frame = 3
Query: 4500 CVCNPGYYGD--GTTCFLFSQLCT--EKCHPNAKCVNRK------CKCNERLVGDG----VNFC--FNCTSCHPDALCF--PDQQECSCKSEFVGDGKICT-LRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCFDCRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPK---CHRNAVCINQN----CVCIPEYIGDGINFCFNCSSCDRNADCEPHNN--------RCTCYQGFTGNGLT--CNAIELKCEPS---CGE-------NAKCVNGK----CECLPGLQ-GNPLQHCFNCKRCDKFAD-CDVWNKKCV---------CKNGYMGNGLTCISVNGCNNK---CDSNALCVNRH----CICLPGFTGDGTRFCFDCSSCPKNSN----------CLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECL--PGLQGNPMQHCFDCKKCHKFADC-DVWNKK--CVCKNGYFGNGYMCTPINGCNLKC---NENALCVNQ----KCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVL-----------------------CTSKCHKNAKCLK--GNCECLPGFVGDGIQVCFNCSTCD---------KNANCFPYQERCVCKPRYSGNG-------ENCVKI----GPESICPNXXXXXXXXXXXXXXXLQGFSGDGIK------TCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEG---SSPKCHSNAL--RVNQQCICLPGFIGDGKNFCF-------DCSTCPPNSDCLPQEQRCIC----KKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGDGIKFCFKCSSCDPNAD-CVPEQQKCVCKTGFYGNGN-----KCDKIESTCEPP--CAPGGFCNNS----KCQCNSGLKGDGVT 6896
            C C PG+ G     +C    +  T    CH +A+C N        C    R   DG    ++ C   N T C  +A C   P    C C++ F+GDG  C       C  T    + C      C+     + +    +C+ C                 G++  G+ C+ I EC  +   C  NA C+N N    C C   Y GDG   C + + CD    C PH          +C C+ GF G+G+    N +E  CE     CG        + +  NG     CEC PG +       C +   C++  + CD  +  CV         C  GY G G  C  ++ C+     CDS A+C+NR     C C+ G+TGDG   C      PK+            C  E+++C   E  +     C P  H            +NG C+ L   GL       C     C+K A+C D+      C C +G+ G+G +C  ++ CN      +EN  C N      C+CL GF     K   D    P       EK E         N     P  +  L                        T  CH  A C +  G C C  GF+GDG   C   ST D           A C      C C   Y G+G       ++CV       PE++C N+  +           L GF+GDG+K         NCS C   A CV     C C  G+ GNG  CV +       +  CH NA+    ++QC C  GF G+G + CF       D S C  N+ CLP    CIC    K D F   +  +   + P         +SCV                     + CD +   C+    +C+CK+GF  N        C  I+   E    C     C N+     C C  G  GDG+T
Sbjct: 1414 CRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEV----DTVDGSVECKEC---------------MGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGF-MCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGAT-CIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHP-----------INGTCQSLQISGL-------CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNR-----EKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQC----------LPGFTGDGVKCVSIHERASNCSQCDANAHCVGGT-TCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLPT-GSCICRHGFKGDPFYKCSSLVS--KEPANQQDLSDVSSCV---------------------TPCDSSTQLCI--SGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGIT 2299          

HSP 6 Score: 119.013 bits (297), Expect = 9.606e-26
Identity = 258/1001 (25.77%), Postives = 361/1001 (36.06%), Query Frame = 3
Query: 3561 SSRCGENAFC--YNGTCKCKLGFQGNP-LEHCFDC-------RVCHYPAYCD--IPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQTCTCKRGYVKDGNNC---------SIISARCH-PECGVN--AQCINGKCECLAGLQG--------NPFQQCFDCKR-CSQFADCDPWNE--RCVCQSGYIGNGFTCTKIINCVTK--CHVNGFCENQE----CKCLPGLIGDGINFC---FDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDG-VQSCFDCSICDNNT----------VCYPDQEKCVCNPGYYGDGTTCFLFSQ--LCTEKCHPNAKCVNRK----CKCNERLVGDGVNFCFNC--------TSCHPD--ALCFPDQQECSCKSEFVG------------DGKICTLR-ADIC--RPTCGENAICVNGQ-----CQCQSGLQGNPLKHCFDCRPCHSFAVCDVENRRC---------ICQSGFEGDGRNCKKIKECSPKCHRNAVCIN----------QNCVCIPEYIGD----------------GINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCI-SVNGC---NNKCDSNALCVNRHCICLPGFTGDGTR------FCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLK---CNENALCV-NQKCICLPGFIGDGIKFCFD-CSACPAN-------SNCVPE---------KKECKCAKDYFMNEKI-----CSPIKQPVLCTSKCHKNAKCL----KGNCECLPGFVGDGI 6065
            S  CG +A C    G C+C+ GF+G P  + C D          CH  A C   +    C C          P  F      K   G C+ +       +T C   + C      KP   +C C+ G++ DG  C         S  S++ H  E  ++     ++G  EC   + G            +C   K  CS  A+C   N    C C+ GY G+GF CT I  C  +  CH +  C N E    C+C  G  GDGI  C    + S  D+  FC   +     SV    NG   S+                    CEC PG R +    SC D   C+ +           V      +C C  GY G+G  C    +       C   A C+NR     CKC     GDG   C           T+C  +   LC  ++++C+   E V             +G   +L+ + +C  +  C ++A C++       C C  G  G+ +  C D   C++  +CD EN +C         +C  GF+     C   ++  P  +R  + I+          Q      E +                    + C   + C   A CE     C C  GF G+G T          +C   +K     C  LP L             C   A CD   + C C  GY+G+G  C      C   +N C   A+C NR C CLPGFTGDG +         +CS C  N++C+     C C  GY  NG  C P                            +P+        CH  A C+  +++C C +G+ GNG  C P   C      C +NA+C+    CIC  GF GD    C    S  PAN       S+CV             EC C   +  N  +     C+ I +    + KC + A C        C C  G VGDGI
Sbjct: 1398 SDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFC----------PTGFR-----KADDGSCQDIDECTEHNSTCCGANAKCVN----KPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIY-NGSLSSV--------------------CECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGAT-CIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMI-CDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQP--NREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVT-CHSLATCEQSTGVCICRDGFIGDGTT----------AC---SKKSTADCISLPSL-------------CADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVG-GTTCKCNPGYFGNGLCCVP----------------------------DPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGI 2298          

HSP 7 Score: 117.857 bits (294), Expect = 1.728e-25
Identity = 256/985 (25.99%), Postives = 384/985 (38.98%), Query Frame = 3
Query: 7506 CFDCKRCDQNAICRPTEQRCVCKPEFRG--------DGFQCALNLKTTCQNDCHPNAVRVNN-----CCRCKNGFFGDGFSFC--------FNCSNCSPNADCF--PHLSKCQCKEEFTGNGFICQRKECKP---------ACSEATSLCIKNQC-------FCRPGLIGDGYNCLDCRKC-HEKATCNIR--------SMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVC--VKG--KCICNRNLVGDGYQ-CRAPEECN-NDAD--CVQFQEV----CRKDQSSLKKICKCKDGLVRDLQG-------QCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDC-------SGCDKNAICTEKQG---CICKSGFIGDGRQCIVLNE--CADNSDCTTIRGR-----ASECIRSSEGIQKC-QCSQGFKLLNGKCEPLSCIYPCA------KNAVCI-----YQKCECLPGLVGNGFIKCTNCSECHKKALCHDQR----------GCVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKICITSTDT-VKRCVCKSSFIS----------------SNSGCVPLTCLSKCHKYANCE--NGVCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARL---DSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGNG------YSGCFDCSKCHANADCDESKGCTCKPGFEGNGCYCRPE--DKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQ---------CDKNAVCL-SNNCVCKTGYSG-------TGLNCKPNDQ--CSQNSDCPEP-NSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQP---------KCHMFAICI----TQTCYCVPGYFGDGI 9953
            C     C  +A+C      C C+P F G        D  +CA     T  ++CH +A R  N      C C  GF       C         N + C  NA C   P    C+C+  F G+G+ C     KP          CSE+   C  +          C  G    G  C D  +C  EKA C++         +  C C  GY G+GF C  I  C +                                      + PCHP A C  ++G  KC C+    GDG + C  P E +  D +  C +   V     R    SL  +C+C+ G   + +        +C++ + N    + AVCV +     RC C  G+ G+G   CTD        +GCD  A+C  + G   C C +G+ GDG  CI + E   +D + CT    R       +C    E + +C  C  G   +NG C+ L     CA      K+A CI        C C  G +G+G I C +  EC+   +C D+            CVC  G+     +C ++++   N +  + ++   +S+++  ++   K S  +                S S C  +TC    H  A CE   GVC C  G++GDG         KS+ DC      C  +    +S+  C C +G+       S      +++ ++          C+P+    A+C    C+C P F G+G      +    +CS+C ANA C     C C PG+ GNG  C P+  D   F   C+ P  +C      SR C C  G   S NG    + C  Q         C KNA+CL + +C+C+ G+ G       + ++ +P +Q   S  S C  P +S  ++    + +C+C  GF+ ++     + C           KC   A C     +  C C  G+ GDGI
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECA-----TGDHNCHESA-RCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDE--------------------------------------RHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEE-SRNNCDPASAVCVNTEG-SYRCECAEGYEGEGGV-CTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMI-CDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVTC----HSLATCEQSTGVCICRDGFIGDGTTACSK---KSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNL----------CSPE----AVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICH-PNAVCNSE---SRQCQCSSGF--SGNG----VSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLC--ISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGI 2298          

HSP 8 Score: 112.849 bits (281), Expect = 7.335e-24
Identity = 268/1131 (23.70%), Postives = 403/1131 (35.63%), Query Frame = 3
Query: 6267 DGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALR-VNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRT--PQCVPKCHHYASCVQ-DKCECLPGFIGDGIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSC--------FNCSKCDVNAKCF--PSVKKCICVIGYKGDGFRCYPVI------LECPKCHY-------RAQCVIGKCQCKNGLQG--------DGINFCM-NCSECDKNAQCF---PNFSKCECRQGYRGDGKNCVKIDECSPK--CHQNAVCINSN----CHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTG--NGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGDGK-NYCFDCKRCDQ--------NAICRPTE--QRCVCKPEFRGDGFQCA-LNLKTTCQNDCHPNAV---RVNNC-CRCKNGFFGDGFSFCFNCSNCSPNAD-----------CFPHLSKCQCKEE--------FTGNGFI---CQRKECKPACSEAT-----SLCI-----KNQCFCRPGLIGDGYNCLDCRKCHEKATCNIRSMKCE---------CLPGYIGNGFECISITSCTQSSDCIRPN-EICNVAISQCICEANSFLDPISKLCINPN--------------------CQPPCHPKAVCVK--GKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQ--SSLKKICKCKDGLVRDLQGQCQKPA----CNGACHSKAVCVKSSNLESRCLCLPGFVGDGM------TTCTDCSGCDKNAICTEKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIY---PCAKNAVCIYQ--KCECLPGLVGNGFIKC-------TNCSECHKKALCHDQRGCVCSHGYSGDGI-------------QCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSF-----ISSNSGCVPL-TCLSKCHK---YANCENG----VCKCILGYVGDGIIC 9128
            DG+    + ++  +           + ++G     +   E +E ++P     +      +   LP   G G++      T  P +   PQ +    +K     DT  + T  T  PQ          C   D+C  L          C     C+P  +  P ++ CV       + ++C   +  C        +     C C +G +     SC         N + C  NAKC   P    C C  G+ GDG++C P         +  K H            V G  +CK  + G        + IN C+   + C  NA C      FS C C+QGYRGDG  C  I+EC  +  CH +A C N      C C   + G+G+  C N           P E  C   + F G  + ++C ++        +  +L     C C+ G   + + N C D   C++        +A+C  TE   RC C   + G+G  C  ++        C   A+   R+ +C C+C  G+ GDG + C       P +D           C     +C   EE          G+  I   CQ  +    C++       + CI      + C C  G IGDG  C D  +C+    C+  + KCE         CL G+     +C+         +  +PN E   +         +    P +K  +                           CH  A C +  G CIC    +GDG    + +   + ADC+    +C       +  + C+C  G + D       P      +  C  +AVC        RC CLPGF GDG+         ++CS CD NA C     C C  G+ G+G  C+                                            +PL C++    C  NAVC  +  +C+C  G  GNG + C       T+ S C K A+C     C+C HG+ GD               Q  + D  S  + C    ++CI+       C+CKS F     +S +  C  +  C  K HK    A C N     VC C  G+VGDGI C
Sbjct: 1271 DGVSPTSSATAPEVPTTSASSTPDAVEESGIPSTSKPTAEPLETTAPSTEVTSPEGSGTEESTLPPTEGSGESTTSSAPTVEPATVLPPQNRN---EKPEPTKDTFALPTTTTGAPQANDSSVENTKCTSSDEC-GLDALCERRTGVC----RCEPGFEGAPPKKSCV-------DVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFS-CSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDVEKFCGRVDHVSCLSV------RIYNGSL--SSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGAT-CIKIEE-EPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCV-------VDEKKQPNREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKK---STADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQN-----RRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVP-------------------------------------------DPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNG-VSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISG-----ECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2300          

HSP 9 Score: 110.923 bits (276), Expect = 2.713e-23
Identity = 247/999 (24.72%), Postives = 356/999 (35.64%), Query Frame = 3
Query: 6894 TSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGFRCYPV-ILECPK----CHYRAQC--VIG--KCQCKNGLQGDGINFCMNCSECDK--------NAQCF--PNFSKCECRQGYRGDGKNCVKIDE--CSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDP--------SCNTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKRCDQNAICRPTEQ--------RCVCKPEFRGDGF-QCALNLKTTCQNDCHPNAVRVNNC----CRCKNGFFGD------GFSFCFNCSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRKCHE-KATCNIRSM--------KCECLPGYIGNGFECISITSCTQSSDCIRPNE---ICNVAISQCICEANSFLD---------PISKLCINPNCQPPCHPKAVCVKGK-----------CICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKIC-----KCKDGLVRDLQGQCQKPACN---------GACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCS--GCDKNAICTEKQG-CICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKC--EPLSCIYP---CAKNAVCIYQKCECLPGLVGNGFI------KCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYA--NCENGVCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEK--SSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGN----GYSGCFDCSKCHANA-DCDE---------SKGCTCKPGFEGNGCYCRP 9512
            T C +  +C ++A C      C C  G++G   +   V + EC      CH  A+C   +G   C C  G +      C +  EC +        NA+C   P    CEC  G+ GDG  CV   +  C       + C  SN  C                  D +  CK       C  G+  +G  C+ I+         S N NC      F  SC CK G  GDG   C D   CD+   C P  +        +C C   F GDG  +C   L+ +C+ D      RV++      R  NG          GF F    ++C         +   +C+E          R  C PA +   +     +C C  G  G+G  C D  +C    A C+  +M         C+C+ GY G+G  CI I    +S      +E   +C +   QC  +               PI+  C +      C  K  C K             C C    +GDG  C   +ECNN   C      C     S   +C     K  +  V D + Q  +              +   K    +S                  T+ + CS   C   A C +  G CIC+ GFIGDG         A   DC ++    ++  +     + C+C  G+      C   P  C+     C+  AVC  ++C+CLPG  G+G        + +NCS+C   A C     C C+ GY G+G+ C             DP                          CV  T +  CH  A  N E+  C+C  G+ G+G+ C     C++      +N  C+     +  C C+ GF+       SSLV+ +   ++ +   S CV     P    + LC+ G C C   F+ N    G   C D  +C   +  CD          S  CTC  G  G+G  C P
Sbjct: 1393 TKCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSC-------------EVDTVDGSVECKE------CMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTF--SCSCKQGYRGDG-FMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCE-DVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSC---------VDIDECEE---------SRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTA---DCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCC-----------VPDPLD------------------------CVHFTGI--CHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLP----TGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCV----TPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVP 2302          

HSP 10 Score: 104.375 bits (259), Expect = 2.449e-21
Identity = 107/334 (32.04%), Postives = 145/334 (43.41%), Query Frame = 3
Query: 2154 IKCHENASC--VNGYCKCNRNLIGDGINSC-----FDCLK----CNTEADCSPYENRCYCRPGYTGNGFTCI---KSC---DKICHKDALCQNSRCICKPNFEGDGV------NYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGV------SECETFLPKGNCFPPCANHAICTVEN-TCQCRKNYYGN-----PLEKCNIDCSKCHTDSDCDKTNGYCKCRYGFFGDGF----------------TCNKTCCVEKCHEQAQ-CVDGKCLCKPGFSGD----GVETCFHCSQC-DSNAICDQ--------NNKACICKSGFEGNGINCLRAIN 2960
            + CH  A+C    G C C    IGDG  +C      DC+     C  +A C      C C  GY G+G+ C    + C   D +C  +A+CQN RC C P F GDGV          +CS+C   A C   T  C C P Y G+G+       +C  F   G C P    +A+C  E+  CQC   + GN     P + C  D S C  ++ C  T G C CR+GF GD F                  + + CV  C    Q C+ G+C+CK GF  +    G ETC    +C + +  CD+         +  C C  G  G+GI C+  +N
Sbjct: 1980 VTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGT-TCKCNPGYFGNGLCCVPDPLDCVHFT--GICHP----NAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPT-GSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVN 2305          

HSP 11 Score: 103.99 bits (258), Expect = 3.097e-21
Identity = 241/866 (27.83%), Postives = 326/866 (37.64%), Query Frame = 3
Query: 8190 CICNRNLVGDGYQC----RAP--EECNNDADCVQFQEVCRKDQSSLKKICK------CKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDK------NAICTEKQG---CICKSGFIGDG---------RQCIVLNEC---ADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSC--IYPCAKN--------AVCIYQ----KCECLPGLVGNGFIKCTNCSECHK-------KALCHDQRG---CVCSHGYSGDGIQC-RIEDQC-SLNSDCTDP--------NKICITSTDTVKRC-VCKSSFISSNSGCVPLT----CLSK--CHKYANC-----ENGVCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRS-----------------------------------------MRAYSGCVPIDCNPKCHRSALC--VIGTCKCPPSFKGNGYSGC-----FDC----SKCHANADCDES-KGCTCKPGFEGNGCYCRPEDK-CKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPV----QCDKNAVCLS-NNCVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICITQT--CYCVPGYFGDGI-----KSC-TSCSVCHKNAQCLPDRGCVCKSDFIGDGF-NCRPL--DECRINEDCRDPNKMCLLNPSMKNL----QCTCKPLHILINNYCLP--------KECTSKCHK---NAKCE----GGMCQCLSGFIGDGINC 10283
            C C    +GDGYQC    + P     ++ + C +    C  D       CK       K G V +   +C   A    C   A CV  +   S C C  G+ GDG   CTD + CD+      +A CT  +G   C C SGF GDG         R C  + +     D+  C ++R      I +      C+C  GF+      E  SC  I  C ++        AVC+      +CEC  G  G G + CT+  EC +        A+C ++ G   C C  GY+GDG  C +IE++  S  + CTD          K C    + V +C  C       N  C  L     C  K  C+K+A C     ++  C C  G++GDG+IC   DEC ++  C  EN +C   +  S  C C  GF+ K ++  +V+ +    R                                            + S C  +     CH  A C    G C C   F G+G + C      DC    S C   A CD S + C C  G+ G+G  C P  + C    +   P  +C      +R C C PG T     KC+ +        QCD NA C+    C C  GY G GL C P+                         CV   G                CH  A+C +++  C C  G+ G+G+     KSC T  SVC KNA CLP   C+C+  F GD F  C  L   E    +D  D +       S   L    +C CK       N  L          EC  K HK    A C       +C C  G +GDGI C
Sbjct: 1500 CECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECV--AEKAPCSLNANCVNMNGTFS-CSCKQGYRGDGFM-CTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVR------IYNGSLSSVCECEPGFRFEK---ESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGV-CTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTI-GSFNCVCLEGFK-KVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTV----TCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVC-----QNRRCQCLPGFT-GDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDP----------------------LDCVHFTGI---------------CHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICK--SGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2300          

HSP 12 Score: 102.834 bits (255), Expect = 7.660e-21
Identity = 244/955 (25.55%), Postives = 343/955 (35.92%), Query Frame = 3
Query: 6282 CFNCSSCSIEAICVPDQEKCICKAGFSGN--GEQCVENIE--GSSPKCHSNALRVNQ----QCICLPGFIGDGKNFCFDCSTCP--------PNSDCL--PQEQRCICKKDYFMNDTQCIHTGRTP---QCVPKCH---HYASCVQDKC-------ECLPGFIGDG-----IKFCF-KCSSCDPNADCVPEQQ--KCVCKTGFYGNGNKCDKIESTCEP-PCAPGGFCNNS----KCQCNSGLKGDGVTSCFNCSKC---DVNAKCFPSVK-KCICVIGYKGD---------GFRCYPV------ILECPKCH-----YRAQCVIG----KCQCKNGLQGDGINFCMNCSECDKN-------AQCFPNFSKCECR--QGYRGDGKNCVKIDECSPKCHQNAVCINSNCH---------------------CLPMY-----TGNGVSFCFNCAQ---CDANAIC---KPDENLCVCAQGFTGNGITCKAIDP--------SCNTNCHKDALCFKDSCICKSGLSG-DGKNYCFDCKRCDQNAIC--------------RPTEQRCVCKPEFRGDGFQCALNLKTTCQ----NDCHPNAV--RVNNCCRCKNGFFGDGFSFCFNCSN---------CSPNADCFPHLSKCQCKEEFTGNGFIC---------QRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCL-------DCRKCHEKATCNIRSMKCECLPGYIGNGFECI-SITSCTQSSDCIRPNEICNVAISQCICEANSFLDPIS----KLCINPNCQPPCHPKAVCV-KGKCICNRNLVGDG-YQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNL--ESRCLCLPGFVGD----GMTTCTDCS-------GCDKNAICTEKQG---CICKSGFIGDGRQCI 8576
            C +   C ++A+C      C C+ GF G    + CV+  E       CH +A   N      C C  GF       C D   C          N+ C+  P    C C+  +  +  QC+ T + P       K H      SC  D         EC+ G+   G     I  C  + + C  NA+CV       C CK G+ G+G  C  I    E  PC P   C N     KC+C+SG +GDG+  C N  +    DV   C       C+ V  Y G          GFR          I EC +         A CV      +C+C  G +G+G   C +  ECD+        A C      C C+   GY GDG  C+KI+E  PK  + A C +                         CLP +     T   +     CAQ   C+ +A C    PD + C C  GF G+G+ C  +D           NT C      F  +C+C  G    D K    + K+ ++  I               +PT +  +  P+        A    T+        CH  A   +    C C++GF GDG + C   S          C+  A C      C+C   + G+G++C         +   C P      ++C   +C C PG  GDG  C+       +C +C   A C +    C+C PGY GNG  C+     C   +    PN +CN    QC C +    + +S    K C     +  C   A+C+  G CIC     GD  Y+C +          V  +   ++D S +                 C  P           C  S+ L     C+C  GF  +    G  TC D          CD+ A C    G   C C  G +GDG  C+
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEG-GVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEE-EPKSDKTA-CTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSF--NCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPE-----AVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHC-VGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTD--KSVCAKNAICLPTGSCICRHGFKGDPFYKCSS---------LVSKEPANQQDLSDVS---------------SCVTP-----------CDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCV 2301          

HSP 13 Score: 101.679 bits (252), Expect = 1.685e-20
Identity = 224/822 (27.25%), Postives = 306/822 (37.23%), Query Frame = 3
Query: 2706 CKCRYGFFGDGFTC-------------NKTCCVEKCHE-QAQCVDGKCLCKP---GFSGDGV------ETCFHCSQCDSNAICDQNNK--ACICKSGFEGNGINCLRAINCKQK--CHKQARC--LLG--KCICNKGLNGNGVEYCFN--------------------CTSCHLNAKCIPRQNTCECNSGF--HGDGIQCKLLPLCTPA---CHP-QASCINGN----CKCNNNLIGDGISSCFDCDKCSMN-ARCDVSNQRCI---------CQPGYEGNGIKCVK----------TCFQSCHKL--------AVCKEGTCKCSNGLTG----DGV-------NFCFNCSLCDKNAKCL---INEEKCECMERFEGDGFTCQDKVDCSSRC---GENAFCYNG----TCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICI----------------TENDIF-----------------SRTPCS-FSCHPNAKCIK--GRCRCLSNLIGDGTTYCFNCSS---------CARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPE--------CGVNAQCINGKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCV------CQSGYIGNGFTCT-KIINCV---TKCHVNGFC--ENQECKCLPGLIGDGINFCF-------DCSTCDINAFCEPFNERCVCSVGFTGNG-KKCSILAP------------ITCKRACHKKAK-CVKGKCECLPGLRGD----GVQSCFDCS-------ICDNNTVCYPD--QEKCVCNPGYYGDGTTCF 4544
            C+C  GF GDG+ C             +K+ C E     +   VDG   CK    G+   G       E     + C  NA C   N   +C CK G+ G+G  C     C ++  CH  A C  L G  KC C+ G  G+G++ C N                    C S  +    +   + CEC  GF    +   C  +  C  +   C P  A C+N      C+C     G+G   C D D+C    A CD S   CI         C  GY G+G  C+K           C     +L         V +E   +C   L G    +G          C   + C+K+A+C+    +   C C + F GDG  C D  +C++      EN  C N      C C  GF+    +   D +          PNR+ I I                T+  +                  S + CS  +CH  A C +  G C C    IGDGTT C   S+         CA  + C    ++C C  GY+ DG  CS      HP+        C   A C N +C+CL G  G+  +     +R S  + CD  N  CV      C  GY GNG  C    ++CV     CH N  C  E+++C+C  G  G+G++ CF       D S C  NA C P    C+C  GF G+   KCS L               +C   C    + C+ G+C C  G R +    G ++C D          CD    C        C C  G+ GDG TC 
Sbjct: 1500 CECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSL--SSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEG-GVCTDIDECDRGMAGCD-SMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEK--------KQPNREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSP-----HPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCD-ANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLPTG-SCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCV 2301          

HSP 14 Score: 96.2857 bits (238), Expect = 6.572e-19
Identity = 204/756 (26.98%), Postives = 289/756 (38.23%), Query Frame = 3
Query: 2091 CKCKPGFVGSGYECREEVNCDIK--CHENASCVNGY----CKCNRNLIGDGINSCFDCLKCNTEADCSPYENR-------------------CYCRPGY----TGNGFTCIKSCDKICH----KDALCQNS----RCICKPNFEGDGVNYCFDCSKCHK-------LAQCHPKTGNCTCR--PPYVGDGVSECETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDKTNGYCKCRYGFFGDGFTCNKT----CCVEK--CHEQAQCVDGK-----CLCKPGFSGDGVETCFHCSQCDSNAICDQNNKAC---------ICKSGFEGNGINCLRAINCKQKCHKQARCL-----------LGKCICNKGLNGN---------------GVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGDGI---------QCKLLPLCTPACHPQASCING--NCKCNNNLIGDGI------SSCFDCDK-CSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQS-----CHKLAVCKEG-TCKCSNGLTGDG----------VNFCFNCSLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDC---SSRCGENAFCY-NGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLS----NLIGDGTTYCFNCSSCA-------RNSDCKPE--QQTCTCKRGYVKDGNNC 3929
            C CK G+ G G+ C +   CD +  CH +A C N      C+C+    GDGI  C + L+ + E D   +  R                   C C PG+      N    I  C++  +      A+C N+    RC C   +EG+G   C D  +C +       +A C  + G+C C+    Y GDG + C     +     P ++   CT E +  C        LEK      +C  D +     G   C  G      TC        C +K  C++ A+C+D       C C  GF GDG+  C    +C++  +CD  N  C         +C  GF+     C+  ++ K++ +++   +             K    + L                      C   T CH  A C      C C  GF GDG           C  LP     C  +A C N   +C+C+   IGDG         C   D  CS  A C   N+RC C PG+ G+G+KCV    ++     C   A C  G TCKC+ G  G+G          V+F     +C  NA C     +C+C   F G+G +C  +  C    S C +NA C   G+C C+ GF+G+P   C    V   PA     +    C+        TPC  S      CI G C C S    N    G+  C +   CA       R + C+       CTC  G+V DG  C
Sbjct: 1591 CSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCE-DVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEG-GVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGAT-CIKIEEE-----PKSDKTACTDEWSRLCE-------LEK-----KQCTVDEEEVPQCG--ACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGM-ICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCV--VDEKKQPNREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVT-CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLP---SLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVC--QNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHF---TGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSL-VSKEPANQQDLSDVSSCV--------TPCDSSTQ---LCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2300          

HSP 15 Score: 95.1301 bits (235), Expect = 1.598e-18
Identity = 246/987 (24.92%), Postives = 357/987 (36.17%), Query Frame = 3
Query: 9159 DCKYENQECVAR----LDS-----SLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALC--VIG--TCKCPPSFKGNGYSGCFDCSKCH--------ANADCDESKG---CTCKPGFEGNGCYCRPEDK------CKFNSDCNDPLKIC-VQSPDTSRNC------VCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNN----CVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCH------------------MFAICITQTCYCVPGY-FGDGIKSCTSCSVCHKN--------AQCLPDRG---CVCKSDFIGDGFNCRPLDEC------------------------------------RINEDCRDPNKMCLLNPS----MKNLQCT-----------CKPLHILINNYCLPKECT------SKCHKNAKC-----EGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKC------QP------------------EPCPINCHPLAQCKSGKCVCQGELQGDGIRTCFKCSSCHARAVC--SMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVF-QCIEETCPN--KCHNFAYC-RQKVCQCRLGFQGDGV------FNC-HDCSVCHPNAIC-SPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFN----NSLCYPIP-----------CVKQCDRNEE-CLFGQCQCKPGFIHNS----NKTCVEPNDCDV-----NNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIP 11531
            D   EN +C +     LD+     + +C C+ GF+    K S V+              C   D N  CH SA C   +G   C CP  F+      C D  +C         ANA C    G   C C+ GF G+G  C P  K          S C++    C V + D S  C        K G       +C+    P  C  NA C++ N    C CK GY G G  C   ++C +   C  P++ C  ++  + KC C  GF+ D  K      +  C                   ++   ++  C C PG+ F     SC     C ++        A C+   G   C C   + G+G  C  +DEC                                    +I E+ +     C    S    ++  QCT           C P H  IN  C   + +      + C+K+A+C     +   C C  GFIGDG+ C    EC     C D+ + C+ T     F CVC+ GF+ ++ KC      QP                  +  P     L   +                +     +CH+ A C  S   C C  G++G+G              C  ++ A          C   P      SLC   A + KC  +++     C C  GY    +G  CSP  H Q   DC   ++ C    + Q +RC C  GF    V    I E   N  +C   A+C     C+C  G+ G+G+       +C H   +CHPNA+C S S  C C      G+G SC P+  CR D      NA+C  T     C C+ G+        +SL    P           CV  CD + + C+ G+C CK GF  NS    ++TC + ++C       +  A+C++             +C C  G +     C+P
Sbjct: 1387 DSSVENTKCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVD-----------VDECATGDHN--CHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAP--CSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPC-HPHAECTNLEG-SFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENT--IGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTA-----------CSKKSTA---------DCISLP------SLC---ADKAKCDNSTRS----CECDAGYIG--DGYVCSP--HPQ---DCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQC-SSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTG---SCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTF--------GSHVCTCPDGHVGDGITCVP 2302          

HSP 16 Score: 94.3597 bits (233), Expect = 2.756e-18
Identity = 247/988 (25.00%), Postives = 366/988 (37.04%), Query Frame = 3
Query: 2064 AECYPEISKCKCKPGFVGSG-----YECREEVNCDIKCHENASC---VNGY-CKCNRNLIGDGINSCFDCLKCNTEADCS-----------PYENRCYCRPGYTGNGFTCI----KSCDKICHKDALCQNSRCICKPNFEGDGVNYCFDCSKCHK------------LAQCHP-----------KTGNCTCRPPYVGDG-----VSECETFLPKGNCFPPCANHAICT-VENT--CQCRKNYYGNPLEKCNIDCSKCHTDSD--CDKTN---------------GYCKCRYGFFGDGFTCNKTCCVE--KCHEQ--------AQCVDG----KCLCKPGFSGDG-----VETCFH-CSQCDSNAICDQNNKACICK--SGFEGNGINCLRAINCKQKCHKQA---------------------------RCLLGKCICN---KGLNGNGVEYCFNCTSCHLNAKCI---PRQNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYE--------------GNGIKCVKTCFQ-------------------------SCHKLAVCKE--GTCKCSNGLTGDGVNFCFN---------CSLCDKNAKCLINEEKCECMERFEGDGFTC----QDKVDCSSRCGENAFCYNGTCKCKLGFQGNPL------EHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPC-----------SFSCHPNAKC--IKGRCRCLSNLIGDGTTYCF-------NCSSCARNSDCKPEQQTCTCKRGYVKDG-NNCSIISAR-------------CHPECGVNAQ-CINGKCECLAGLQGNPF----QQCFDCKRCSQFA-DCDP--------WNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCSTCDINA--FCEPFNERCVCSVGFT 4316
            A C      C+C+PGF G+       +  E    D  CHE+A C   V GY C C          SC D  +C TE + +           P    C C  G+ G+G+ C+    K CD      + C  S   C+ +   DG   C +C   +K            +A+  P            T +C+C+  Y GDG     ++EC+   P       C  HA CT +E +  C+C   + G+ ++KC     +   D +  C + +                 C+C  GF    F      CV+  +C E         A CV+     +C C  G+ G+G     ++ C    + CDS A+C     +C CK  +G+ G+G  C++ I  + K  K A                            CL G    N   + L  +G+  C     C+ +A+CI   P  + C C  GF GDG+ C  +  C  A      C + N KC N  IG     C +  K  ++ +C V  ++   QP  E              G      K                             +CH LA C++  G C C +G  GDG   C            SLC   AKC  +   CEC   + GDG+ C    QD V   + C   A C N  C+C  GF G+ +      E   +C  C   A+C +    C C      F    C           +  CHPNA C     +C+C S   G+G + CF       + S CA+N+ C P   +C C+ G+  D    CS + ++             C   C  + Q CI+G+C C +G + N      + C D   C++ +  CD          +  C C  G++G+G TC   +N   +  ++ +CE            DG+       T D     F +   E   CS  F+
Sbjct: 1405 ALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDEC-TEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTV-DGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHP-------CHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFR---FEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIK-IEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGL--CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNA----GMCDDENTKCENT-IGSFNCVCLEGFK-KVDEKCVVDEKK---QPNREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHC-VGGTTCKC--NPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLP-TGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVN---QGKLSVYCE-----------ADGMTLVLGNETADFEGKIFVKGQAENPYCSKSFS 2349          

HSP 17 Score: 90.5077 bits (223), Expect = 3.467e-17
Identity = 245/1015 (24.14%), Postives = 354/1015 (34.88%), Query Frame = 3
Query: 7101 CMNCSECDKNAQCFPNFSKCECRQGYRGD--GKNCVKIDECSP---KCHQNAVCINSNCHCLPMYTGNGVSFC--------------------FNCAQCDANAIC--KPDENLCVCAQGFTGNGITC-KAIDPSCNTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNC--CRCKNGFFGDGFSFCFNCSNCSPNADCFPHLS--------KCQCKEEFTGNGFICQRKECKPACSEATSLC-----------------IKNQCFCRPGLI--GDGYNCLDCRKCHEK--------ATC--NIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSK------AVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAICTEKQ----------GCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCECLPGLVGNGFIKCTNCSE--CHKKALCHDQRG-CVCSHGYSGDGIQC----RIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVP--LTCLSK---CHKYANCENGVCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVP--IDC---NPKCHRSALCVIGT--CKCPPSFKGNGYSGCF-------DCSKCHANADCDESKGCTCKPGFEGNGCY----------CRPEDKCKFNS---DCNDPLKICVQSPDTSRNCVCKPG----TTPSTNGKCIILG----CPVQCDKNAVCL----SNNCVCKTGYSGTGLNCKPN 9743
            C +  EC  +A C      C C  G+ G    K+CV +DEC+     CH++A C N        Y G    FC                     N   C ANA C  KP    C C  GF G+G  C       C++     + C + +  C+     D  +   +CK C      + + + C    E   +   C+LN           N V +N    C CK G+ GDGF  C + + C     C PH          KC+C   F G+G        + +C +    C                 + + C C PG     +  +C+D  +C E         A C     S +CEC  GY G G  C  I  C +         +C   +  C C+  +        CI    +P     A   +   +C                          ++ C  D+  + +   C  G    + G CQ    +G C  K      A C+        C C  GF+GDGM  C D   C+   +C ++            C+C  GF     +C+V  +   N +   I         S+ G +K                     P  K ++   Q                + CS   CH  A C    G C+C  G+ GDG          D  SL S C D  K C  ST   + C C + +I     C P    C+ +   C   A C+N  C+C+ G+ GDG+ C    E  S+      N  CV        C C  G+           N +           CVP  +DC      CH +A+C   +  C+C   F GNG S CF       D S C  NA C  +  C C+ GF+G+  Y             +D    +S    C+   ++C+     S  C+CK G    +T S +  C  +        +CD+ A C     S+ C C  G+ G G+ C P+
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQN--------YVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEV----DTVDGSVECKEC--MGGYKKSGKVCEDINECVAEKAPCSLNA----------NCVNMNGTFSCSCKQGYRGDGF-MCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELE-----------------------KKQCTVDEEEVPQCGACLPGH-HPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMI-CDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNRE--KIEIDEENSSSSNSGQEK---------------------PTTKESLTTPQPPPTTTTTAKPATTSASLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAK-CDNST---RSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVG----GTTCKCNPGY---------FGNGLC----------CVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCI-----SGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPH 2303          

HSP 18 Score: 82.4185 bits (202), Expect = 9.221e-15
Identity = 94/322 (29.19%), Postives = 129/322 (40.06%), Query Frame = 3
Query: 1959 CHIDATCYENN-MCICNSGHQGDGXXXXXXXXXXX----------XAECYPEISKCKCKPGFVGSGYECREE----VNCDIKCHENASCVNGYCKCNRNLIGDGI------NSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKS------CDKICHKDALC--QNSRCICKPNFEGDGVNYCF-------DCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPK-----------GNCFPPCANHAICTVENTCQCRKNYYGNP----------LEKCNIDCSKCHTDSDCDKTNG--YCKCRYGFFGDGFTC 2747
            CH  ATC ++  +CIC  G  GDG    +                 A+C      C+C  G++G GY C       V  D  C   A C N  C+C     GDG+          +C +C+  A C      C C PGY GNG  C+           ICH +A+C  ++ +C C   F G+GV+ CF       D S C K A C P TG+C CR  + GD   +C + + K            +C  PC +     +   C C+  +  N           +++C     KC   + C  T G   C C  G  GDG TC
Sbjct: 1982 CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGG-TTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLP-TGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2300          

HSP 19 Score: 80.8777 bits (198), Expect = 3.188e-14
Identity = 154/584 (26.37%), Postives = 230/584 (39.38%), Query Frame = 3
Query: 3921 NNCSIISARC--HPECGVNAQC--INGKCECLAGLQGNPFQQ-CFDCKRCSQF-ADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCST--CDINAFC--EPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDC--------SICDNNTVCYPDQE---------------KCVCNPGYYGDGTTCFLFSQLCTEK--CHPNAKCVNR----KCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGD-GKICTLRADICRPTCGENAICVNGQCQCQSGLQGNPLKH-CFD----------CRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECS---PKCHRNAVCINQ----NCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCE------PSCGE---NAKCVNGKCECL--PGLQGNPLQHCFNCKRCDKFADC-DVWNKK--CVCKNGYMGNGLTCISVNGCNNKC---DSNALCVNR----HCICLPGF 5435
            N+ S+ + +C    ECG++A C    G C C  G +G P ++ C D   C+    +C   +E   CQ+ Y+G G+ C              FC     K   G   D I+ C + ++  C  NA C  +P    C C  GF G+G +C       C      K+ C +    C      DG   C +C         +C++   C  ++                 C C  GY GDG  C   ++ C E+  CHP+A+C N     KC+C+    GDG+  C N           P ++ C    +F G    +  L   I   +       ++  C+C+ G +     + C D          C P  +  V    + RC C  G+EG+G  C  I EC      C   A+CIN+     C C+  Y GDG   C            EP +++  C   ++     C   + +C       P CG        +NG C+ L   GL       C     C+K A+C D+      C C +G++G+G+ C  V+ CNN     D N  C N     +C+CL GF
Sbjct: 1386 NDSSVENTKCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNC---HESARCQN-YVG-GYAC--------------FCPTGFRKADDGSCQD-IDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTV-DGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINE-CDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDVEKFCGRVDHVSCLSVRIYNGS-------LSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGAT-CIKIEE-------EPKSDKTACTDEWS---RLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGL-------CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGF 1911          

HSP 20 Score: 79.7221 bits (195), Expect = 7.251e-14
Identity = 261/1071 (24.37%), Postives = 383/1071 (35.76%), Query Frame = 3
Query: 8472 TTCTDCSGCDKNAICTEKQG-CICKSGFIGD--GRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGF-KLLNGKCEPL-SCIYP----CAKNAVCIYQKCECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRI------EDQCSLNSDCTDPNKICITSTDTVKRCV----CKSSFISSNSGCVPLT-CLSK---CHKYANCENG----VCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVP-IDC-NPKCHRSALCVIGTCKCPPSFKGNGYS-GCFDCSKCH--------ANADCDESKG---CTCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNNCVCKTGYSGTGLNCKPNDQ--CSQNSDCPEPNSR-CEMMKDYNRKCV-----------CLPGFQDDNGKCSPKEC------QPKCHMFAICI-----TQTCYCVPGYFGDG-----IKSCTSCSVCH-KNAQCLPDRG---CVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCLL--------------NPSMKNLQCTCKPLHILINNYCLPKECTS-----KCHKNAKCE--GGMCQCLSGFIGDGINC---QRPFEC-GIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGDGIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLC---SPI-------ACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIE---------------ETCPNKCHNFA-YCRQKVCQCRLGFQGD----GVFNCHDCSVCHPN-------AICSPSLG---CTCPGPHLIGDGRSCKPK-DQCRIDSDCRDSNAVCTLTYDSLKCQCKL 11261
            T CT    C  +A+C  + G C C+ GF G    + C+ ++ECA          R    +    G   C C  GF K  +G C+ +  C       C  NA C+ +     PG                          C C +G+ GDG QC        +   S  S C++ N  C    DTV   V    C   +  S   C  +  C+++   C   ANC N      C C  GY GDG +C   +EC     C + + EC   L+ S  C C SGF+    K    N        +  + G V  + C + + +  +L  +  C+C P F+    S  C D  +C         A+A C  ++G   C C  G+EG G  C   D+C       D + +C+                    G C                   C C  GY+G G  C   ++   S  + C +  SR CE+ K   ++C            CLPG    NG C   +       +  C+  A CI     +  C C  G+ GDG     +  C +  +C  +N +C    G   CVC   F       + +DE  + ++ + PN+  +                P+ K    T +P               S      CH  A CE   G+C C  GFIGDG      +   +C  + + C D+        D     C C  G+      C P P               CV +  L             C   AVC    C+C+PG+ G+G+ C +  +   +    D NA C  G      C+C PG+   N LC    P+        C P    NS+ +   C C  G+S   NG+SC P   C+++      N  C+  G      C+CR GF     ++C                  +C   C +    C    C C+ GF+ +    G   C D   C          A C  + G   CTCP  H +GDG +C P  +Q ++   C        L  ++   + K+
Sbjct: 1393 TKCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYV----GGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNK-----PGTYS-----------------------CECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSC--EVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPC-HPHAECT-NLEGSFKCECHSGFEGDGIKK-CTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSV--CECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINR-----------------MGSC------------------GCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEK---KQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGF-------KKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKESLTTPQPPPTTTTTAKPATTSASLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKC-----DNSTRSCECDAGYIGDGYVCSPHP-------------QDCVLRDNL-------------CSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGT----TCKCNPGY-FGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQ--CQCSSGFSG--NGVSCFPQKSCRTDKSVCAKNAICLPTG-----SCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGH-VGDGITCVPHVNQGKLSVYCEADGMTLVLGNETADFEGKI 2333          

HSP 21 Score: 78.9518 bits (193), Expect = 1.261e-13
Identity = 130/515 (25.24%), Postives = 189/515 (36.70%), Query Frame = 3
Query: 4764 CRPTCGENAICV----NGQCQCQSGLQGNP--LKHCFDC--RPCHSFAVCD--VENRRCICQSGFEGDGRNCKKIKECSPK----CHRNAVCIN----QNCVCIPEYI-----GDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIEL--------KCEPSCGENAKCVNGKCE------------------CLPGLQG----------------NPLQHCF-NCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNK---CDSNALCVNRHCICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKC-HKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPG--FIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGDGIQVCFNCSTC 6092
            C+ TC     C+      QC C SG  G+   L+   +C   PCH  A C   + +  C C  G+EG+G  C  I ECS K    C  ++ CIN      C C   +      G G++ C + + C+  A    HN               C+A E+        KC   C    + ++GKCE                  C+  + G                 P   C  N   CD+ A C +    C CK GY G+G+TC  +N C+ K   C     C+N           DG   C       KN     ++  CI  +G              C  GCG+NA C N  C C+ G +G+P + C D  +C    + C     +CV     FG G+ C        +C + A   +   I   G  F   G +      +   +S            KD  +           + CTS C  N++C+ G CEC+ G+ G+ +  C +   C
Sbjct:   99 CQSTCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLEHPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGA----HN---------------CDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNL----------DGGYVCC------KNGQ---DDATCIKDQGAF------------CSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCV---NLFG-GFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELT------TSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDEC 553          

HSP 22 Score: 68.9366 bits (167), Expect = 1.111e-10
Identity = 141/564 (25.00%), Postives = 204/564 (36.17%), Query Frame = 3
Query: 2532 ETF-LPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDKTNGYCKCRYGFFGDGFTCNKTCCVE---------KCHEQAQC---VDG-KCLCKPGFSGDGVETCFHCSQC-DSNAICDQNNKACI---------CKSGFEGNGINCLRAIN--CKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTS---------------------CHLNAKCIPRQNT--CECNSGFHGDGIQCKLLPLCTP--ACHPQASCINGN----CKCNNNLIGDGIS--------SCFDCDK----------CSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEE---KCECMERFEGDGFTCQDKVDCS---SRCGENAFCYNGT----CKCKLGFQGNPL-------EHCFDCRVC--HYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGDGTTYCFNCSSCARNSDC---KPEQQTCTCKRGYVKDGNNCSII 3938
            +TF LP      P AN +  +VENT             KC     +C  D+ C++  G C+C  GF G      K  CV+          CHE A+C   V G  C C  GF      +C    +C + N+ C   N  C+         C++GF G+G  C+      C      ++ C      C        VE C  C                       C LNA C+    T  C C  G+ GDG  C  +  C     CHP A C N      C+C++   GDGI         SC D +K           S+       +  C C+PG+        +    SC  +  C+E                    + CD  +   +N E   +CEC E +EG+G  C D  +C    + C   A C N      CKC  G+ G+         E   D   C   +   C++  ++C    E       P   +C P    I G C+ L  + G     C   + C ++++C    P+   C+C  G++ DG  C  +
Sbjct: 1371 DTFALPTTTTGAPQANDS--SVENT-------------KC-TSSDECGLDALCERRTGVCRCEPGFEG---APPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVE-CKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFR------FEKESNSCVDIDECEESR------------------NNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEE-----EVPQCGACLPGHHPINGTCQSL-QISG----LCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDV 1880          

HSP 23 Score: 66.6254 bits (161), Expect = 6.406e-10
Identity = 117/465 (25.16%), Postives = 170/465 (36.56%), Query Frame = 3
Query: 2961 CKQKCHKQARCLLG----KCICNKGLNGNGVEY-----CFNCTSCHLNAKCIPRQNT-----CECNSGFHGDGIQCKLLPLC----TPACHPQASCIN--GNCKCN-------NNLIGDGISSCFDCDKCSMNAR-CD--------VSNQRCI--CQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTG-----------DGVN-----FCF-NCSLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDCSSR----------------------------------------CGENAFCYNGTCKCKLGFQGNPLEHCFDCRVC-HYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCI-KGRCRCLSNLIGDGTTYCFNCSSCARNSDC--KPEQQTCTCKRGYV-KDGNNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFDCKRC 4055
            C+  C  +  CL      +C C+ G +G+  E      C     CH+ A+C   QNT     C C  G+ G+G +C  +  C    T  C   + CIN  G   CN           G G+  C D ++C   A  CD        + + +C+  C PGYE    KC         KL  C +    C N + G           DG N      C  N ++CD++A C I  + C+C   + GDG TC D  +C ++                                        CG+NA C N TC C  GF+G+P + C D   C    + C     +C+     ++F    C       A+C  +      S +   G  +          S         + T  RG + KD    +     C   C  N++C+ G CEC++G  GN    C D   C
Sbjct:   99 CQSTCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLE-HPCHMMAQC---QNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKC-DVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCV-----NLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDEC 553          

HSP 24 Score: 60.077 bits (144), Expect = 5.220e-8
Identity = 110/453 (24.28%), Postives = 155/453 (34.22%), Query Frame = 3
Query: 4089 RCVCQSGYIGNGFTCTKIINCVTKCHVNGFC-ENQECKCLPGLI--------------GDGINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSC---FDC--------------------------------SICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEK---CHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCFDCRPC-HSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCI--PEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLT-CNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRC 5276
             C C  GY GNG  CT I  C  K  +   C E+ +C  LPG                G G++ C D + C+  A     +E C  S+G               C   C    + + GKCE +     + +  C    DC                                +ICD +  C+   + C C  GY GDG TC   ++ C  K   C    +C+N           DG   C  C +   DA C  DQ                      C   CG+NAIC N  C C  G +G+P K C D   C  + +VC     RC+   G    G  C +      +C   A   + + +     ++   G        S   ++         T  +G     +    +  L C   C  N++CV G CEC+ G  GN L  C +   C
Sbjct:  156 ECRCLPGYEGNGHECTDIDECSDK--LTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIG------------SFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINE-CDAKDTPCSDGGRCLNL----------DGGYVC--CKNGQDDATCIKDQ-------------------GAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCVNLFG----GFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSS-----GGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDEC 553          

HSP 25 Score: 59.3066 bits (142), Expect = 1.021e-7
Identity = 127/513 (24.76%), Postives = 181/513 (35.28%), Query Frame = 3
Query: 7863 KNQCFCRPGLIG------DGYNCLDCRKCHEKATC--NIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICN-------RNLVGDGY-QCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGA-----CHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKN-AICTEKQG-------CICKSGFIGDGRQCIVLNE-------CADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSG------DGIQCRIEDQC---------SLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVP----------LTCLSKCHKYANCENGVCKCILGYVGDGII-CRLPDECKSSLDCKYENQECVARLDSSLMC 9215
            K QC+C  G  G      D   CL+   CH  A C   + S +C CLPGY GNG EC  I  C+                           D ++  C       P H K + + G   CN       +   G G  +C    EC   A      E+C     S K + KC  G    + G+C+     G+     C  +A CV +  +                 C   S C KN AIC            C CK+G+ GDG  C  +NE       C+D   C  + G    C ++ +    C   QG            C   C  NA+C    C C+ G  G+   KC + +EC +        G  C + + G         +    DQ          S  +D T   +  I  + +++     S  I+   G +P          L C S C   + C  G C+C+ GY G+ ++ C   DEC + + C  E  E    L    +C
Sbjct:  115 KPQCYCDSGFSGSACELQDKNECLE-HPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECS---------------------------DKLTSRC-------PEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYEL-IDGKCEDVNECGSEKLHKCDVRADCVNT--IGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDG-GYVCCKNGQDDATCIKDQG----------AFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGS--ITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDECITEI-CNIEANEWCVNLIGGFVC 575          

HSP 26 Score: 56.9954 bits (136), Expect = 5.690e-7
Identity = 89/331 (26.89%), Postives = 124/331 (37.46%), Query Frame = 3
Query: 5160 ELKCEPSCGENAKCV----NGKCECLPGLQGNP--LQHCFNCKR--CDKFADCD--VWNKKCVCKNGYMGNGLTCISVNGCNNK----CDSNALCVN----RHCICLPGFT-----GDGTRFCFDCSSCPKNS-NCLPEEQ--------KCI--CQEGYIMNGAKCQPI-------VHEC--RPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKK----CHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLK----------------------------------------CNENALCVNQKCICLPGFIGDGIKFCFDCSACPAN 5891
            E KC+ +C     C+      +C C  G  G+   LQ    C    C   A C   + + +C C  GY GNG  C  ++ C++K    C  ++ C+N     +C C  GFT     G G   C D + C   + NC  +E         KC+  C  GY +   KC+ +       +H+C  R  C         +CE      G   Q    C+K    C + A C +    C CK GY G+G  C  IN C+ K                                        C +NA+C N  C C+ GF GD  K C D + C  N
Sbjct:   96 EHKCQSTCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLEHPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVEN 426          

HSP 27 Score: 53.9138 bits (128), Expect = 4.743e-6
Identity = 95/331 (28.70%), Postives = 122/331 (36.86%), Query Frame = 3
Query: 6255 GFSGDGIKTCFNCSS---------CSIEAICVPDQEKCICKAGFSGNGEQCVENIEG---SSPKCHSNALRVNQQCICLPGFIGDG------KNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGDGIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIES--TCEPPCAPGGFC-NNSKCQCNSGLKGDGVTSCFN-CSKCDVNAKCFPSVK----------------KCICVIGYKGD----GFRCYPVILECP----KCHYRAQC--VIGK--CQCKNGLQGDGIN 7097
            GF GDG   C   S+         C+ +A C      C C AG+ G+G  C  + +        C   A+  N++C CLPGF GDG           +CS C  N+ C+     C C   YF N                      CV D  +C+  F G           C PNA C  E ++C C +GF GNG  C   +S  T +  CA    C     C C  G KGD    C +  SK   N +    V                 +CIC  G++ +    G      I EC     KC   A C    G   C C +G  GDGI 
Sbjct: 2000 GFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGG-TTCKCNPGYFGNG-------------------LCCVPDPLDCVH-FTG----------ICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGIT 2299          

HSP 28 Score: 53.1434 bits (126), Expect = 7.583e-6
Identity = 98/353 (27.76%), Postives = 140/353 (39.66%), Query Frame = 3
Query: 6621 CHHYASCVQD----KCECLPGFIGDGIKFCFKCSSCDPNADCV----PEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAK-------CFPSVK--KCI--CVIGYKGDGFRCYPV----ILECPKCHYRAQCV--IG--KCQCKNGLQGDGIN-----FCM-NCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPK---CHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKRCDQN-AICRPTEQRCV 7568
            CH  A C       +C CLPG+ G+G     +C+  D  +D +    PE  KC+   G Y                     +CN ++     G +G G+  C + ++C+  A        C  S+   KC+  C  GY+    +C  V      +  KC  RA CV  IG  +C+C+ G +GDG N      C  N + CD++A C      C+C+ GY GDG  C  I+EC  K   C     C+N           +G   C    Q DA          C+  QG              C+  C  +A+C   +C C  G  GD    C D   C +N ++C     RCV
Sbjct:  142 CHMMAQCQNTLGSYECRCLPGYEGNG----HECTDIDECSDKLTSRCPEHSKCINLPGTY---------------------YCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNL----------DGGYVCCKNGQDDAT---------CIKDQGAF------------CSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCV 438          

HSP 29 Score: 52.7582 bits (125), Expect = 9.670e-6
Identity = 102/407 (25.06%), Postives = 154/407 (37.84%), Query Frame = 3
Query: 4701 ECSCKSEFVGDGKICTLR---ADICRPTCGENAICVN----GQCQCQSGL-----QGNPLKHCFDCRPCHSFA-------VCD--VENRRCI--CQSGFEGDGRNCKKIKEC-SPKCHR---NAVCINQ----NCVCIPEYIGDGIN-----FCF-NCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIE---------------------------------------LKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRC-DKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICLPG--FTGDGTRFCFDCSSCPKNSN-CLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKC 5681
            EC C   + G+G  CT     +D     C E++ C+N      C C  G      QG+ L  C D   C + A       +C+  + + +C+  C  G+E     C+ + EC S K H+    A C+N      C C   + GDG N      C  N + CDR+A C    + C C  G+TG+G+TC+ I                                          C   CG+NA C N  C C+ G +G+P + C +   C +  + C     +CV     +  G  C        +C   A   +   I   G  FT  G +      S   +S   +   +  I ++  +    +       C   C  N++CV G CEC+ G  GN +  C D  +C
Sbjct:  156 ECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCV----NLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLA-----CTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDEC 553          
BLAST of Neurogenic locus notch-like protein protein 1 vs. Ensembl Celegans
Match: fbn-1 (FiBrilliN homolog [Source:UniProtKB/TrEMBL;Acc:I7LFE6])

HSP 1 Score: 126.331 bits (316), Expect = 5.641e-28
Identity = 268/1083 (24.75%), Postives = 380/1083 (35.09%), Query Frame = 3
Query: 4500 CVCNPGYYGD--GTTCFLFSQLCT--EKCHPNAKCVNRK------CKCNERLVGDG----VNFC--FNCTSCHPDALCF--PDQQECSCKSEFVGDGKICT-LRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCFDCRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPK---CHRNAVCINQN----CVCIPEYIGDGINFCFNCSSCDRNADCEPHNN--------RCTCYQGFTGNGLT--CNAIELKCEPS---CGE-------NAKCVNGK----CECLPGLQ-GNPLQHCFNCKRCDKFAD-CDVWNKKCV---------CKNGYMGNGLTCISVNGCNNK---CDSNALCVNRH----CICLPGFTGDGTRFCFDCSSCPKNSN----------CLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECL--PGLQGNPMQHCFDCKKCHKFADC-DVWNKK--CVCKNGYFGNGYMCTPINGCNLKC---NENALCVNQ----KCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQP----------------------VLCTSKCHKNAKCLKGNCEC--LPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSS-CSIEAICVPDQEKCICKAGFSGNGEQCVENIEG---SSPKCHSNALRVNQQCICLPGFIGDG------KNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGDGIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGF-RCYPVILECPK--------------CHYRAQ-CVIGKCQCKNGLQGD----GINFCMNCSE-------CDKNAQCFPNFSK--CECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGN 7289
            C C PG+ G     +C    +  T    CH +A+C N        C    R   DG    ++ C   N T C  +A C   P    C C++ F+GDG  C       C  T    + C      C+     + +    +C+ C                 G++  G+ C+ I EC  +   C  NA C+N N    C C   Y GDG   C + + CD    C PH          +C C+ GF G+G+    N +E  CE     CG        + +  NG     CEC PG +       C +   C++  + CD  +  CV         C  GY G G  C  ++ C+     CDS A+C+NR     C C+ G+TGDG   C      PK+            C  E+++C   E  +     C P  H            +NG C+ L   GL       C     C+K A+C D+      C C +G+ G+G +C  ++ CN      +EN  C N      C+CL GF     K   D    P       EK E         N     P  +                       ++ T+   K  +    + E    P    +   +C    TC   A C      C+C+  + G+G                                 S      C +  S C+ +A C      C C AG+ G+G  C  + +        C   A+  N++C CLPGF GDG           +CS C  N+ C+     C C   YF N                      CV D  +C+  F G           C PNA C  E ++C C +GF GNG             C P   C   K                  S C  NA C P+   CIC  G+KGD F +C  ++ + P               C    Q C+ G+C CK+G + +    G   C +  E       CD+ A C   F    C C  G+ GDG  CV      P  +Q  + +      + +  GN
Sbjct: 1414 CRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEV----DTVDGSVECKEC---------------MGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGF-MCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGAT-CIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHP-----------INGTCQSLQISGL-------CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNR-----EKIEIDEENSSSSNSGQEKPTTKERTTVSTTVSTTTPTEETTTSESLILTAAPSKPTESTTESSEAPTTPAKTSETTSLCSTV-TCHSLATCEQSTGVCICRDGFIGDGTTAC-----------------------------SKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGG-TTCKCNPGYFGNG-------------------LCCVPDPLDCVH-FTG----------ICHPNAVCNSESRQCQCSSGFSGNGVS-----------CFPQKSCRTDK------------------SVCAKNAICLPT-GSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCV------PHVNQGKLSVYCEADGMTLVLGN 2355          

HSP 2 Score: 120.168 bits (300), Expect = 3.735e-26
Identity = 277/1036 (26.74%), Postives = 365/1036 (35.23%), Query Frame = 3
Query: 4881 AVCDVENRRCICQSGFEGD--GRNCKKIKECSP---KCHRNAVCINQNCVCIPEYIGDGINFC------FNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNG--CNNKCDSNALCVNRHCICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPI---VHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLK--CNENALCVNQ----KCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGDG-IQVCFNCSTCDKNA-NCFPYQE---------RCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICK--AGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPK--CHHYASCVQDK-----CECLPGFIGDGIKFCFKCSSCDPNADCVPEQQK---------CVCKTGFYGNGNKC----------DKIE----------------STCE---------------------------PPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGFRCYPVILECPKCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGDG-------KNCVKIDE-CSPKCHQNAVCINSNCHCLPMYTGNGV------SFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSC---NTNCHKDALCFKDS--CICKSGLSGDGKNYCF-------DCKRCDQNAICRPTEQRCVCKPEFRGDGF 7598
            A+C+     C C+ GFEG    ++C  + EC+     CH +A C N        Y+G    FC       +  SC    +C  HN+ C                       CG NAKCVN      PG                           C C+NG++G+G  C+      C++   S + C   +  C    T DG+  C +C                    GY  +G  C+ I   V E  P C  NA CVN             M   F C                 CK GY G+G+MCT IN C+ +  C+ +A C N     KC C  GF GDGIK C +           P ++ C+        EK C  +   V C S    N   L   CEC PGF  +     C +   C+++  NC P            RC C   Y G G  C  I                     +C +G +G           C   A+C+     C CK  AG++G+G  C++  E   PK    A       +C      + K    D    P    CLP          + +N T C     +  C  K  C+ +A C+        C C  GFIGDG+  C     C+    C  E  K         CVC  GF     KC          +KIE                +T E                            P  P      S     +  K    TS  +   C   A C  S   CIC  G+ GDG                         C      D I+    C++    A+C  +   CEC  GY GDG       ++CV  D  CSP+    AVC N  C CLP +TG+GV          NC+QCDANA C      C C  G+ GNG+ C      C      CH +A+C  +S  C C SG SG+G + CF       D   C +NAIC PT   C+C+  F+GD F
Sbjct: 1405 ALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQN--------YVGGYACFCPTGFRKADDGSCQDIDECTEHNSTC-----------------------CGANAKCVN-----KPGTY------------------------SCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVD-TVDGSVECKECMG------------------GYKKSGKVCEDINECVAEKAP-CSLNANCVN-------------MNGTFSCS----------------CKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDV------EKFCGRVDH-VSCLSVRIYNGS-LSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDI--------------------DECDRGMAG-----------CDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEE--EPKSDKTACTDEWSRLCEL----EKKQCTVDEEEVPQCGACLPGH--------HPINGT-CQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGM-ICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKERTTVSTTVSTTTPTEETTTSESLILTAAPSKPTESTTESSEAPTTPAKTSETTSLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTA----------------------CSKKSTADCISLPSLCAD---KAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPE----AVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGG-TTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLPT-GSCICRHGFKGDPF 2233          

HSP 3 Score: 115.546 bits (288), Expect = 9.270e-25
Identity = 255/1016 (25.10%), Postives = 382/1016 (37.60%), Query Frame = 3
Query: 7506 CFDCKRCDQNAICRPTEQRCVCKPEFRG--------DGFQCALNLKTTCQNDCHPNAVRVNN-----CCRCKNGFFGDGFSFC--------FNCSNCSPNADCF--PHLSKCQCKEEFTGNGFICQRKECKP---------ACSEATSLCIKNQC-------FCRPGLIGDGYNCLDCRKC-HEKATCNIR--------SMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVC--VKG--KCICNRNLVGDGYQ-CRAPEECN-NDAD--CVQFQEV----CRKDQSSLKKICKCKDGLVRDLQG-------QCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDC-------SGCDKNAICTEKQG---CICKSGFIGDGRQCIVLNE--CADNSDCTTIRGR-----ASECIRSSEGIQKC-QCSQGFKLLNGKCEPLSCIYPCA------KNAVCI-----YQKCECLPGLVGNGFIKCTNCSECHKKALCHDQR----------GCVCSHGYSGDGIQCRIEDQCSLNSDCTD------------------------------------------------PNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCE--NGVCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARL---DSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGNG------YSGCFDCSKCHANADCDESKGCTCKPGFEGNGCYCRPE--DKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQ---------CDKNAVCL-SNNCVCKTGYSG-------TGLNCKPNDQ--CSQNSDCPEP-NSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQP---------KCHMFAICI----TQTCYCVPGYFGDGI 9953
            C     C  +A+C      C C+P F G        D  +CA     T  ++CH +A R  N      C C  GF       C         N + C  NA C   P    C+C+  F G+G+ C     KP          CSE+   C  +          C  G    G  C D  +C  EKA C++         +  C C  GY G+GF C  I  C +                                      + PCHP A C  ++G  KC C+    GDG + C  P E +  D +  C +   V     R    SL  +C+C+ G   + +        +C++ + N    + AVCV +     RC C  G+ G+G   CTD        +GCD  A+C  + G   C C +G+ GDG  CI + E   +D + CT    R       +C    E + +C  C  G   +NG C+ L     CA      K+A CI        C C  G +G+G I C +  EC+   +C D+            CVC  G+     +C ++++   N +  +                                                P+K   ++T++ +     +    + S C  +TC    H  A CE   GVC C  G++GDG         KS+ DC      C  +    +S+  C C +G+       S      +++ ++          C+P+    A+C    C+C P F G+G      +    +CS+C ANA C     C C PG+ GNG  C P+  D   F   C+ P  +C      SR C C  G   S NG    + C  Q         C KNA+CL + +C+C+ G+ G       + ++ +P +Q   S  S C  P +S  ++    + +C+C  GF+ ++     + C           KC   A C     +  C C  G+ GDGI
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECA-----TGDHNCHESA-RCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDE--------------------------------------RHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEE-SRNNCDPASAVCVNTEG-SYRCECAEGYEGEGGV-CTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMI-CDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKERTTVSTTVSTTTPTEETTTSESLILTAAPSKPTESTTESSEAPTTPAKTSETTSLCSTVTC----HSLATCEQSTGVCICRDGFIGDGTTACSK---KSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNL----------CSPE----AVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICH-PNAVCNSE---SRQCQCSSGF--SGNG----VSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLC--ISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGI 2329          

HSP 4 Score: 113.235 bits (282), Expect = 4.410e-24
Identity = 249/975 (25.54%), Postives = 364/975 (37.33%), Query Frame = 3
Query: 2235 CFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKSC---------DKICHKDALCQNS----RCICKPNFEGDGVNYCFDCSKCHKL--------AQC--HPKTGNCTCRPPYVGDGVS-------ECE-TFLPKGNCFPPCANHAICTVENTCQCRKNYYG--------NPLEKCNIDCSKCHTDSDCDKTNGY--CKCRYGFFGDGFTCNKTC-CVEK--CHEQAQC--VDG--KCLCKPGFSGDGVETCF------------------HCSQCDSNAICDQNNKACICKSGF--EGNGINCLRAINCKQKCH----KQARCLLG----KCICNKGLNGNG-----VEYC-FNCTSCHLNAKCIPRQNTC--ECNSGFHGDGIQC---------------------------------KLLPLCTPACHPQASCINGNCKCNNNLIGDGISSCFDCDKCSMNARC-DV--SNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNC----SLCDKNAKCLINEEKCECMERFEGDGFTC------QDKVDCSSRCGENAFCYNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPC----------SFSCHPNAKCIK--GRCRCLSNLIGDGTTYCFNCSS---------CARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPE--------CGVNAQCINGKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCV------CQSGYIGNGFTCT-KIINCV---TKCHVNGFC--ENQECKCLPGLIGDGINFCF-------DCSTCDINAFCEPFNERCVCSVGFTGNG-KKCSILAP------------ITCKRACHKKAK-CVKGKCECLPGLRGD----GVQSCFDCS-------ICDNNTVCYPD--QEKCVCNPGYYGDGTTCF 4544
            C    +C  +A C      C C PG+   G    KSC         D  CH+ A CQN      C C   F       C D  +C +         A+C   P T +C C   ++GDG          C+ T   K +C     +  + TV+ + +C++   G          + +C  + + C  +++C   NG   C C+ G+ GDGF C     C E+  CH  A+C  ++G  KC C  GF GDG++ C                   H S           +  C C+ GF  E    +C+    C++  +      A C+      +C C +G  G G     ++ C      C   A CI R  +C  +C +G+ GDG  C                                 + +P C  AC P    ING C+   +L   G+  C   + C+ +A C D+   +  C C  G+ G+G+ C       C+   +C +   KC N +        FNC         + KC+++E+K    E+ E D          Q+K     R   +      T   +     + +                 P++     TE+     TP           + +CH  A C +  G C C    IGDGTT C   S+         CA  + C    ++C C  GY+ DG  CS      HP+        C   A C N +C+CL G  G+  +     +R S  + CD  N  CV      C  GY GNG  C    ++CV     CH N  C  E+++C+C  G  G+G++ CF       D S C  NA C P    C+C  GF G+   KCS L               +C   C    + C+ G+C C  G R +    G ++C D          CD    C        C C  G+ GDG TC 
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGF--EGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCG-ACLPGHHPINGTCQ---SLQISGL--CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDD--VDECNNAGMCDDENTKCENTI------GSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKERTTVSTTVSTTTPTEETTTSESLI-------------LTAAPSKPTESTTESSEAPTTPAKTSETTSLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSP-----HPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCD-ANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLPTG-SCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCV 2332          

HSP 5 Score: 112.079 bits (279), Expect = 1.227e-23
Identity = 261/1049 (24.88%), Postives = 368/1049 (35.08%), Query Frame = 3
Query: 5586 CGENAKCV--NGKCECLPGLQGNP-MQHCFDCKKC-------HKFADCD--VWNKKCVCKNGYF-GNGYMCTPINGCNLK----CNENALCVNQ----KCICLPGFIGDGIKFCFDCSACPANS-----------------NCVPEKKECK-CAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGN----CECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGK-NFCFDCSTCPPN-SDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGDG-----IKFCFK-CSSCDPNADCVPEQQKCVCK--TGFYGNGNKCDKIESTCEPPCAPGG-------FCNNSKCQCNSGLKGDGVTSCFNC--SKCDVNAKCFPSVKKCICVIGYKGDGFRCYPVILECPKCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCE---------CRQGYRGDGKNCVKIDECSPKCHQNAV-----CINSNCHCLPMYTGNGVSFCFNCAQCD------------ANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDS--CICKSGLSGDGKNYC-----FDC----KRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQND--CHPNAVRVNNCCRCKNGFFGDGF------SFCFNCSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRK-CHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISK--------------LCINPNCQPPCHPKA-VCVKGKCIC----NRNLVGDGYQ-CRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRD 8348
            CG +A C    G C C PG +G P  + C D  +C       H+ A C   V    C C  G+   +   C  I+ C       C  NA CVN+     C C  GF+GDG + C   +  P +S                 + V    ECK C   Y  + K+C  I + V   + C  NA C+  N    C C  G+ GDG  +C + + CD+   C P+ E              C  +     C               +C  GF GDGIK C N           P +  C     F G     V+++   S + ++ +L  +  C C PGF  + + N C D   C  + ++C P    C+  +  +                            +CEC  G+ G+G     I  C +  + CD  A C+     C CK   G+ G+G  C KIE   EP              C   K QC   +  + V  C  C      +N  C       +C    K D  +    I   P  H+        C C +G  GDG+  C +  EC+    C    +KCE         C +G++   + CV  ++  P   +  +       +++    P                               A  KP E+    ++  T    T +         CH  A C + +  CIC+ G  GDG   C      DC      C   A C  + + C C   + GDG+ C+ + +     D  C P AV  N  C+C  GF GDG           NCS C  NA C    + C+C   + GNG  C                           + D  +C+     CH  A CN  S +C+C  G+ GNG  C    SC         N IC +    CIC      DP  K              L    +C  PC     +C+ G+CIC     RN    G + C   +EC   +        CR    S   +C C DG V D
Sbjct: 1401 CGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQ-CVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGF-MCTDINECDERHPCHPHAE--------------CTNLEGSFKC---------------ECHSGFEGDGIKKCTN-----------PLERSCEDVEKFCGR----VDHVSCLSVRIYNGSL--SSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSY----------------------------RCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEE--EPKSDKTACTDEWSRLCELEKKQCT--VDEEEVPQCGACLPGHHPINGTCQSLQISGLCA--QKNDCNKHAECIDIHPDSHF--------CSCPDGFIGDGM-ICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKERTTVSTTVSTTTPTEETTTSESLILTAAPSKPTESTTESSEAPTTPAKTSETTSLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTT-CKCNPGYFGNGLCC---------------------------VPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAIC-LPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGS--HVCTCPDGHVGD 2327          

HSP 6 Score: 104.76 bits (260), Expect = 1.628e-21
Identity = 107/334 (32.04%), Postives = 145/334 (43.41%), Query Frame = 3
Query: 2154 IKCHENASC--VNGYCKCNRNLIGDGINSC-----FDCLK----CNTEADCSPYENRCYCRPGYTGNGFTCI---KSC---DKICHKDALCQNSRCICKPNFEGDGV------NYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGV------SECETFLPKGNCFPPCANHAICTVEN-TCQCRKNYYGN-----PLEKCNIDCSKCHTDSDCDKTNGYCKCRYGFFGDGF----------------TCNKTCCVEKCHEQAQ-CVDGKCLCKPGFSGD----GVETCFHCSQC-DSNAICDQ--------NNKACICKSGFEGNGINCLRAIN 2960
            + CH  A+C    G C C    IGDG  +C      DC+     C  +A C      C C  GY G+G+ C    + C   D +C  +A+CQN RC C P F GDGV          +CS+C   A C   T  C C P Y G+G+       +C  F   G C P    +A+C  E+  CQC   + GN     P + C  D S C  ++ C  T G C CR+GF GD F                  + + CV  C    Q C+ G+C+CK GF  +    G ETC    +C + +  CD+         +  C C  G  G+GI C+  +N
Sbjct: 2011 VTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGT-TCKCNPGYFGNGLCCVPDPLDCVHFT--GICHP----NAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPT-GSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVN 2336          

HSP 7 Score: 102.834 bits (255), Expect = 7.550e-21
Identity = 276/1205 (22.90%), Postives = 418/1205 (34.69%), Query Frame = 3
Query: 6267 DGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALR-VNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRT--PQCVPKCHHYASCVQ-DKCECLPGFIGDGIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSC--------FNCSKCDVNAKCF--PSVKKCICVIGYKGDGFRCYPVILE-CPKCHY-RAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPK---CHQNAVCINSN----CHCLPMYTGNGVSFCFNCAQCDANAICKPDE---NL-----CVCAQGFTGNGI---------TCKAIDPSCNTNCHKDALCFK-------DSCICKSGLSGDGK-NYCFDCKRCDQN--------AICRPTE--QRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFG-DGFSFCFN-CSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKP-----ACS-EATSLCI--KNQCF-----------CRPGLIGDGYNCL------------DCRKCHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQ--CICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAICTEKQG-CICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKC--EPLSCIYP---CAKNAVCIYQKCECLPGLVGNGFI------KCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYA--NCENGVCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEK--SSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGN----GYSGCFDCSKCHANA-DCDE---------SKGCTCKPGFEGNGCYCRP 9512
            DG+    + ++  +           + ++G     +   E +E ++P     +      +   LP   G G++      T  P +   PQ +    +K     DT  + T  T  PQ          C   D+C  L          C     C+P  +  P ++ CV       + ++C   +  C        +     C C +G +     SC         N + C  NAKC   P    C C  G+ GDG++C P   + C      ++ C      C    + D ++  + C EC                 GY+  GK C  I+EC  +   C  NA C+N N    C C   Y G+G   C +  +CD    C P     NL     C C  GF G+GI         +C+ ++  C    H   L  +         C C+ G   + + N C D   C+++        A+C  TE   RC C   + G+G  C                    +   C  G  G D  + C N   +C            C+C   +TG+G  C + E +P     AC+ E + LC   K QC            C PG       C             DC K  E    +  S  C C  G+IG+G  C  +  C  +  C   N  C   I    C+C    F     K  ++   QP               NR  +    +  +      +    + +       S+     +        L     KP  +    S+A    +   E+  LC         +T T    C   A C +  G CIC+ GFIGDG         A   DC ++    ++  +     + C+C  G+      C   P  C+     C+  AVC  ++C+CLPG  G+G        + +NCS+C   A C     C C+ GY G+G+ C             DP                          CV  T +  CH  A  N E+  C+C  G+ G+G+ C     C++      +N  C+     +  C C+ GF+       SSLV+ +   ++ +   S CV     P    + LC+ G C C   F+ N    G   C D  +C   +  CD          S  CTC  G  G+G  C P
Sbjct: 1271 DGVSPTSSATAPEVPTTSASSTPDAVEESGIPSTSKPTAEPLETTAPSTEVTSPEGSGTEESTLPPTEGSGESTTSSAPTVEPATVLPPQNRN---EKPEPTKDTFALPTTTTGAPQANDSSVENTKCTSSDEC-GLDALCERRTGVC----RCEPGFEGAPPKKSCV-------DVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSC----EVDTVDGSVECKEC---------------MGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGF-MCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCT-------------------DIDECDRGMAGCDSMAMCINRMGSCG-----------CKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVC-LEGFKKVDEKCVVDEKKQP---------------NREKIEIDEENSSSSNSGQEKPTTKERTTVSTTVSTTTPTEETTTSESLILTAAPSKPTESTTESSEAPTTPAKTSETTSLC---------STVT----CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTA---DCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCC-----------VPDPLD------------------------CVHFTGI--CHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLP----TGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCV----TPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVP 2333          

HSP 8 Score: 95.5153 bits (236), Expect = 9.933e-19
Identity = 261/1074 (24.30%), Postives = 363/1074 (33.80%), Query Frame = 3
Query: 7101 CMNCSECDKNAQCFPNFSKCECRQGYRGD--GKNCVKIDECSP---KCHQNAVCINSNCHCLPMYTGNGVSFC--------------------FNCAQCDANAIC--KPDENLCVCAQGFTGNGITC--------------KAIDPSCNTNCHKDALCFKDSCI-CKSGLSGDGK-----NYCFDCKR-CDQNAICRPTEQ--RCVCKPEFRGDGFQCALNLKTTCQNDCHPNA----VRVNNCCRCKNGFFGDGFSFCFNCSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLI--GDGYNCLDCRKCHEK--------ATC--NIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICNRNLVGDGYQC-RAPEECNNDAD---------CVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSK------AVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAICTEKQ----------GCICKSGFIGDGRQCIVLNECADNSDCTTI---------RGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCEC--LPGLVGNGFIKCTNCSECHKKALCHDQRG-CVCSHGYSGDGIQC----RIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCV--PLTCLSK---CHKYANCENGVCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGNGY---SGCFDCSK----CHANADCD-ESKGCTCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIIL---------------GCPVQCDKNA-VCLSNNCVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKD-----YNRKCVCLPGFQDDNGKCSPKECQPKCHMF 9896
            C +  EC  +A C      C C  G+ G    K+CV +DEC+     CH++A C N        Y G    FC                     N   C ANA C  KP    C C  GF G+G  C              K+     N +C  D +     C  C  G    GK     N C   K  C  NA C        C CK  +RGDGF C    +   ++ CHP+A    +  +  C C +GF GDG   C N           P    C+  E+F G         C        SL   + C C PG     +  +C+D  +C E         A C     S +CEC  GY G G  C  I             + C+  ++ C   A         +CIN            C    C C     GDG  C +  EE  +D           C   ++ C  D+  + +   C  G    + G CQ    +G C  K      A C+        C C  GF+GDGM  C D   C+   +C ++            C+C  GF     +C+V  +   N +   I          G+     +    +     +          E L      +K      +  E    P         C+  + CH  A C    G C+C  G+ GDG          D  SL S C D  K C  ST   + C C + +I     C   P  C+ +   C   A C+N  C+C+ G+ GDG+ C                                                  +    RA S C   D N  C     C     KC P + GNG        DC      CH NA C+ ES+ C C  GF GNG  C P+  C+ +        IC+     + +C+C+ G       KC  L                C   CD +  +C+S  C+CK+G+         ++ C+   +C E + +C+ +        +  C C  G   D   C P   Q K  ++
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQN--------YVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDVEKFCGR---VDHVSCLSVRIYNGSL--SSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDI-------------DECDRGMAGCDSMA---------MCIN--------RMGSC---GCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGH-HPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGM-ICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKERTTVSTTVSTTTPTEETTTSESLILTAAPSKPTESTTESSEAPTTPAKTSETTSLCSTVT-CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAK-CDNST---RSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKC--------------------------------------------------VSIHERA-SNCSQCDANAHCVGGTTC-----KCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLP----TGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFR-RNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVNQGKLSVY 2343          

HSP 9 Score: 92.4337 bits (228), Expect = 9.473e-18
Identity = 105/352 (29.83%), Postives = 148/352 (42.05%), Query Frame = 3
Query: 2448 CHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPP--CANHAIC-TVENTCQCRKNYYGNPL------EKCNIDCSKCHTDSDCDKTNGYCKCRYGFFGDGFTC----NKTCCVEKCHEQAQCVDGK-CLCKPGFSGDGV------ETCFHCSQ-CDSNAICDQNNKACICKSGFEGNGINCLRAINC---KQKCHKQARCL-LGKCICNKGLNGNGVEYCFNCTSCH-LNAKCIPRQNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGNCKCNN----NLIGDGISSCFDCDKCSMNA-RCD--------VSNQRCICQPGYEGNGIKCVKTCFQSCHKLAV 3386
            CH LA C   TG C CR  ++GDG + C           P  CA+ A C     +C+C   Y G+        + C +  + C  ++ C   N  C+C  GF GDG  C     +     +C   A CV G  C C PG+ G+G+        C H +  C  NA+C+  ++ C C SGF GNG++C    +C   K  C K A CL  G CIC  G  G+    C +  S    N + +   ++C                   TP       CI+G C C +    N    G  +C D D+C+  + +CD          +  C C  G+ G+GI CV    Q   KL+V
Sbjct: 2013 CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQ--NRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSC------------------VTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVNQG--KLSV 2342          

HSP 10 Score: 92.4337 bits (228), Expect = 9.962e-18
Identity = 121/420 (28.81%), Postives = 163/420 (38.81%), Query Frame = 3
Query: 4182 ENQECKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEK---CHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQ-CQCQSGLQGNPL---KHCFDCRP----CHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPK---CHRNAVCI-NQNCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNP----------LQHCFN-CKRCDKFADC--DVWNKKCVCKNGYMGNGLTCI 5357
            E+ E    P    +  + C    TC   A CE     C+C  GF G+G             AC KK+      C  LP L       C D + CDN+T        C C+ GY GDG  C    Q C  +   C P A C NR+C+C     GDGV     C S H                           RA  C   C  NA CV G  C+C  G  GN L       DC      CH  AVC+ E+R+C C SGF G+G +C   K C      C +NA+C+   +C+C   + GD     + CSS       EP N +              + +     P       C++G+C C  G + N           +  C     +CD+ A C     +  C C +G++G+G+TC+
Sbjct: 1990 ESSEAPTTPAKTSETTSLCSTV-TCHSLATCEQSTGVCICRDGFIGDGTT-----------ACSKKSTA---DCISLPSL-------CADKAKCDNST------RSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVK----CVSIHE--------------------------RASNCS-QCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPF---YKCSSL---VSKEPANQQ------------DLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCV 2332          

HSP 11 Score: 84.3445 bits (207), Expect = 2.905e-15
Identity = 142/541 (26.25%), Postives = 197/541 (36.41%), Query Frame = 3
Query: 4647 CFNCTSCHPDALCFPDQQECSCKSEFVG--------------------------------------------------DGKICTLRADICRPTCGENAICVNG----QCQCQSGLQGNPLKHCFDC--RPCHSF----AVCDVENRRC------------ICQSGFEGDGRNCKKIKECSPK---CHRNAVCINQN----CVCIPEYIGDGINFCFNCSSCDRNADCEPHNN--------RCTCYQGFTGNGLT--CNAIELKCEPS---CGE-------NAKCVNGK----CECLPGLQ-GNPLQHCFNCKRCDKFA-DCDVWNKKCV---------CKNGYMGNGLTCISVNGCNN---KCDSNALCVNRH----CICLPGFTGDGTRFCFDCSSCPKNSN----------CLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECL--PGLQGNPMQHCFDCKKCHKFADC-DVWNKK--CVCKNGYFGNGYMCTPINGCNLKC---NENALCVNQ----KCICLPGF 5840
            C +   C  DALC      C C+  F G                                                  D   CT     C   CG NA CVN      C+C++G  G+  + C     +PC S     + C   N  C             C  G++  G+ C+ I EC  +   C  NA C+N N    C C   Y GDG   C + + CD    C PH          +C C+ GF G+G+    N +E  CE     CG        + +  NG     CEC PG +       C +   C++   +CD  +  CV         C  GY G G  C  ++ C+     CDS A+C+NR     C C+ G+TGDG   C      PK+            C  E+++C   E  +     C P  H            +NG C+ L   GL       C     C+K A+C D+      C C +G+ G+G +C  ++ CN      +EN  C N      C+CL GF
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTC---CGANAKCVNKPGTYSCECENGFLGDGYQ-CVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGF-MCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGAT-CIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHP-----------INGTCQSLQISGL-------CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGF 1911          

HSP 12 Score: 83.1889 bits (204), Expect = 6.496e-15
Identity = 94/322 (29.19%), Postives = 129/322 (40.06%), Query Frame = 3
Query: 1959 CHIDATCYENN-MCICNSGHQGDGXXXXXXXXXXX----------XAECYPEISKCKCKPGFVGSGYECREE----VNCDIKCHENASCVNGYCKCNRNLIGDGI------NSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKS------CDKICHKDALC--QNSRCICKPNFEGDGVNYCF-------DCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPK-----------GNCFPPCANHAICTVENTCQCRKNYYGNP----------LEKCNIDCSKCHTDSDCDKTNG--YCKCRYGFFGDGFTC 2747
            CH  ATC ++  +CIC  G  GDG    +                 A+C      C+C  G++G GY C       V  D  C   A C N  C+C     GDG+          +C +C+  A C      C C PGY GNG  C+           ICH +A+C  ++ +C C   F G+GV+ CF       D S C K A C P TG+C CR  + GD   +C + + K            +C  PC +     +   C C+  +  N           +++C     KC   + C  T G   C C  G  GDG TC
Sbjct: 2013 CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGG-TTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLP-TGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2331          

HSP 13 Score: 82.0333 bits (201), Expect = 1.303e-14
Identity = 154/584 (26.37%), Postives = 229/584 (39.21%), Query Frame = 3
Query: 3921 NNCSIISARC--HPECGVNAQC--INGKCECLAGLQGNPFQQ-CFDCKRCSQF-ADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCST--CDINAFC--EPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDC--------SICDNNTVCYPDQE---------------KCVCNPGYYGDGTTCFLFSQLCTEK--CHPNAKCVNR----KCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGD-GKICTLRADICRPTCGENAICVNGQCQCQSGLQ-GNPLKHCFD----------CRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECS---PKCHRNAVCINQ----NCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCE------PSCGE---NAKCVNGKCECL--PGLQGNPLQHCFNCKRCDKFADC-DVWNKK--CVCKNGYMGNGLTCISVNGCNNKC---DSNALCVNR----HCICLPGF 5435
            N+ S+ + +C    ECG++A C    G C C  G +G P ++ C D   C+    +C   +E   CQ+ Y+G G+ C              FC     K   G   D I+ C + ++  C  NA C  +P    C C  GF G+G +C       C      K+ C +    C      DG   C +C         +C++   C  ++                 C C  GY GDG  C   ++ C E+  CHP+A+C N     KC+C+    GDG+  C N           P ++ C    +F G    +  L   I   +       ++  C+C+ G +       C D          C P  +  V    + RC C  G+EG+G  C  I EC      C   A+CIN+     C C+  Y GDG   C            EP +++  C   ++     C   + +C       P CG        +NG C+ L   GL       C     C+K A+C D+      C C +G++G+G+ C  V+ CNN     D N  C N     +C+CL GF
Sbjct: 1386 NDSSVENTKCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNC---HESARCQN-YVG-GYAC--------------FCPTGFRKADDGSCQD-IDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTV-DGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINE-CDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDVEKFCGRVDHVSCLSVRIYNGS-------LSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGAT-CIKIEE-------EPKSDKTACTDEWS---RLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGL-------CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGF 1911          

HSP 14 Score: 82.0333 bits (201), Expect = 1.540e-14
Identity = 111/366 (30.33%), Postives = 148/366 (40.44%), Query Frame = 3
Query: 4053 CSQFADCDPWNERCVCQSGYIGNGFT-CTKI-----INCVTKCHVNGFCEN--QECKCLPGLIGDGI-------NFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKC-SILAPITCKRACHKKAKCVKGK-CECLPGLRGDG---VQSCFDC----SICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEK--CHPNAKCV-NRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCFDCRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCH---RNAVCIN----QNCVCIPEYIGDGIN 5048
            C   A C+     C+C+ G+IG+G T C+K      I+  + C     C+N  + C+C  G IGDG        +     + C   A C+  N RC C  GFTG+G KC SI    +    C   A CV G  C+C PG  G+G   V    DC     IC  N VC  +  +C C+ G+ G+G +CF      T+K  C  NA C+    C C     GD    C +  S  P      +QQ+ S  S  V              P      +C++G+C C+SG                         RR    SG E     C  I EC+ K H   R A C N      C C   ++GDGI 
Sbjct: 2013 CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQ--NRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEP-----ANQQDLSDVSSCV-------------TPCDSSTQLCISGECICKSGF------------------------RRNSTLSGSE----TCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGIT 2330          

HSP 15 Score: 79.7221 bits (195), Expect = 7.511e-14
Identity = 130/515 (25.24%), Postives = 189/515 (36.70%), Query Frame = 3
Query: 4764 CRPTCGENAICV----NGQCQCQSGLQGNP--LKHCFDC--RPCHSFAVCD--VENRRCICQSGFEGDGRNCKKIKECSPK----CHRNAVCIN----QNCVCIPEYI-----GDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIEL--------KCEPSCGENAKCVNGKCE------------------CLPGLQG----------------NPLQHCF-NCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNK---CDSNALCVNRHCICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKC-HKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPG--FIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGDGIQVCFNCSTC 6092
            C+ TC     C+      QC C SG  G+   L+   +C   PCH  A C   + +  C C  G+EG+G  C  I ECS K    C  ++ CIN      C C   +      G G++ C + + C+  A    HN               C+A E+        KC   C    + ++GKCE                  C+  + G                 P   C  N   CD+ A C +    C CK GY G+G+TC  +N C+ K   C     C+N           DG   C       KN     ++  CI  +G              C  GCG+NA C N  C C+ G +G+P + C D  +C    + C     +CV     FG G+ C        +C + A   +   I   G  F   G +      +   +S            KD  +           + CTS C  N++C+ G CEC+ G+ G+ +  C +   C
Sbjct:   99 CQSTCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLEHPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGA----HN---------------CDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNL----------DGGYVCC------KNGQ---DDATCIKDQGAF------------CSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCV---NLFG-GFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELT------TSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDEC 553          

HSP 16 Score: 77.0258 bits (188), Expect = 4.367e-13
Identity = 264/1102 (23.96%), Postives = 386/1102 (35.03%), Query Frame = 3
Query: 8472 TTCTDCSGCDKNAICTEKQG-CICKSGFIGD--GRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGF-KLLNGKCEPL-SCIYP----CAKNAVCIYQKCECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRI------EDQCSLNSDCTDPNKICITSTDTVKRCV----CKSSFISSNSGCVPLT-CLSK---CHKYANCENG----VCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVP-IDC-NPKCHRSALCVIGTCKCPPSFKGNGYS-GCFDCSKCH--------ANADCDESKG---CTCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNNCVCKTGYSGTGLNCKPNDQ--CSQNSDCPEPNSR-CEMMKDYNRKCV-----------CLPGFQDDNGKCSPKEC------QPKCHMFAICI-----TQTCYCVPGYFGDG-----IKSCTSCSVCH-KNAQCLPDRG---CVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCLL--------------NPSMKN-------------------------LQCTCKPLHILINNYCLP------KECTS-----KCHKNAKCE--GGMCQCLSGFIGDGINC---QRPFEC-GIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGDGIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLC---SPI-------ACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIE---------------ETCPNKCHNFA-YCRQKVCQCRLGFQGD----GVFNCHDCSVCHPN-------AICSPSLG---CTCPGPHLIGDGRSCKPK-DQCRIDSDCRDSNAVCTLTYDSLKCQCKL 11261
            T CT    C  +A+C  + G C C+ GF G    + C+ ++ECA          R    +    G   C C  GF K  +G C+ +  C       C  NA C+ +     PG                          C C +G+ GDG QC        +   S  S C++ N  C    DTV   V    C   +  S   C  +  C+++   C   ANC N      C C  GY GDG +C   +EC     C + + EC   L+ S  C C SGF+    K    N        +  + G V  + C + + +  +L  +  C+C P F+    S  C D  +C         A+A C  ++G   C C  G+EG G  C   D+C       D + +C+                    G C                   C C  GY+G G  C   ++   S  + C +  SR CE+ K   ++C            CLPG    NG C   +       +  C+  A CI     +  C C  G+ GDG     +  C +  +C  +N +C    G   CVC   F       + +DE  + ++ + PN+  +                P+ K                               KP      +   P       E TS      CH  A CE   G+C C  GFIGDG      +   +C  + + C D+        D     C C  G+      C P P               CV +  L             C   AVC    C+C+PG+ G+G+ C +  +   +    D NA C  G      C+C PG+   N LC    P+        C P    NS+ +   C C  G+S   NG+SC P   C+++      N  C+  G      C+CR GF     ++C                  +C   C +    C    C C+ GF+ +    G   C D   C          A C  + G   CTCP  H +GDG +C P  +Q ++   C        L  ++   + K+
Sbjct: 1393 TKCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYV----GGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNK-----PGTYS-----------------------CECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSC--EVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPC-HPHAECT-NLEGSFKCECHSGFEGDGIKK-CTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSV--CECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINR-----------------MGSC------------------GCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEK---KQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGF-------KKVDEKCVVDEKKQPNREKIEIDEENSSSSNSGQEKPTTKERTTVSTTVSTTTPTEETTTSESLILTAAPSKPTESTTESSEAPTTPAKTSETTSLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKC-----DNSTRSCECDAGYIGDGYVCSPHP-------------QDCVLRDNL-------------CSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGT----TCKCNPGY-FGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQ--CQCSSGFSG--NGVSCFPQKSCRTDKSVCAKNAICLPTG-----SCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGH-VGDGITCVPHVNQGKLSVYCEADGMTLVLGNETADFEGKI 2364          

HSP 17 Score: 72.0182 bits (175), Expect = 1.380e-11
Identity = 106/388 (27.32%), Postives = 155/388 (39.95%), Query Frame = 3
Query: 3366 SCHKLAVCKE--GTCKCSNGLTGDGVNFCFN---------CSLCDKNAKCLINEEKCECMERFEGDGFTC----QDKVDCSSRCGENAFCYNGTCKCKLGFQGNPL------EHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPC-----------SFSCHPNAKC--IKGRCRCLSNLIGDGTTYCF-------NCSSCARNSDCKPEQQTCTCKRGYVKDG-NNCSIISAR-------------CHPECGVNAQ-CINGKCECLAGLQGNPF----QQCFDCKRCSQFA-DCDP--------WNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCSTCDINA--FCEPFNERCVCSVGFT 4316
            +CH LA C++  G C C +G  GDG   C            SLC   AKC  +   CEC   + GDG+ C    QD V   + C   A C N  C+C  GF G+ +      E   +C  C   A+C +    C C      F    C           +  CHPNA C     +C+C S   G+G + CF       + S CA+N+ C P   +C C+ G+  D    CS + ++             C   C  + Q CI+G+C C +G + N      + C D   C++ +  CD          +  C C  G++G+G TC   +N   +  ++ +CE            DG+       T D     F +   E   CS  F+
Sbjct: 2012 TCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHC-VGGTTCKC--NPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLP-TGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVN---QGKLSVYCE-----------ADGMTLVLGNETADFEGKIFVKGQAENPYCSKSFS 2380          

HSP 18 Score: 69.707 bits (169), Expect = 6.618e-11
Identity = 141/564 (25.00%), Postives = 204/564 (36.17%), Query Frame = 3
Query: 2532 ETF-LPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDKTNGYCKCRYGFFGDGFTCNKTCCVE---------KCHEQAQC---VDG-KCLCKPGFSGDGVETCFHCSQC-DSNAICDQNNKACI---------CKSGFEGNGINCLRAIN--CKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTS---------------------CHLNAKCIPRQNT--CECNSGFHGDGIQCKLLPLCTP--ACHPQASCINGN----CKCNNNLIGDGIS--------SCFDCDK----------CSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEE---KCECMERFEGDGFTCQDKVDCS---SRCGENAFCYNGT----CKCKLGFQGNPL-------EHCFDCRVC--HYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGDGTTYCFNCSSCARNSDC---KPEQQTCTCKRGYVKDGNNCSII 3938
            +TF LP      P AN +  +VENT             KC     +C  D+ C++  G C+C  GF G      K  CV+          CHE A+C   V G  C C  GF      +C    +C + N+ C   N  C+         C++GF G+G  C+      C      ++ C      C        VE C  C                       C LNA C+    T  C C  G+ GDG  C  +  C     CHP A C N      C+C++   GDGI         SC D +K           S+       +  C C+PG+        +    SC  +  C+E                    + CD  +   +N E   +CEC E +EG+G  C D  +C    + C   A C N      CKC  G+ G+         E   D   C   +   C++  ++C    E       P   +C P    I G C+ L  + G     C   + C ++++C    P+   C+C  G++ DG  C  +
Sbjct: 1371 DTFALPTTTTGAPQANDS--SVENT-------------KC-TSSDECGLDALCERRTGVCRCEPGFEG---APPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVE-CKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFR------FEKESNSCVDIDECEESR------------------NNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEE-----EVPQCGACLPGHHPINGTCQSL-QISG----LCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDV 1880          

HSP 19 Score: 67.0106 bits (162), Expect = 4.184e-10
Identity = 117/465 (25.16%), Postives = 170/465 (36.56%), Query Frame = 3
Query: 2961 CKQKCHKQARCLLG----KCICNKGLNGNGVEY-----CFNCTSCHLNAKCIPRQNT-----CECNSGFHGDGIQCKLLPLC----TPACHPQASCIN--GNCKCN-------NNLIGDGISSCFDCDKCSMNAR-CD--------VSNQRCI--CQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTG-----------DGVN-----FCF-NCSLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDCSSR----------------------------------------CGENAFCYNGTCKCKLGFQGNPLEHCFDCRVC-HYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCI-KGRCRCLSNLIGDGTTYCFNCSSCARNSDC--KPEQQTCTCKRGYV-KDGNNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFDCKRC 4055
            C+  C  +  CL      +C C+ G +G+  E      C     CH+ A+C   QNT     C C  G+ G+G +C  +  C    T  C   + CIN  G   CN           G G+  C D ++C   A  CD        + + +C+  C PGYE    KC         KL  C +    C N + G           DG N      C  N ++CD++A C I  + C+C   + GDG TC D  +C ++                                        CG+NA C N TC C  GF+G+P + C D   C    + C     +C+     ++F    C       A+C  +      S +   G  +          S         + T  RG + KD    +     C   C  N++C+ G CEC++G  GN    C D   C
Sbjct:   99 CQSTCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLE-HPCHMMAQC---QNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKC-DVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCV-----NLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDEC 553          

HSP 20 Score: 63.929 bits (154), Expect = 4.124e-9
Identity = 138/551 (25.05%), Postives = 199/551 (36.12%), Query Frame = 3
Query: 9159 DCKYENQECVAR----LDS-----SLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALC--VIG--TCKCPPSFKGNGYSGCFDCSKCH--------ANADCDESKG---CTCKPGFEGNGCYCRPEDK------CKFNSDCNDPLKIC-VQSPDTSRNC------VCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNN----CVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCH------------------MFAICITQTCYCVPGY-FGDGIKSCTSCSVCHKN--------AQCLPDRG---CVCKSDFIGDGFNCRPLDEC------------------------------------RINEDCRDPNKMCLLNPS----MKNLQCT-----------CKPLHILINNYCLPKECT------SKCHKNAKC-----EGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKC 10412
            D   EN +C +     LD+     + +C C+ GF+    K S V+              C   D N  CH SA C   +G   C CP  F+      C D  +C         ANA C    G   C C+ GF G+G  C P  K          S C++    C V + D S  C        K G       +C+    P  C  NA C++ N    C CK GY G G  C   ++C +   C  P++ C  ++  + KC C  GF+ D  K      +  C                   ++   ++  C C PG+ F     SC     C ++        A C+   G   C C   + G+G  C  +DEC                                    +I E+ +     C    S    ++  QCT           C P H  IN  C   + +      + C+K+A+C     +   C C  GFIGDG+ C    EC     C D+ + C+ T     F CVC+ GF+ ++ KC
Sbjct: 1387 DSSVENTKCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVD-----------VDECATGDHN--CHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAP--CSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPC-HPHAECTNLEG-SFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENT--IGSFNCVCLEGFKKVDEKC 1918          

HSP 21 Score: 62.7734 bits (151), Expect = 8.695e-9
Identity = 132/514 (25.68%), Postives = 194/514 (37.74%), Query Frame = 3
Query: 3243 SSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIK--CV-----KTCFQSCHKLAVCKE----GTCKCSNGL--TGDG----VNFC--FNCSLCDKNAKCL--INEEKCECMERFEGDGFTC--QDKVDCSSRCGENAFCYNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITEND-IFSRTPCSFSCHPNAKCIKG----RCRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQ--------TCTCKRGYVKDG---------NNCSIISARC----HPECGVNAQCINGK----CECLAGLQ-GNPFQQCFDCKRCSQFA-DCDPWNE---------RCVCQSGYIGNGFTCTKIINC---VTKCHVNGFCENQE----CKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCSVGFTG----NGKKCSILAPITCK-RACHKKAKCVKGKCECL--PGLRGDGVQSCFDCSICDNNTVC---YPDQEKCVCNPGYYGDGTTC 4541
            + C   D+C ++A C+     C C+PG+EG   K  CV      T   +CH+ A C+       C C  G     DG    ++ C   N + C  NAKC+       CEC   F GDG+ C    K  C S     + C      C++    + ++   +C+ C             +C   N+ +  + PCS     NA C+       C C     GDG   C + + C     C P  +         C C  G+  DG          +C  +   C    H  C ++ +  NG     CEC  G +       C D   C +   +CDP +          RC C  GY G G  CT I  C   +  C     C N+     CKC+ G  GDG       +TC I    EP +++  C+  ++       K+C++      +  AC      + G C+ L   GL       C   + C+ +  C   +PD   C C  G+ GDG  C
Sbjct: 1393 TKCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEV----DTVDGSVECKEC----MGGYKKSGKVCEDINECVAEKAPCSL----NANCVNMNGTFSCSCKQGYRGDG-FMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSC-LSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDG-------ATC-IKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGL-------CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMIC 1877          

HSP 22 Score: 60.8474 bits (146), Expect = 3.555e-8
Identity = 110/453 (24.28%), Postives = 155/453 (34.22%), Query Frame = 3
Query: 4089 RCVCQSGYIGNGFTCTKIINCVTKCHVNGFC-ENQECKCLPGLI--------------GDGINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSC---FDC--------------------------------SICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEK---CHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCFDCRPC-HSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCI--PEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLT-CNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRC 5276
             C C  GY GNG  CT I  C  K  +   C E+ +C  LPG                G G++ C D + C+  A     +E C  S+G               C   C    + + GKCE +     + +  C    DC                                +ICD +  C+   + C C  GY GDG TC   ++ C  K   C    +C+N           DG   C  C +   DA C  DQ                      C   CG+NAIC N  C C  G +G+P K C D   C  + +VC     RC+   G    G  C +      +C   A   + + +     ++   G        S   ++         T  +G     +    +  L C   C  N++CV G CEC+ G  GN L  C +   C
Sbjct:  156 ECRCLPGYEGNGHECTDIDECSDK--LTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIG------------SFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINE-CDAKDTPCSDGGRCLNL----------DGGYVC--CKNGQDDATCIKDQ-------------------GAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCVNLFG----GFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSS-----GGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDEC 553          

HSP 23 Score: 59.6918 bits (143), Expect = 7.881e-8
Identity = 127/513 (24.76%), Postives = 181/513 (35.28%), Query Frame = 3
Query: 7863 KNQCFCRPGLIG------DGYNCLDCRKCHEKATC--NIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICN-------RNLVGDGY-QCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGA-----CHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKN-AICTEKQG-------CICKSGFIGDGRQCIVLNE-------CADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSG------DGIQCRIEDQC---------SLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVP----------LTCLSKCHKYANCENGVCKCILGYVGDGII-CRLPDECKSSLDCKYENQECVARLDSSLMC 9215
            K QC+C  G  G      D   CL+   CH  A C   + S +C CLPGY GNG EC  I  C+                           D ++  C       P H K + + G   CN       +   G G  +C    EC   A      E+C     S K + KC  G    + G+C+     G+     C  +A CV +  +                 C   S C KN AIC            C CK+G+ GDG  C  +NE       C+D   C  + G    C ++ +    C   QG            C   C  NA+C    C C+ G  G+   KC + +EC +        G  C + + G         +    DQ          S  +D T   +  I  + +++     S  I+   G +P          L C S C   + C  G C+C+ GY G+ ++ C   DEC + + C  E  E    L    +C
Sbjct:  115 KPQCYCDSGFSGSACELQDKNECLE-HPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECS---------------------------DKLTSRC-------PEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYEL-IDGKCEDVNECGSEKLHKCDVRADCVNT--IGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDG-GYVCCKNGQDDATCIKDQG----------AFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGS--ITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDECITEI-CNIEANEWCVNLIGGFVC 575          

HSP 24 Score: 59.6918 bits (143), Expect = 8.427e-8
Identity = 90/307 (29.32%), Postives = 130/307 (42.35%), Query Frame = 3
Query: 10722 SLCSPIACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVF-QCIEETCPN--KCHNFAYC-RQKVCQCRLGFQGDGV------FNC-HDCSVCHPNAIC-SPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFN----NSLCYPIP-----------CVKQCDRNEE-CLFGQCQCKPGFIHNS----NKTCVEPNDCDV-----NNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIP 11531
            SL S  A + KC  +++     C C  GY    +G  CSP  H Q   DC   ++ C    + Q +RC C  GF    V    I E   N  +C   A+C     C+C  G+ G+G+       +C H   +CHPNA+C S S  C C      G+G SC P+  CR D      NA+C  T     C C+ G+        +SL    P           CV  CD + + C+ G+C CK GF  NS    ++TC + ++C       +  A+C++             +C C  G +     C+P
Sbjct: 2050 SLPSLCADKAKCDNSTRS----CECDAGYIG--DGYVCSP--HPQ---DCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSS-GFSGNGVSCFPQKSCRTDKSVCAKNAICLPTG---SCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTF--------GSHVCTCPDGHVGDGITCVP 2333          

HSP 25 Score: 57.3806 bits (137), Expect = 3.939e-7
Identity = 89/331 (26.89%), Postives = 124/331 (37.46%), Query Frame = 3
Query: 5160 ELKCEPSCGENAKCV----NGKCECLPGLQGNP--LQHCFNCKR--CDKFADCD--VWNKKCVCKNGYMGNGLTCISVNGCNNK----CDSNALCVN----RHCICLPGFT-----GDGTRFCFDCSSCPKNS-NCLPEEQ--------KCI--CQEGYIMNGAKCQPI-------VHEC--RPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKK----CHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLK----------------------------------------CNENALCVNQKCICLPGFIGDGIKFCFDCSACPAN 5891
            E KC+ +C     C+      +C C  G  G+   LQ    C    C   A C   + + +C C  GY GNG  C  ++ C++K    C  ++ C+N     +C C  GFT     G G   C D + C   + NC  +E         KC+  C  GY +   KC+ +       +H+C  R  C         +CE      G   Q    C+K    C + A C +    C CK GY G+G  C  IN C+ K                                        C +NA+C N  C C+ GF GD  K C D + C  N
Sbjct:   96 EHKCQSTCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLEHPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVEN 426          

HSP 26 Score: 56.9954 bits (136), Expect = 4.981e-7
Identity = 79/272 (29.04%), Postives = 105/272 (38.60%), Query Frame = 3
Query: 11550 CHKNAYC--NIGVCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKS----NPYSCKCPSGYEIDNNKCIA--KKCLLP---CDPNAVCVLGECICKVGFTGNGLQCMPTSKCNPLSGCS--DTNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVC---EPSCHPKAACIIGSCICMKPLIGNGITECKLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVD-CPTRKICV-NSKCICPEQYTSSP 12311
            CH  A C  + GVC C   +IGDG T+C KK+     +DC  + S C  K+    +  SC+C +GY  D   C    + C+L    C P AVC    C C  GFTG+G++C+  S     S CS  D N+ C+         C C PGY  +    +  P+ C      CHP A C                                       NS   Q  C C  GF      C  ++ CR +   C    IC+    CIC   +   P
Sbjct: 2013 CHSLATCEQSTGVCICRDGFIGDGTTACSKKST----ADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCV--SIHERASNCSQCDANAHCV-----GGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVC---------------------------------------NSESRQ--CQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDP 2232          

HSP 27 Score: 56.6102 bits (135), Expect = 7.143e-7
Identity = 139/544 (25.55%), Postives = 208/544 (38.24%), Query Frame = 3
Query: 2064 AECYPEISKCKCKPGFVGSG-----YECREEVNCDIKCHENASC---VNGY-CKCNRNLIGDGINSCFDCLKCNTEADCS-----------PYENRCYCRPGYTGNGFTCI----KSCDKICHKDALCQNSRCICKPNFEGDGVNYCFDCSKCHK------------LAQCHP-----------KTGNCTCRPPYVGDG-----VSECETFLPKGNCFPPCANHAICT-VENT--CQCRKNYYGNPLEKCNIDCSKCHTDSD--CDKTN---------------GYCKCRYGFFGDGFTCNKTCCV--EKCHE--------QAQCVDG----KCLCKPGFSGDG-----VETCFH-CSQCDSNAICDQNNKACICK--SGFEGNGINCLRAINCKQKCHKQA-------RCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGN-----CKCNNNLIGDGISSCFDCDKCSMNARCDVSNQR---------CICQPGYEGNGIKCV 3350
            A C      C+C+PGF G+       +  E    D  CHE+A C   V GY C C          SC D  +C TE + +           P    C C  G+ G+G+ C+    K CD      + C  S   C+ +   DG   C +C   +K            +A+  P            T +C+C+  Y GDG     ++EC+          PC  HA CT +E +  C+C   + G+ ++KC     +   D +  C + +                 C+C  GF    F      CV  ++C E         A CV+     +C C  G+ G+G     ++ C    + CDS A+C     +C CK  +G+ G+G  C++ I  + K  K A        C L K  C   ++   V  C  C   H      P   TC+         +Q   L      C+  A CI+ +     C C +  IGDG+  C D D+C+    CD  N +         C+C  G++    KCV
Sbjct: 1405 ALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDEC-TEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTV-DGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERH-------PCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFR---FEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIK-IEEEPKSDKTACTDEWSRLCELEKKQCT--VDEEEVPQCGACLPGHH-----PINGTCQS--------LQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGM-ICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCV 1919          

HSP 28 Score: 53.5286 bits (127), Expect = 5.034e-6
Identity = 98/353 (27.76%), Postives = 140/353 (39.66%), Query Frame = 3
Query: 6621 CHHYASCVQD----KCECLPGFIGDGIKFCFKCSSCDPNADCV----PEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAK-------CFPSVK--KCI--CVIGYKGDGFRCYPV----ILECPKCHYRAQCV--IG--KCQCKNGLQGDGIN-----FCM-NCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPK---CHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKRCDQN-AICRPTEQRCV 7568
            CH  A C       +C CLPG+ G+G     +C+  D  +D +    PE  KC+   G Y                     +CN ++     G +G G+  C + ++C+  A        C  S+   KC+  C  GY+    +C  V      +  KC  RA CV  IG  +C+C+ G +GDG N      C  N + CD++A C      C+C+ GY GDG  C  I+EC  K   C     C+N           +G   C    Q DA          C+  QG              C+  C  +A+C   +C C  G  GD    C D   C +N ++C     RCV
Sbjct:  142 CHMMAQCQNTLGSYECRCLPGYEGNG----HECTDIDECSDKLTSRCPEHSKCINLPGTY---------------------YCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNL----------DGGYVCCKNGQDDAT---------CIKDQGAF------------CSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCV 438          

HSP 29 Score: 53.5286 bits (127), Expect = 5.383e-6
Identity = 118/438 (26.94%), Postives = 153/438 (34.93%), Query Frame = 3
Query: 10992 CHNFAYCRQK--VCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIP--CVKQ---CDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPINCYQPCHKNAYCNIGV-CTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCDPNAVC--VLGECICKVGFTGNGLQCMPTSKCNPLSGCSDTNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVC-EPSCHPKAA---------------CIIGSCICMKPLIGN----GITECKLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCI 12215
            CH+ A C Q   VC CR GF GDG   C   S    + I  PSL               C  K +C  D+  R              C+C  GYI  +  +C P P  CV +   C     C   +CQC PGF  +  K CV      ++  AS                                  NC Q C  NA+C  G  C CNP Y G+G+        C+ D               P  C   +G                C PNAVC     +C C  GF+GNG+ C P   C         N++C+   PT    C+C+ G+ K      C  +V  EP+     +               CI G CIC      N    G   C   DEC+   H  ++ A C+N T G   C C  G   +   C+
Sbjct: 2013 CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTA--DCISLPSL---------------CADKAKC--DNSTR-------------SCECDAGYIG-DGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVK-CVS-----IHERAS----------------------------------NCSQ-CDANAHCVGGTTCKCNPGYFGNGL-------CCVPD---------------PLDCVHFTGI---------------CHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICL---PTG--SCICRHGF-KGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRN-TFGSHVCTCPDGHVGDGITCV 2332          

HSP 30 Score: 53.1434 bits (126), Expect = 6.807e-6
Identity = 102/407 (25.06%), Postives = 154/407 (37.84%), Query Frame = 3
Query: 4701 ECSCKSEFVGDGKICTLR---ADICRPTCGENAICVN----GQCQCQSGL-----QGNPLKHCFDCRPCHSFA-------VCD--VENRRCI--CQSGFEGDGRNCKKIKEC-SPKCHR---NAVCINQ----NCVCIPEYIGDGIN-----FCF-NCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIE---------------------------------------LKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRC-DKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICLPG--FTGDGTRFCFDCSSCPKNSN-CLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKC 5681
            EC C   + G+G  CT     +D     C E++ C+N      C C  G      QG+ L  C D   C + A       +C+  + + +C+  C  G+E     C+ + EC S K H+    A C+N      C C   + GDG N      C  N + CDR+A C    + C C  G+TG+G+TC+ I                                          C   CG+NA C N  C C+ G +G+P + C +   C +  + C     +CV     +  G  C        +C   A   +   I   G  FT  G +      S   +S   +   +  I ++  +    +       C   C  N++CV G CEC+ G  GN +  C D  +C
Sbjct:  156 ECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCV----NLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLA-----CTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDEC 553          

HSP 31 Score: 53.1434 bits (126), Expect = 7.850e-6
Identity = 116/461 (25.16%), Postives = 169/461 (36.66%), Query Frame = 3
Query: 9054 CHKYANCENGV----CKCILGYVGDGIICRLPDECKSSLDCK-YENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSF-------KGNGYSGCFDCSKCHANADCDESKG---CTCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVC--LSNNCVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDNG--KCSPKECQPKCHMFAICITQTCYCVPGYFGDGIKSCTSCSVCHKNAQCLPDRGCVCKSDFIG---------------DGFNCRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKE----------CTSKCHKNAKCEGGMCQCLSGFIGDG-INCQRPFEC 10301
            CH  A C+N +    C+C+ GY G+G  C   DEC   L  +  E+ +C+  L  +  C C  GF  K  + S ++    I         C   D +  C  S        KC P +       +     G     KC   ADC  + G   C C+ GFEG+G  C+P+  C+ NS                                         CD++A C  + + C CKTGY+G G+ C   ++C           RC    + +   VC    QDD    K     C   C   AIC   TC C+ G+ GD  K C   + C +N       G  C + F G                 F+           D     +  +      ++Q T     I +    +PK+          CTS C  N++C GG C+C+SG+ G+  + C+   EC
Sbjct:  142 CHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCI-NLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNC---DADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNS---------------------------------------AICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRC---LNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSG--SIQ-TSSGGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDEC 553          
BLAST of Neurogenic locus notch-like protein protein 1 vs. Ensembl Celegans
Match: fbn-1 (FiBrilliN homolog [Source:UniProtKB/TrEMBL;Acc:I7LFE6])

HSP 1 Score: 104.76 bits (260), Expect = 1.694e-21
Identity = 107/334 (32.04%), Postives = 145/334 (43.41%), Query Frame = 3
Query: 2154 IKCHENASC--VNGYCKCNRNLIGDGINSC-----FDCLK----CNTEADCSPYENRCYCRPGYTGNGFTCI---KSC---DKICHKDALCQNSRCICKPNFEGDGV------NYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGV------SECETFLPKGNCFPPCANHAICTVEN-TCQCRKNYYGN-----PLEKCNIDCSKCHTDSDCDKTNGYCKCRYGFFGDGF----------------TCNKTCCVEKCHEQAQ-CVDGKCLCKPGFSGD----GVETCFHCSQC-DSNAICDQ--------NNKACICKSGFEGNGINCLRAIN 2960
            + CH  A+C    G C C    IGDG  +C      DC+     C  +A C      C C  GY G+G+ C    + C   D +C  +A+CQN RC C P F GDGV          +CS+C   A C   T  C C P Y G+G+       +C  F   G C P    +A+C  E+  CQC   + GN     P + C  D S C  ++ C  T G C CR+GF GD F                  + + CV  C    Q C+ G+C+CK GF  +    G ETC    +C + +  CD+         +  C C  G  G+GI C+  +N
Sbjct: 2091 VTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGT-TCKCNPGYFGNGLCCVPDPLDCVHFT--GICHP----NAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPT-GSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVN 2416          

HSP 2 Score: 92.4337 bits (228), Expect = 1.080e-17
Identity = 105/352 (29.83%), Postives = 144/352 (40.91%), Query Frame = 3
Query: 4869 CHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKC---EPSCGENAKCVNGKCECLPGLQGNPL------QHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGL-------TCISVNGCNNKCDSNALC--VNRHCICLPGFTGDGTRFCF-------DCSSCPKNSNCLPEEQKCICQEGYIMNG-AKCQPIVHE-------------CRPGCGENAK-CVNGKCECLPGLQGNPM----QHCFD-------CKKCHKFADC--DVWNKKCVCKNGYFGNGYMCTP 5765
            CHS A C+     CIC+ GF GDG        CS K          +C+ +P             S C   A C+     C C  G+ G+G  C+     C   +  C   A C N +C+CLPG  G+ +      +   NC +CD  A C V    C C  GY GNGL        C+   G    C  NA+C   +R C C  GF+G+G   CF       D S C KN+ CLP    CIC+ G+  +   KC  +V +             C   C  + + C++G+C C  G + N      + C D         KC + A C     +  C C +G+ G+G  C P
Sbjct: 2093 CHSLATCEQSTGVCICRDGFIGDGTTA-----CSKKS-------TADCISLP-------------SLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHC-VGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGI---CHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLPT-GSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVP 2413          

HSP 3 Score: 92.0485 bits (227), Expect = 1.245e-17
Identity = 105/352 (29.83%), Postives = 148/352 (42.05%), Query Frame = 3
Query: 2448 CHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPP--CANHAIC-TVENTCQCRKNYYGNPL------EKCNIDCSKCHTDSDCDKTNGYCKCRYGFFGDGFTC----NKTCCVEKCHEQAQCVDGK-CLCKPGFSGDGV------ETCFHCSQ-CDSNAICDQNNKACICKSGFEGNGINCLRAINC---KQKCHKQARCL-LGKCICNKGLNGNGVEYCFNCTSCH-LNAKCIPRQNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGNCKCNN----NLIGDGISSCFDCDKCSMNA-RCD--------VSNQRCICQPGYEGNGIKCVKTCFQSCHKLAV 3386
            CH LA C   TG C CR  ++GDG + C           P  CA+ A C     +C+C   Y G+        + C +  + C  ++ C   N  C+C  GF GDG  C     +     +C   A CV G  C C PG+ G+G+        C H +  C  NA+C+  ++ C C SGF GNG++C    +C   K  C K A CL  G CIC  G  G+    C +  S    N + +   ++C                   TP       CI+G C C +    N    G  +C D D+C+  + +CD          +  C C  G+ G+GI CV    Q   KL+V
Sbjct: 2093 CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQ--NRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSC------------------VTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVNQG--KLSV 2422          

HSP 4 Score: 89.7373 bits (221), Expect = 5.822e-17
Identity = 117/397 (29.47%), Postives = 156/397 (39.29%), Query Frame = 3
Query: 4251 TCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEK---CHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQ-CQCQSGLQGNPL---KHCFDCRP----CHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPK---CHRNAVCI-NQNCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNP----------LQHCFN-CKRCDKFADC--DVWNKKCVCKNGYMGNGLTCI 5357
            TC   A CE     C+C  GF G+G             AC KK+      C  LP L       C D + CDN+T        C C+ GY GDG  C    Q C  +   C P A C NR+C+C     GDGV     C S H                           RA  C   C  NA CV G  C+C  G  GN L       DC      CH  AVC+ E+R+C C SGF G+G +C   K C      C +NA+C+   +C+C   + GD     + CSS       EP N +              + +     P       C++G+C C  G + N           +  C     +CD+ A C     +  C C +G++G+G+TC+
Sbjct: 2092 TCHSLATCEQSTGVCICRDGFIGDGTT-----------ACSKKSTA---DCISLPSL-------CADKAKCDNST------RSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVK----CVSIHE--------------------------RASNCS-QCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPF---YKCSSL---VSKEPANQQ------------DLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCV 2412          

HSP 5 Score: 85.1149 bits (209), Expect = 1.492e-15
Identity = 109/373 (29.22%), Postives = 141/373 (37.80%), Query Frame = 3
Query: 5067 SCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCI-SVNGC---NNKCDSNALCVNRHCICLPGFTGDGTR------FCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLK---CNENALCV-NQKCICLPGFIGDGIKFCFD-CSACPAN-------SNCVPE---------KKECKCAKDYFMNEKI-----CSPIKQPVLCTSKCHKNAKCL----KGNCECLPGFVGDGI 6065
            +C   A CE     C C  GF G+G T          +C   +K     C  LP L             C   A CD   + C C  GY+G+G  C      C   +N C   A+C NR C CLPGFTGDG +         +CS C  N++C+     C C  GY  NG  C P                            +P+        CH  A C+  +++C C +G+ GNG  C P   C      C +NA+C+    CIC  GF GD    C    S  PAN       S+CV             EC C   +  N  +     C+ I +    + KC + A C        C C  G VGDGI
Sbjct: 2092 TCHSLATCEQSTGVCICRDGFIGDGTT----------AC---SKKSTADCISLPSL-------------CADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVG-GTTCKCNPGYFGNGLCCVP----------------------------DPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGI 2409          

HSP 6 Score: 83.5741 bits (205), Expect = 4.220e-15
Identity = 142/541 (26.25%), Postives = 197/541 (36.41%), Query Frame = 3
Query: 4647 CFNCTSCHPDALCFPDQQECSCKSEFVG--------------------------------------------------DGKICTLRADICRPTCGENAICVNG----QCQCQSGLQGNPLKHCFDC--RPCHSF----AVCDVENRRC------------ICQSGFEGDGRNCKKIKECSPK---CHRNAVCINQN----CVCIPEYIGDGINFCFNCSSCDRNADCEPHNN--------RCTCYQGFTGNGLT--CNAIELKCEPS---CGE-------NAKCVNGK----CECLPGLQ-GNPLQHCFNCKRCDKFA-DCDVWNKKCV---------CKNGYMGNGLTCISVNGCNN---KCDSNALCVNRH----CICLPGFTGDGTRFCFDCSSCPKNSN----------CLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECL--PGLQGNPMQHCFDCKKCHKFADC-DVWNKK--CVCKNGYFGNGYMCTPINGCNLKC---NENALCVNQ----KCICLPGF 5840
            C +   C  DALC      C C+  F G                                                  D   CT     C   CG NA CVN      C+C++G  G+  + C     +PC S     + C   N  C             C  G++  G+ C+ I EC  +   C  NA C+N N    C C   Y GDG   C + + CD    C PH          +C C+ GF G+G+    N +E  CE     CG        + +  NG     CEC PG +       C +   C++   +CD  +  CV         C  GY G G  C  ++ C+     CDS A+C+NR     C C+ G+TGDG   C      PK+            C  E+++C   E  +     C P  H            +NG C+ L   GL       C     C+K A+C D+      C C +G+ G+G +C  ++ CN      +EN  C N      C+CL GF
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTC---CGANAKCVNKPGTYSCECENGFLGDGYQ-CVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGF-MCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGAT-CIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHP-----------INGTCQSLQISGL-------CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGF 1911          

HSP 7 Score: 82.8037 bits (203), Expect = 7.716e-15
Identity = 103/331 (31.12%), Postives = 137/331 (41.39%), Query Frame = 3
Query: 3747 SFSCHPNAKCIK--GRCRCLSNLIGDGTTYCFNCSS---------CARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPE--------CGVNAQCINGKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCV------CQSGYIGNGFTCT-KIINCV---TKCHVNGFC--ENQECKCLPGLIGDGINFCF-------DCSTCDINAFCEPFNERCVCSVGFTGNG-KKCSILAP------------ITCKRACHKKAK-CVKGKCECLPGLRGD----GVQSCFDCS-------ICDNNTVCYPD--QEKCVCNPGYYGDGTTCF 4544
            + +CH  A C +  G C C    IGDGTT C   S+         CA  + C    ++C C  GY+ DG  CS      HP+        C   A C N +C+CL G  G+  +     +R S  + CD  N  CV      C  GY GNG  C    ++CV     CH N  C  E+++C+C  G  G+G++ CF       D S C  NA C P    C+C  GF G+   KCS L               +C   C    + C+ G+C C  G R +    G ++C D          CD    C        C C  G+ GDG TC 
Sbjct: 2090 TVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSP-----HPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCD-ANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLPTG-SCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCV 2412          

HSP 8 Score: 82.8037 bits (203), Expect = 8.676e-15
Identity = 94/322 (29.19%), Postives = 129/322 (40.06%), Query Frame = 3
Query: 1959 CHIDATCYENN-MCICNSGHQGDGXXXXXXXXXXX----------XAECYPEISKCKCKPGFVGSGYECREE----VNCDIKCHENASCVNGYCKCNRNLIGDGI------NSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKS------CDKICHKDALC--QNSRCICKPNFEGDGVNYCF-------DCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPK-----------GNCFPPCANHAICTVENTCQCRKNYYGNP----------LEKCNIDCSKCHTDSDCDKTNG--YCKCRYGFFGDGFTC 2747
            CH  ATC ++  +CIC  G  GDG    +                 A+C      C+C  G++G GY C       V  D  C   A C N  C+C     GDG+          +C +C+  A C      C C PGY GNG  C+           ICH +A+C  ++ +C C   F G+GV+ CF       D S C K A C P TG+C CR  + GD   +C + + K            +C  PC +     +   C C+  +  N           +++C     KC   + C  T G   C C  G  GDG TC
Sbjct: 2093 CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGG-TTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLP-TGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2411          

HSP 9 Score: 82.4185 bits (202), Expect = 9.124e-15
Identity = 144/525 (27.43%), Postives = 202/525 (38.48%), Query Frame = 3
Query: 4881 AVCDVENRRCICQSGFEGD--GRNCKKIKECSP---KCHRNAVCINQNCVCIPEYIGDGINFC------FNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNG----KCECLPGLQGNPLQHCFNCKR-CDKF----ADCDVWNKKC------------VCKNGYMGNGLTCISVNGC---NNKCDSNALCVNRH----CICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQ--------KCICQEGYIMNGAK--CQPIVHECRPG---CGE-------NAKCVNGK----CECLPGLQ-GNPMQHCFDCKKCHKFA-DCDVWNKKCV---------CKNGYFGNGYMCTPINGCN---LKCNENALCVNQK----CICLPGFIGDG---IKF----CFDCSACPANSN--CVPEKKECKCAKDYFMNEKICSPIKQPV-----------LCTSK--CHKNAKCLKGN-----CECLPGFVGDGIQVCFNCSTCDKNANCFPYQERC 6131
            A+C+     C C+ GFEG    ++C  + EC+     CH +A C N        Y+G    FC       +  SC    +C  HN+ C                       CG NAKCVN      CEC  G  G+  Q     K+ CD      + C   N  C             C  GY  +G  C  +N C      C  NA CVN +    C C  G+ GDG   C D + C +   C P  +        KC C  G+  +G K    P+   C      CG        + +  NG     CEC PG +       C D  +C +   +CD  +  CV         C  GY G G +CT I+ C+     C+  A+C+N+     C C+ G+ GDG   IK       D +AC    +  C  EKK+C   ++       C P   P+           LC  K  C+K+A+C+  +     C C  GF+GDG+ +C +   C+    C     +C
Sbjct: 1405 ALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQN--------YVGGYACFCPTGFRKADDGSCQDIDECTEHNSTC-----------------------CGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDG-FMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGM-ICDDVDECNNAGMCDDENTKC 1896          

HSP 10 Score: 82.4185 bits (202), Expect = 1.052e-14
Identity = 101/348 (29.02%), Postives = 149/348 (42.82%), Query Frame = 3
Query: 4662 SCHPDALCFPDQQECSCKSEFVGDGKI-CTLRAD---ICRPT-CGENAICVNG--QCQCQSGLQGNPL---KHCFDC----RPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHR---NAVCIN-QNCVCIPEYIGDGI-------NFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIEL-KCEPS-CGENAKCV-NGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNA-LCVNRHCICLPGF----TGDGTRFCFDCSSCPKNSNCLPE---------EQKCICQEGYIMNGAKCQPIVHECR 5579
            +CH  A C      C C+  F+GDG   C+ ++    I  P+ C + A C N    C+C +G  G+      H  DC      C   AVC  +NRRC C  GF GDG  C  I E +  C +   NA C+    C C P Y G+G+       +       C  NA C   + +C C  GF+GNG++C   +  + + S C +NA C+  G C C  G +G+P   C +    +     D+ +                  V+ C   CDS+  LC++  CIC  GF    T  G+  C D   C + S+                C C +G++ +G  C P V++ +
Sbjct: 2092 TCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVC--QNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSD------------------VSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVNQGK 2419          

HSP 11 Score: 82.4185 bits (202), Expect = 1.154e-14
Identity = 100/330 (30.30%), Postives = 139/330 (42.12%), Query Frame = 3
Query: 8385 ACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCD---KNAICTEK-------QGCICKSGFIGDGRQCI------VLNE--------------------CADNSDCTTIRGRASECIRSSE-----GIQKCQCSQGFKLLNGKC---EPLSCIY---PCAKNAVCIYQ--KCECLPGLVGNGFIKC-------TNCSECHKKALCHDQRGCVCSHGYSGDGI-------------QCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSF-----ISSNSGCVPL-TCLSKCHK---YANCENG----VCKCILGYVGDGIIC 9128
             CHS A C +S+ +   C+C  GF+GDG T C+  S  D     ++C +K       + C C +G+IGDG  C       VL +                      D   C +I  RAS C +        G   C+C+ G+   NG C   +PL C++    C  NAVC  +  +C+C  G  GNG + C       T+ S C K A+C     C+C HG+ GD               Q  + D  S  + C    ++CI+       C+CKS F     +S +  C  +  C  K HK    A C N     VC C  G+VGDGI C
Sbjct: 2092 TCHSLATCEQSTGV---CICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGY-FGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNG-VSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISG-----ECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2411          

HSP 12 Score: 81.6481 bits (200), Expect = 1.940e-14
Identity = 154/584 (26.37%), Postives = 229/584 (39.21%), Query Frame = 3
Query: 3921 NNCSIISARC--HPECGVNAQC--INGKCECLAGLQGNPFQQ-CFDCKRCSQF-ADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCST--CDINAFC--EPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDC--------SICDNNTVCYPDQE---------------KCVCNPGYYGDGTTCFLFSQLCTEK--CHPNAKCVNR----KCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGD-GKICTLRADICRPTCGENAICVNGQCQCQSGLQ-GNPLKHCFD----------CRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECS---PKCHRNAVCINQ----NCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCE------PSCGE---NAKCVNGKCECL--PGLQGNPLQHCFNCKRCDKFADC-DVWNKK--CVCKNGYMGNGLTCISVNGCNNKC---DSNALCVNR----HCICLPGF 5435
            N+ S+ + +C    ECG++A C    G C C  G +G P ++ C D   C+    +C   +E   CQ+ Y+G G+ C              FC     K   G   D I+ C + ++  C  NA C  +P    C C  GF G+G +C       C      K+ C +    C      DG   C +C         +C++   C  ++                 C C  GY GDG  C   ++ C E+  CHP+A+C N     KC+C+    GDG+  C N           P ++ C    +F G    +  L   I   +       ++  C+C+ G +       C D          C P  +  V    + RC C  G+EG+G  C  I EC      C   A+CIN+     C C+  Y GDG   C            EP +++  C   ++     C   + +C       P CG        +NG C+ L   GL       C     C+K A+C D+      C C +G++G+G+ C  V+ CNN     D N  C N     +C+CL GF
Sbjct: 1386 NDSSVENTKCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNC---HESARCQN-YVG-GYAC--------------FCPTGFRKADDGSCQD-IDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTV-DGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINE-CDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDVEKFCGRVDHVSCLSVRIYNGS-------LSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGAT-CIKIEE-------EPKSDKTACTDEWS---RLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGL-------CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGF 1911          

HSP 13 Score: 81.6481 bits (200), Expect = 1.940e-14
Identity = 113/366 (30.87%), Postives = 149/366 (40.71%), Query Frame = 3
Query: 4053 CSQFADCDPWNERCVCQSGYIGNGFT-CTKI-----INCVTKCHVNGFCEN--QECKCLPGLIGDGI---NFCFDC----STCDINAFCEPFNERCVCSVGFTGNGKKC-SILAPITCKRACHKKAKCVKGK-CECLPGLRGDG---VQSCFDC----SICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEK--CHPNAKCV-NRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCFDCRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCH---RNAVCIN----QNCVCIPEYIGDGIN 5048
            C   A C+     C+C+ G+IG+G T C+K      I+  + C     C+N  + C+C  G IGDG        DC    + C   A C+  N RC C  GFTG+G KC SI    +    C   A CV G  C+C PG  G+G   V    DC     IC  N VC  +  +C C+ G+ G+G +CF      T+K  C  NA C+    C C     GD    C +  S  P      +QQ+ S  S  V              P      +C++G+C C+SG                         RR    SG E     C  I EC+ K H   R A C N      C C   ++GDGI 
Sbjct: 2093 CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQ--NRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEP-----ANQQDLSDVSSCV-------------TPCDSSTQLCISGECICKSGF------------------------RRNSTLSGSE----TCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGIT 2410          

HSP 14 Score: 80.4925 bits (197), Expect = 3.577e-14
Identity = 107/337 (31.75%), Postives = 139/337 (41.25%), Query Frame = 3
Query: 3063 SCHLNAKCIPRQNTCECNSGFHGDGI---------QCKLLPLCTPACHPQASCING--NCKCNNNLIGDGI------SSCFDCDK-CSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQS-----CHKLAVCKEG-TCKCSNGLTGDG---VNFCFNC----SLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDC---SSRCGENAFCY-NGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLS----NLIGDGTTYCFNCSSCA-------RNSDCKPE--QQTCTCKRGYVKDGNNC 3929
            +CH  A C      C C  GF GDG           C  LP     C  +A C N   +C+C+   IGDG         C   D  CS  A C   N+RC C PG+ G+G+KCV    ++     C   A C  G TCKC+ G  G+G   V    +C     +C  NA C     +C+C   F G+G +C  +  C    S C +NA C   G+C C+ GF+G+P   C    V   PA     +    C+        TPC  S      CI G C C S    N    G+  C +   CA       R + C+       CTC  G+V DG  C
Sbjct: 2092 TCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSL---CADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVC--QNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSL-VSKEPANQQDLSDVSSCV--------TPCDSSTQ---LCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2411          

HSP 15 Score: 79.7221 bits (195), Expect = 6.707e-14
Identity = 103/373 (27.61%), Postives = 134/373 (35.92%), Query Frame = 3
Query: 5679 CHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQP-VLCTSKCHKNAKCLKGNCECLPGFVGDGI------QVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPK--CHSNAL-RVNQQCICLPGFIGD--------------GKNFCFDCSTCPPNSDCLPQ---EQRCICKKDYFMNDT-----QCIHTGRTPQCVPKCHHYASCV----QDKCECLPGFIGDGI 6689
            CH  A C+     C+C++G+ G+G        C+ K   +       CI LP             S C   + C    + C+C   Y  +  +CSP  Q  VL  + C   A C    C+CLPGF GDG+      +   NCS CD NA+C      C C P Y GNG  CV                               D +        C   A+C  +  +C C +GFSGNG  C       + K  C  NA+      CIC  GF GD               +    D S+C    D   Q      CICK  +  N T      C       +   KC   A+C        C C  G +GDGI
Sbjct: 2093 CHSLATCEQSTGVCICRDGFIGDG-----TTACSKKSTAD-------CISLP-------------SLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCV-GGTTCKCNPGYFGNGLCCVP------------------------------DPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGI 2409          

HSP 16 Score: 79.7221 bits (195), Expect = 7.606e-14
Identity = 161/639 (25.20%), Postives = 232/639 (36.31%), Query Frame = 3
Query: 7302 CFNCAQCDANAICKPDENLCVCAQGFTGN--GITCKAID--PSCNTNCHKDALCFKD----SCICKSGLSGDGKNYCFDCKRC-DQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGDGFSFCFNCSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQC-------FCRPGLIGDGYNCLDCRKC-HEKATCNIR--------SMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVC--VKG--KCICNRNLVGDGYQ-CRAPEECN-NDAD--CVQFQEV----CRKDQSSLKKICKCKDGLVRDLQG-------QCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDC-------SGCDKNAICTEKQG---CICKSGFIGDGRQCIVLNE--CADNSDCTTIRGR-----ASECIRSSEGIQKC-QCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCV 9032
            C +  +C  +A+C+    +C C  GF G     +C  +D   + + NCH+ A C       +C C +G        C D   C + N+ C     +CV KP                               C C+NGF GDG+              C P  +K  C             +  K  CSE+   C  +          C  G    G  C D  +C  EKA C++         +  C C  GY G+GF C  I  C +                                      + PCHP A C  ++G  KC C+    GDG + C  P E +  D +  C +   V     R    SL  +C+C+ G   + +        +C++ + N    + AVCV +     RC C  G+ G+G   CTD        +GCD  A+C  + G   C C +G+ GDG  CI + E   +D + CT    R       +C    E + +C  C  G   +NG C+ L     CA       QK +C          K   C + H      D   C C  G+ GDG+ C   D+C+    C D N  C  +  +   CVC   F   +  CV
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTY---------------------------SCECENGFLGDGYQ-------------CVP-TTKKPCD----------STQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDE--------------------------------------RHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEE-SRNNCDPASAVCVNTEG-SYRCECAEGYEGEGGV-CTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCA-------QKNDCN---------KHAECIDIHP-----DSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSF-NCVCLEGFKKVDEKCV 1919          

HSP 17 Score: 79.337 bits (194), Expect = 9.780e-14
Identity = 97/343 (28.28%), Postives = 139/343 (40.52%), Query Frame = 3
Query: 2757 CCVEKCHEQAQCVD--GKCLCKPGFSGDGVETCFHCSQCD---------SNAICDQNNKACICKSGFEGNGINCL-RAINCKQK---CHKQARCLLGKCICNKGLNGNGV------EYCFNCTSCHLNAKCIPRQNTCECNSGFHGDGIQCKLLPL----CTPACHPQASCINGNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCV-----KTCFQSCHKLAVC-KEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDCSSRCGENAFCYNGTCKCKLGFQGNPL----EHCFDCRVCHYPAY 3680
            C    CH  A C    G C+C+ GF GDG   C   S  D           A CD + ++C C +G+ G+G  C     +C  +   C  +A C   +C C  G  G+GV      E   NC+ C  NA C+    TC+CN G+ G+G+ C   PL     T  CHP                               NA C+  +++C C  G+ GNG+ C      +T    C K A+C   G+C C +G  GD     + CS        L+++E     ++   D  +C    D S++      C +G C CK GF+ N      E C D   C   ++
Sbjct: 2088 CSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCV-GGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHP-------------------------------NAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPF---YKCS-------SLVSKEPAN--QQDLSDVSSCVTPCDSSTQ-----LCISGECICKSGFRRNSTLSGSETCADIDECAEKSH 2381          

HSP 18 Score: 78.9518 bits (193), Expect = 1.072e-13
Identity = 130/515 (25.24%), Postives = 189/515 (36.70%), Query Frame = 3
Query: 4764 CRPTCGENAICV----NGQCQCQSGLQGNP--LKHCFDC--RPCHSFAVCD--VENRRCICQSGFEGDGRNCKKIKECSPK----CHRNAVCIN----QNCVCIPEYI-----GDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIEL--------KCEPSCGENAKCVNGKCE------------------CLPGLQG----------------NPLQHCF-NCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNK---CDSNALCVNRHCICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKC-HKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPG--FIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGDGIQVCFNCSTC 6092
            C+ TC     C+      QC C SG  G+   L+   +C   PCH  A C   + +  C C  G+EG+G  C  I ECS K    C  ++ CIN      C C   +      G G++ C + + C+  A    HN               C+A E+        KC   C    + ++GKCE                  C+  + G                 P   C  N   CD+ A C +    C CK GY G+G+TC  +N C+ K   C     C+N           DG   C       KN     ++  CI  +G              C  GCG+NA C N  C C+ G +G+P + C D  +C    + C     +CV     FG G+ C        +C + A   +   I   G  F   G +      +   +S            KD  +           + CTS C  N++C+ G CEC+ G+ G+ +  C +   C
Sbjct:   99 CQSTCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLEHPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGA----HN---------------CDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNL----------DGGYVCC------KNGQ---DDATCIKDQGAF------------CSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCV---NLFG-GFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELT------TSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDEC 553          

HSP 19 Score: 76.6406 bits (187), Expect = 5.407e-13
Identity = 99/347 (28.53%), Postives = 128/347 (36.89%), Query Frame = 3
Query: 7428 NCHKDALCFKDS--CICKSGLSGDGKNYC-----FDC----KRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQND--CHPNAVRVNNCCRCKNGFFGDGF------SFCFNCSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRK-CHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISK--------------LCINPNCQPPCHPKA-VCVKGKCIC----NRNLVGDGYQ-CRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRD 8348
             CH  A C + +  CIC+ G  GDG   C      DC      C   A C  + + C C   + GDG+ C+ + +     D  C P AV  N  C+C  GF GDG           NCS C  NA C    + C+C   + GNG  C                           + D  +C+     CH  A CN  S +C+C  G+ GNG  C    SC         N IC +    CIC      DP  K              L    +C  PC     +C+ G+CIC     RN    G + C   +EC   +        CR    S   +C C DG V D
Sbjct: 2092 TCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTT-CKCNPGYFGNGLCC---------------------------VPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAIC-LPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGS--HVCTCPDGHVGD 2407          

HSP 20 Score: 76.2554 bits (186), Expect = 8.360e-13
Identity = 82/256 (32.03%), Postives = 115/256 (44.92%), Query Frame = 3
Query: 6819 PPCAPGGF---CNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGF-----RCYPVILECPK-CHYRAQC--VIGKCQCKNGLQGDGINFCMNCSECD-KNAQCFPNF----SKCECRQGYRGDGKNCVKIDECSPKCHQ---NAVCIN-SNCHCLPMYTGNG---VSFCFNCAQ----CDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTN---CHKDALCF-KDSCICKSGLSGD 7493
            PP + GG+    N  + Q  S    +  + C   + C   A C  S   CIC  G+ GDG      +     +  P  C  +A+C      C+C  G  GDG     +  +C  ++  C P       +C+C  G+ GDG  CV I E +  C Q   NA C+  + C C P Y GNG   V    +C      C  NA+C  +   C C+ GF+GNG++C     SC T+   C K+A+C    SCIC+ G  GD
Sbjct: 2058 PPPSNGGYGEETNQEEEQVTSTTTTEAPSLCSTVT-CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFP-QKSCRTDKSVCAKNAICLPTGSCICRHGFKGD 2311          

HSP 21 Score: 75.485 bits (184), Expect = 1.348e-12
Identity = 145/542 (26.75%), Postives = 206/542 (38.01%), Query Frame = 3
Query: 2847 CFHCSQCDSNAICDQNNKACICKSGFEGN--GINCLRAINCK---QKCHKQARC--LLG--KCICNKGLNGNGVEYC--------FNCTSCHLNAKCI--PRQNTCECNSGFHGDGIQCKLLPLCTPACHPQAS----CINGNCKCNNNLIGDGISSCFDC---------------------DKCSMNARCDVSNQ--RCICQPGYEGNGIKC--VKTCFQS--CHKLAVCK--EGT--CKCSNGLTGDGVNFCFNCSLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDCSSRCGENAFCYNGT----CKCKLGFQGNPLEH-CFDCRVCHYPA-YCDIPNRKCICITEN-----------------DIFSRTPCSFSCHPNAKCIKGR----CRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQTCTCKRGYVK----DGNNCSIISARCHPECGV---NAQCINGKCECL--AGLQGNPFQQCFDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKC 4202
            C    +C  +A+C++    C C+ GFEG     +C+    C      CH+ ARC   +G   C C  G        C         N T C  NAKC+  P   +CEC +GF GDG QC  +P     C    S    C   N  C  + + DG   C +C                       CS+NA C   N    C C+ GY G+G  C  +  C +   CH  A C   EG+  C+C +G  GDG+  C N             E  CE +E+F G      D V C S        YNG+    C+C+ GF+     + C D   C      CD  +  C+    +                 DI         C   A CI       C+C++   GDG T C            +P+     C   + +    +   C++      P+CG        ING C+ L  +GL      Q  DC + ++  D  P +  C C  G+IG+G  C    + V +C+  G C+++  KC
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQC--VPTTKKPCDSTQSSKSHCSESNMSCEVDTV-DGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDVEKFCGR----VDHVSCLS-----VRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGAT-CIKIEE-------EPKSDKTACTDEWSRLCELEKKQCTVDEEEV-PQCGACLPGHHPINGTCQSLQISGL----CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMIC----DDVDECNNAGMCDDENTKC 1896          

HSP 22 Score: 75.0998 bits (183), Expect = 1.541e-12
Identity = 114/405 (28.15%), Postives = 150/405 (37.04%), Query Frame = 3
Query: 7833 ACSEATSLCIKNQCFCRPGLIGDGYNC------LDC----RKCHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICNRNLVGDGYQCRAPEE-------CNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKP------ACNGACHSKAVCVKSSNLESR-CLCLPGFVGDGMT-----TC-TDCSGCDKNAICTEKQGCICKSGFIGDGR---QCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPC-AKNAVCIYQKCECLPGLVGN----GFIKCTNCSECHKK-------ALCHDQRG---CVCSHGYSGDGIQC 8903
             C ++T +CI     CR G IGDG          DC      C +KA C+  +  CEC  GYIG+G+ C          DC+  + +C+                               P+AVC   +C C     GDG +C +  E       C+ +A CV                CKC  G   +  G C  P         G CH  AVC    N ESR C C  GF G+G++     +C TD S C KNAIC     CIC+ GF GD       +V  E A+  D + +                                 SC+ PC +   +CI  +C C  G   N    G   C +  EC +K       A C +  G   C C  G+ GDGI C
Sbjct: 2098 TCEQSTGVCI-----CRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVC-----SPHPQDCVLRDNLCS-------------------------------PEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVG------------GTTCKCNPGYFGN--GLCCVPDPLDCVHFTGICHPNAVC----NSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVS--------------------------------SCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2411          

HSP 23 Score: 72.0182 bits (175), Expect = 1.507e-11
Identity = 106/388 (27.32%), Postives = 155/388 (39.95%), Query Frame = 3
Query: 3366 SCHKLAVCKE--GTCKCSNGLTGDGVNFCFN---------CSLCDKNAKCLINEEKCECMERFEGDGFTC----QDKVDCSSRCGENAFCYNGTCKCKLGFQGNPL------EHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPC-----------SFSCHPNAKC--IKGRCRCLSNLIGDGTTYCF-------NCSSCARNSDCKPEQQTCTCKRGYVKDG-NNCSIISAR-------------CHPECGVNAQ-CINGKCECLAGLQGNPF----QQCFDCKRCSQFA-DCDP--------WNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCSTCDINA--FCEPFNERCVCSVGFT 4316
            +CH LA C++  G C C +G  GDG   C            SLC   AKC  +   CEC   + GDG+ C    QD V   + C   A C N  C+C  GF G+ +      E   +C  C   A+C +    C C      F    C           +  CHPNA C     +C+C S   G+G + CF       + S CA+N+ C P   +C C+ G+  D    CS + ++             C   C  + Q CI+G+C C +G + N      + C D   C++ +  CD          +  C C  G++G+G TC   +N   +  ++ +CE            DG+       T D     F +   E   CS  F+
Sbjct: 2092 TCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHC-VGGTTCKC--NPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLP-TGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVN---QGKLSVYCE-----------ADGMTLVLGNETADFEGKIFVKGQAENPYCSKSFS 2460          

HSP 24 Score: 69.707 bits (169), Expect = 7.658e-11
Identity = 141/564 (25.00%), Postives = 204/564 (36.17%), Query Frame = 3
Query: 2532 ETF-LPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDKTNGYCKCRYGFFGDGFTCNKTCCVE---------KCHEQAQC---VDG-KCLCKPGFSGDGVETCFHCSQC-DSNAICDQNNKACI---------CKSGFEGNGINCLRAIN--CKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTS---------------------CHLNAKCIPRQNT--CECNSGFHGDGIQCKLLPLCTP--ACHPQASCINGN----CKCNNNLIGDGIS--------SCFDCDK----------CSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEE---KCECMERFEGDGFTCQDKVDCS---SRCGENAFCYNGT----CKCKLGFQGNPL-------EHCFDCRVC--HYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGDGTTYCFNCSSCARNSDC---KPEQQTCTCKRGYVKDGNNCSII 3938
            +TF LP      P AN +  +VENT             KC     +C  D+ C++  G C+C  GF G      K  CV+          CHE A+C   V G  C C  GF      +C    +C + N+ C   N  C+         C++GF G+G  C+      C      ++ C      C        VE C  C                       C LNA C+    T  C C  G+ GDG  C  +  C     CHP A C N      C+C++   GDGI         SC D +K           S+       +  C C+PG+        +    SC  +  C+E                    + CD  +   +N E   +CEC E +EG+G  C D  +C    + C   A C N      CKC  G+ G+         E   D   C   +   C++  ++C    E       P   +C P    I G C+ L  + G     C   + C ++++C    P+   C+C  G++ DG  C  +
Sbjct: 1371 DTFALPTTTTGAPQANDS--SVENT-------------KC-TSSDECGLDALCERRTGVCRCEPGFEG---APPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVE-CKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFR------FEKESNSCVDIDECEESR------------------NNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEE-----EVPQCGACLPGHHPINGTCQSL-QISG----LCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDV 1880          

HSP 25 Score: 68.1662 bits (165), Expect = 1.862e-10
Identity = 106/392 (27.04%), Postives = 143/392 (36.48%), Query Frame = 3
Query: 6255 GFSGDGIKTCFNCSS---------CSIEAICVPDQEKCICKAGFSGNGEQCVENIEG---SSPKCHSNALRVNQQCICLPGFIGDG------KNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGDGIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGF-RCYPVILECPK--------------CHYRAQ-CVIGKCQCKNGLQGD----GINFCMNCSE-------CDKNAQCFPNFSK--CECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGN 7289
            GF GDG   C   S+         C+ +A C      C C AG+ G+G  C  + +        C   A+  N++C CLPGF GDG           +CS C  N+ C+     C C   YF N                      CV D  +C+  F G           C PNA C  E ++C C +GF GNG             C P   C   K                  S C  NA C P+   CIC  G+KGD F +C  ++ + P               C    Q C+ G+C CK+G + +    G   C +  E       CD+ A C   F    C C  G+ GDG  CV      P  +Q  + +      + +  GN
Sbjct: 2111 GFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGG-TTCKCNPGYFGNG-------------------LCCVPDPLDCV-HFTG----------ICHPNAVCNSESRQCQCSSGFSGNGVS-----------CFPQKSCRTDK------------------SVCAKNAICLPT-GSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCV------PHVNQGKLSVYCEADGMTLVLGN 2435          

HSP 26 Score: 67.0106 bits (162), Expect = 5.006e-10
Identity = 111/403 (27.54%), Postives = 159/403 (39.45%), Query Frame = 3
Query: 6282 CFNCSSCSIEAICVPDQEKCICKAGFSGN--GEQCVENIE--GSSPKCHSNALRVNQ----QCICLPGFIGDGKNFCFDCSTCP--------PNSDCL--PQEQRCICKKDYFMNDTQCIHTGRTP---QCVPKCH---HYASCVQDKC-------ECLPGFIGDG-----IKFCF-KCSSCDPNADCVPEQQ--KCVCKTGFYGNGNKCDKIESTCEP-PCAPGGFCNNS----KCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGY--KGDGFRCYPVILECPKCHYRAQCVIGKCQCKNGLQGDG-INFCMNCSECDKNA-QCFPNFS---------KCECRQGYRGDGKNCVKIDECS---PKCHQNAVCINS----NCHCLPMYTGNGVS 7298
            C +   C ++A+C      C C+ GF G    + CV+  E       CH +A   N      C C  GF       C D   C          N+ C+  P    C C+  +  +  QC+ T + P       K H      SC  D         EC+ G+   G     I  C  + + C  NA+CV       C CK G+ G+G  C  I    E  PC P   C N     KC+C+SG +GDG+  C N           P  + C  V  +  + D   C  V +      Y    +   C+C+ G + +   N C++  EC+++   C P  +         +CEC +GY G+G  C  IDEC      C   A+CIN      C C+  YTG+G +
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDVEKFCGRVDHVSCLSVRI------YNGS-LSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGAT 1779          

HSP 27 Score: 67.0106 bits (162), Expect = 5.398e-10
Identity = 117/465 (25.16%), Postives = 170/465 (36.56%), Query Frame = 3
Query: 2961 CKQKCHKQARCLLG----KCICNKGLNGNGVEY-----CFNCTSCHLNAKCIPRQNT-----CECNSGFHGDGIQCKLLPLC----TPACHPQASCIN--GNCKCN-------NNLIGDGISSCFDCDKCSMNAR-CD--------VSNQRCI--CQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTG-----------DGVN-----FCF-NCSLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDCSSR----------------------------------------CGENAFCYNGTCKCKLGFQGNPLEHCFDCRVC-HYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCI-KGRCRCLSNLIGDGTTYCFNCSSCARNSDC--KPEQQTCTCKRGYV-KDGNNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFDCKRC 4055
            C+  C  +  CL      +C C+ G +G+  E      C     CH+ A+C   QNT     C C  G+ G+G +C  +  C    T  C   + CIN  G   CN           G G+  C D ++C   A  CD        + + +C+  C PGYE    KC         KL  C +    C N + G           DG N      C  N ++CD++A C I  + C+C   + GDG TC D  +C ++                                        CG+NA C N TC C  GF+G+P + C D   C    + C     +C+     ++F    C       A+C  +      S +   G  +          S         + T  RG + KD    +     C   C  N++C+ G CEC++G  GN    C D   C
Sbjct:   99 CQSTCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLE-HPCHMMAQC---QNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKC-DVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCV-----NLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDEC 553          

HSP 28 Score: 65.4698 bits (158), Expect = 1.312e-9
Identity = 115/394 (29.19%), Postives = 148/394 (37.56%), Query Frame = 3
Query: 9246 EKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALC--VIGTCKCPPSFKGNGYSGC-----FDC----SKCHANADCDES-KGCTCKPGFEGNGCYCRPEDK-CKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPV----QCDKNAVCLS-NNCVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICITQT--CYCVPGYFGDGI-----KSC-TSCSVCHKNAQCLPDRGCVCKSDFIGDGF-NCRPL--DECRINEDCRDPNKMCLLNPSMKNL----QCTCKPLHILINNYCLP--------KECTSKCHK---NAKCE----GGMCQCLSGFIGDGINC 10283
            E+++    Q+    +  A S C  +     CH  A C    G C C   F G+G + C      DC    S C   A CD S + C C  G+ G+G  C P  + C    +   P  +C      +R C C PG T     KC+ +        QCD NA C+    C C  GY G GL C P+                         CV   G                CH  A+C +++  C C  G+ G+G+     KSC T  SVC KNA CLP   C+C+  F GD F  C  L   E    +D  D +       S   L    +C CK       N  L          EC  K HK    A C       +C C  G +GDGI C
Sbjct: 2067 EETNQEEEQVTSTTTTEAPSLCSTV----TCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVC-----QNRRCQCLPGFT-GDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDP----------------------LDCVHFTGI---------------CHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICK--SGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2411          

HSP 29 Score: 65.4698 bits (158), Expect = 1.488e-9
Identity = 94/363 (25.90%), Postives = 134/363 (36.91%), Query Frame = 3
Query: 7638 CHPNAV--RVNNCCRCKNGFFGDGFSFCFNCSN---------CSPNADCFPHLSKCQCKEEFTGNGFIC---------QRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCL-------DCRKCHEKATCNIRSMKCECLPGYIGNGFECI-SITSCTQSSDCIRPNEICNVAISQCICEANSFLDPIS----KLCINPNCQPPCHPKAVCV-KGKCICNRNLVGDG-YQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNL--ESRCLCLPGFVGD----GMTTCTDCS-------GCDKNAICTEKQG---CICKSGFIGDGRQCI 8576
            CH  A   +    C C++GF GDG + C   S          C+  A C      C+C   + G+G++C         +   C P      ++C   +C C PG  GDG  C+       +C +C   A C +    C+C PGY GNG  C+     C   +    PN +CN    QC C +    + +S    K C     +  C   A+C+  G CIC     GD  Y+C +          V  +   ++D S +                 C  P           C  S+ L     C+C  GF  +    G  TC D          CD+ A C    G   C C  G +GDG  C+
Sbjct: 2093 CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPE-----AVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHC-VGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTD--KSVCAKNAICLPTGSCICRHGFKGDPFYKCSS---------LVSKEPANQQDLSDVS---------------SCVTP-----------CDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCV 2412          

HSP 30 Score: 62.7734 bits (151), Expect = 1.014e-8
Identity = 132/514 (25.68%), Postives = 194/514 (37.74%), Query Frame = 3
Query: 3243 SSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIK--CV-----KTCFQSCHKLAVCKE----GTCKCSNGL--TGDG----VNFC--FNCSLCDKNAKCL--INEEKCECMERFEGDGFTC--QDKVDCSSRCGENAFCYNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITEND-IFSRTPCSFSCHPNAKCIKG----RCRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQ--------TCTCKRGYVKDG---------NNCSIISARC----HPECGVNAQCINGK----CECLAGLQ-GNPFQQCFDCKRCSQFA-DCDPWNE---------RCVCQSGYIGNGFTCTKIINC---VTKCHVNGFCENQE----CKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCSVGFTG----NGKKCSILAPITCK-RACHKKAKCVKGKCECL--PGLRGDGVQSCFDCSICDNNTVC---YPDQEKCVCNPGYYGDGTTC 4541
            + C   D+C ++A C+     C C+PG+EG   K  CV      T   +CH+ A C+       C C  G     DG    ++ C   N + C  NAKC+       CEC   F GDG+ C    K  C S     + C      C++    + ++   +C+ C             +C   N+ +  + PCS     NA C+       C C     GDG   C + + C     C P  +         C C  G+  DG          +C  +   C    H  C ++ +  NG     CEC  G +       C D   C +   +CDP +          RC C  GY G G  CT I  C   +  C     C N+     CKC+ G  GDG       +TC I    EP +++  C+  ++       K+C++      +  AC      + G C+ L   GL       C   + C+ +  C   +PD   C C  G+ GDG  C
Sbjct: 1393 TKCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEV----DTVDGSVECKEC----MGGYKKSGKVCEDINECVAEKAPCSL----NANCVNMNGTFSCSCKQGYRGDG-FMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSC-LSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDG-------ATC-IKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGL-------CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMIC 1877          

HSP 31 Score: 62.003 bits (149), Expect = 1.395e-8
Identity = 104/383 (27.15%), Postives = 143/383 (37.34%), Query Frame = 3
Query: 9612 TPSTNGKCIILGCPVQCDKNAVCLSNN--CVCKTGYSGTGLNCKPNDQCSQNS--DCPEPNSRCEMMK---DYNRKCVCLPGFQDDNGKCSP--KECQPK---CHMFAICITQTCYCVPGYFGDGIK------SCTSCSVCHKNAQCLPDRGCVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKC--EGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMI-----NSKCQPEP-----------CPINCHPLAQ-CKSGKCVCQGELQGD----GIRTCFKCSSCHA-----------RAVCSMDGCKCMPGYVGNGIVC 10604
            T +T  +   L   V C   A C  +   C+C+ G+ G G        CS+ S  DC    S C       +  R C C  G+  D   CSP  ++C  +   C   A+C  + C C+PG+ GDG+K        ++CS C  NA C+    C C   + G+G  C P           DP            L C    +H            T  CH NA C  E   CQC SGF G+G++C     C  D     + ++C  T       C+C  GF+       +S    EP           C   C    Q C SG+C+C+   + +    G  TC     C             R       C C  G+VG+GI C
Sbjct: 2077 TSTTTTEAPSLCSTVTCHSLATCEQSTGVCICRDGFIGDGTTA-----CSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVP-----------DP------------LDC----VHF-----------TGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGS-----CICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2411          

HSP 32 Score: 62.003 bits (149), Expect = 1.691e-8
Identity = 168/646 (26.01%), Postives = 223/646 (34.52%), Query Frame = 3
Query: 5052 CFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYM-GNGLTCISVNGCNNK----CDSNALCVNR----HCICLPGFTGDGTRFCFDCSSCP------KNSNCLPEEQKC------------ICQEGYIMNGAKCQPI---VHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLK--CNENALCVNQ----KCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGDG-IQVCFNCSTCDKNA-NCFPYQE---------RCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICK--AGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPK--CHHYASCVQDK-----CECLPGFIGDGIKFCFKCSSCDPNADCVPEQQK---------CVCKTGFYGNGNKC 6794
            C +   C  +A CE     C C  GF G            + SC +  +C  G              +C    RC  +    V    C C  G+   +  +C  ++ C       C +NA CVN+     C C  GF GDG + C   +  P        S+C      C             C  GY  +G  C+ I   V E  P C  NA CVN             M   F C                 CK GY G+G+MCT IN C+ +  C+ +A C N     KC C  GF GDGIK C +           P ++ C+        EK C  +   V C S    N   L   CEC PGF  +     C +   C+++  NC P            RC C   Y G G  C  I                     +C +G +G           C   A+C+     C CK  AG++G+G  C++  E   PK    A       +C      + K    D    P    CLP          + +N T C     +  C  K  C+ +A C+        C C  GFIGDG+  C     C+    C  E  K         CVC  GF     KC
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGFEG---------APPKKSCVDVDECATGD------------HNCHESARCQNY----VGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQ-CVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAP-CSLNANCVN-------------MNGTFSCS----------------CKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDV------EKFCGRVDH-VSCLSVRIYNGS-LSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDI--------------------DECDRGMAG-----------CDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEE--EPKSDKTACTDEWSRLCEL----EKKQCTVDEEEVPQCGACLPGH--------HPINGT-CQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGM-ICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKC 1918          

HSP 33 Score: 62.003 bits (149), Expect = 1.720e-8
Identity = 139/551 (25.23%), Postives = 202/551 (36.66%), Query Frame = 3
Query: 9159 DCKYENQECVAR----LDS-----SLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALC--VIG--TCKCPPSFKGNGYSGCFDCSKCH--------ANADCDESKG---CTCKPGFEGNGCYCRPEDK------CKFNSDCNDPLKIC-VQSPDTSRNC------VCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNN----CVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQ-DDNGKCS---PKECQP--------------KCHMFAICITQTCYCVPGY-FGDGIKSCTSCSVCHKN--------AQCLPDRG---CVCKSDFIGDGFNCRPLDEC------------------------------------RINEDCRDPNKMCLLNPS----MKNLQCT-----------CKPLHILINNYCLPKECT------SKCHKNAKC-----EGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKC 10412
            D   EN +C +     LD+     + +C C+ GF+    K S V+              C   D N  CH SA C   +G   C CP  F+      C D  +C         ANA C    G   C C+ GF G+G  C P  K          S C++    C V + D S  C        K G       +C+    P  C  NA C++ N    C CK GY G G  C   ++C +   C  P++ C  + + + KC C  GF+ D   KC+    + C+                  ++   ++  C C PG+ F     SC     C ++        A C+   G   C C   + G+G  C  +DEC                                    +I E+ +     C    S    ++  QCT           C P H  IN  C   + +      + C+K+A+C     +   C C  GFIGDG+ C    EC     C D+ + C+ T     F CVC+ GF+ ++ KC
Sbjct: 1387 DSSVENTKCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVD-----------VDECATGDHN--CHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAP--CSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPC-HPHAECTNL-EGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENT--IGSFNCVCLEGFKKVDEKC 1918          

HSP 34 Score: 61.2326 bits (147), Expect = 2.550e-8
Identity = 98/347 (28.24%), Postives = 140/347 (40.35%), Query Frame = 3
Query: 8496 CDKNAICTEKQG---CICKSGFIGDGRQCIVLNECAD------NSDCTTIRGR-----------------ASECIRSSEGIQK-----------------------CQCSQGFKLLNGKCEPLSC--IYPCAK--------NAVCI----YQKCECLPGLVGNGFIKCTNCSECHK-------KALCHDQR---GCVCSHGYSGDGIQC-RIEDQC-SLNSDCTD--------PNKICITSTDTVKRC-VCKSSFISSNSGCVPLT----CLSK--CHKYANC-----ENGVCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEK 9251
            C  NA C    G   C CK G+ GDG  C  +NEC +      +++CT + G                   +   RS E ++K                       C+C  GF+    + E  SC  I  C +        +AVC+      +CEC  G  G G + CT+  EC +        A+C ++    GC C  GY+GDG  C +IE++  S  + CTD          K C    + V +C  C       N  C  L     C  K  C+K+A C     ++  C C  G++GDG+IC   DEC ++  C  EN +C   +  S  C C  GF+   EK
Sbjct: 1576 CSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRF---EKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGV-CTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTI-GSFNCVCLEGFKKVDEK 1917          

HSP 35 Score: 60.077 bits (144), Expect = 5.375e-8
Identity = 110/453 (24.28%), Postives = 155/453 (34.22%), Query Frame = 3
Query: 4089 RCVCQSGYIGNGFTCTKIINCVTKCHVNGFC-ENQECKCLPGLI--------------GDGINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSC---FDC--------------------------------SICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEK---CHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCFDCRPC-HSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCI--PEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLT-CNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRC 5276
             C C  GY GNG  CT I  C  K  +   C E+ +C  LPG                G G++ C D + C+  A     +E C  S+G               C   C    + + GKCE +     + +  C    DC                                +ICD +  C+   + C C  GY GDG TC   ++ C  K   C    +C+N           DG   C  C +   DA C  DQ                      C   CG+NAIC N  C C  G +G+P K C D   C  + +VC     RC+   G    G  C +      +C   A   + + +     ++   G        S   ++         T  +G     +    +  L C   C  N++CV G CEC+ G  GN L  C +   C
Sbjct:  156 ECRCLPGYEGNGHECTDIDECSDK--LTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGS------------FKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINE-CDAKDTPCSDGGRCLNL----------DGGYVC--CKNGQDDATCIKDQ-------------------GAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCVNLFG----GFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSS-----GGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDEC 553          

HSP 36 Score: 59.3066 bits (142), Expect = 9.346e-8
Identity = 127/513 (24.76%), Postives = 181/513 (35.28%), Query Frame = 3
Query: 7863 KNQCFCRPGLIG------DGYNCLDCRKCHEKATC--NIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICN-------RNLVGDGY-QCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGA-----CHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKN-AICTEKQG-------CICKSGFIGDGRQCIVLNE-------CADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSG------DGIQCRIEDQC---------SLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVP----------LTCLSKCHKYANCENGVCKCILGYVGDGII-CRLPDECKSSLDCKYENQECVARLDSSLMC 9215
            K QC+C  G  G      D   CL+   CH  A C   + S +C CLPGY GNG EC  I  C+                           D ++  C       P H K + + G   CN       +   G G  +C    EC   A      E+C     S K + KC  G    + G+C+     G+     C  +A CV +  +                 C   S C KN AIC            C CK+G+ GDG  C  +NE       C+D   C  + G    C ++ +    C   QG            C   C  NA+C    C C+ G  G+   KC + +EC +        G  C + + G         +    DQ          S  +D T   +  I  + +++     S  I+   G +P          L C S C   + C  G C+C+ GY G+ ++ C   DEC + + C  E  E    L    +C
Sbjct:  115 KPQCYCDSGFSGSACELQDKNECLE-HPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECS---------------------------DKLTSRC-------PEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYEL-IDGKCEDVNECGSEKLHKCDVRADCVNT--IGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDG-GYVCCKNGQDDATCIKDQG----------AFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGS--ITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDECITEI-CNIEANEWCVNLIGGFVC 575          

HSP 37 Score: 59.3066 bits (142), Expect = 1.114e-7
Identity = 84/285 (29.47%), Postives = 120/285 (42.11%), Query Frame = 3
Query: 10788 CVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVF-QCIEETCPN--KCHNFAYC-RQKVCQCRLGFQGDGV------FNC-HDCSVCHPNAIC-SPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFN----NSLCYPIP-----------CVKQCDRNEE-CLFGQCQCKPGFIHNS----NKTCVEPNDCDV-----NNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIP 11531
            C C  GY    +G  CSP  H Q   DC   ++ C    + Q +RC C  GF    V    I E   N  +C   A+C     C+C  G+ G+G+       +C H   +CHPNA+C S S  C C      G+G SC P+  CR D      NA+C  T     C C+ G+        +SL    P           CV  CD + + C+ G+C CK GF  NS    ++TC + ++C       +  A+C++             +C C  G +     C+P
Sbjct: 2148 CECDAGYIG--DGYVCSP--HPQ---DCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSS-GFSGNGVSCFPQKSCRTDKSVCAKNAICLPTG---SCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTF--------GSHVCTCPDGHVGDGITCVP 2413          

HSP 38 Score: 58.9214 bits (141), Expect = 1.374e-7
Identity = 146/603 (24.21%), Postives = 236/603 (39.14%), Query Frame = 3
Query: 10602 CQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFS--------LENSLCSPIACRPKCGKNSQCQLGV----CVCKDGYSPSVNGLSCSPIDHCQSEND-CPDSNHKCVYH-GLFQGKRCMCRKGFIPKSVFQCIEET---CPNKCHNFAYCRQKVCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEEC--------LFG--QCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPINCYQPCHKNAYCNIGVCTCNPDYIGDGIT-SCKKKNLCLED-SDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIA----KKCLLPCDPNAVCV--LGECICK--VGFTGNGLQCMPTSKCNPLS---GCSDTNSVCIQ-------VPPTNYYDC-MCKPGY--IKSS--NLSICKPIVCEPSCHPKAACI-----IGSCICMKPLIGNGITECKLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVN 12239
            C + D+C  D+ C  R   C          +C+PGF         ++   C+       C ++++CQ  V    C C  G+  + +G SC  ID C   N  C  +N KCV   G +    C C  GF+    +QC+  T   C +   + ++C +    C +    DG   C +C   +  +                  G+ C+  ++C  +      NA C     +  C CK GY + +  +C  I    +CD    C        L G  +C+C  GF  +  K C  P +       SC+   + C              G ++    C+ +  Y     +      VC C P +  +  + SC   + C E  ++C    + C+     Y C+C  GYE +   C       + +  CD  A+C+  +G C CK   G+TG+G  C+   +  P S    C+D  S   +       V       C  C PG+  I  +  +L I      +  C+  A CI        C C    IG+G+  C   DEC+ +  C ++N  C+N T G   C+C  GF+  + KC+  ++ + N
Sbjct: 1395 CTSSDECGLDALCERRTGVC----------RCEPGFEGAPPKKSCVDVDECA--TGDHNCHESARCQNYVGGYACFCPTGFRKADDG-SCQDIDECTEHNSTCCGANAKCVNKPGTYS---CECENGFLGDG-YQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTV-DGSVECKECMGGYKKS------------------GKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGY-RGDGFMCTDI---NECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLE------RSCEDVEKFC--------------GRVDHV-SCLSVRIYNGSLSS------VCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEE-EPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMI-CDDVDECNNAGMCDDENTKCEN-TIGSFNCVCLEGFKKVDEKCVVDEKKQPN 1927          

HSP 39 Score: 58.9214 bits (141), Expect = 1.433e-7
Identity = 98/348 (28.16%), Postives = 147/348 (42.24%), Query Frame = 3
Query: 9054 CHKYANCE--NGVCKCILGYVGDGIICRLPDEC--KSSLDCKYENQECVARL---DSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGNG------YSGCFDCSKCHANADCDESKGCTCKPGFEGNGCYCRPE--DKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQ---------CDKNAVCL-SNNCVCKTGYSG-------TGLNCKPNDQ--CSQNSDCPEP-NSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQP---------KCHMFAICI----TQTCYCVPGYFGDGI 9953
            CH  A CE   GVC C  G++GDG        C  KS+ DC      C  +    +S+  C C +G+       S      +++ ++          C+P+    A+C    C+C P F G+G      +    +CS+C ANA C     C C PG+ GNG  C P+  D   F   C+ P  +C      SR C C  G   S NG    + C  Q         C KNA+CL + +C+C+ G+ G       + ++ +P +Q   S  S C  P +S  ++    + +C+C  GF+ ++     + C           KC   A C     +  C C  G+ GDGI
Sbjct: 2093 CHSLATCEQSTGVCICRDGFIGDGTTA-----CSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNL----------CSPE----AVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICH-PNAVCNSE---SRQCQCSSGF--SGNG----VSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLC--ISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGI 2409          

HSP 40 Score: 58.5362 bits (140), Expect = 1.709e-7
Identity = 160/702 (22.79%), Postives = 241/702 (34.33%), Query Frame = 3
Query: 6267 DGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALR-VNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRT--PQCVPKCHHYASCVQ-DKCECLPGFIGDGIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSC--------FNCSKCDVNAKCF--PSVKKCICVIGYKGDGFRCYPVILE-CPKCHY-RAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPK---CHQNAVCINSN----CHCLPMYTGNGVSFCFNCAQCDANAICKPDE---NL-----CVCAQGFTGNGI---------TCKAIDPSCNTNCHKDALCFK-------DSCICKSGLSGDGK-NYCFDCKRCDQN--------AICRPTE--QRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFG-DGFSFCFN-CSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKP-----ACS-EATSLCI--KNQCF-----------CRPGLIGDGYNCL------------DCRKCHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQ--CIC 8093
            DG+    + ++  +           + ++G     +   E +E ++P     +      +   LP   G G++      T  P +   PQ +    +K     DT  + T  T  PQ          C   D+C  L          C     C+P  +  P ++ CV       + ++C   +  C        +     C C +G +     SC         N + C  NAKC   P    C C  G+ GDG++C P   + C      ++ C      C    + D ++  + C EC                 GY+  GK C  I+EC  +   C  NA C+N N    C C   Y G+G   C +  +CD    C P     NL     C C  GF G+GI         +C+ ++  C    H   L  +         C C+ G   + + N C D   C+++        A+C  TE   RC C   + G+G  C                    +   C  G  G D  + C N   +C            C+C   +TG+G  C + E +P     AC+ E + LC   K QC            C PG       C             DC K  E    +  S  C C  G+IG+G  C  +  C  +  C   N  C   I    C+C
Sbjct: 1271 DGVSPTSSATAPEVPTTSASSTPDAVEESGIPSTSKPTAEPLETTAPSTEVTSPEGSGTEESTLPPTEGSGESTTSSAPTVEPATVLPPQNRN---EKPEPTKDTFALPTTTTGAPQANDSSVENTKCTSSDEC-GLDALCERRTGVC----RCEPGFEGAPPKKSCV-------DVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSC----EVDTVDGSVECKEC---------------MGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGF-MCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCT-------------------DIDECDRGMAGCDSMAMCINRMGSCG-----------CKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVC 1907          

HSP 41 Score: 57.7658 bits (138), Expect = 2.709e-7
Identity = 137/556 (24.64%), Postives = 210/556 (37.77%), Query Frame = 3
Query: 2235 CFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKSC---------DKICHKDALCQN----SRCICKPNFEGDGVNYCFDCSKCHKL--------AQC--HPKTGNCTCRPPYVGDGVS-------ECE-TFLPKGNCFPPCANHAICTVENTCQCRKNYYG--------NPLEKCNIDCSKCHTDSDCDKTNGY--CKCRYGFFGDGFTCNKTC-CVEK--CHEQAQC--VDG--KCLCKPGFSGDGVETCF------------------HCSQCDSNAICDQNNKACICKSG--FEGNGINCLRAINCKQKCH----KQARCLLG----KCICNKGLNGNG-----VEYC-FNCTSCHLNAKCIPRQNT--CECNSGFHGDGIQC---------------------------------KLLPLCTPACHPQASCINGNCKCNNNLIGDGISSCFDCDKCSMNARC-DV--SNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNC----SLCDKNAKCLINEEKCECMERFEGD 3530
            C    +C  +A C      C C PG+   G    KSC         D  CH+ A CQN      C C   F       C D  +C +         A+C   P T +C C   ++GDG          C+ T   K +C     +  + TV+ + +C++   G          + +C  + + C  +++C   NG   C C+ G+ GDGF C     C E+  CH  A+C  ++G  KC C  GF GDG++ C                   H S           +  C C+ G  FE    +C+    C++  +      A C+      +C C +G  G G     ++ C      C   A CI R  +  C+C +G+ GDG  C                                 + +P C  AC P    ING C+   +L   G+  C   + C+ +A C D+   +  C C  G+ G+G+ C       C+   +C +   KC N +        FNC         + KC+++E+K    E+ E D
Sbjct: 1395 CTSSDECGLDALCERRTGVCRCEPGF--EGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCG-ACLPGHHPINGTCQ---SLQISGL--CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDD--VDECNNAGMCDDENTKCENTI------GSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEID 1934          

HSP 42 Score: 56.9954 bits (136), Expect = 5.570e-7
Identity = 89/331 (26.89%), Postives = 124/331 (37.46%), Query Frame = 3
Query: 5160 ELKCEPSCGENAKCV----NGKCECLPGLQGNP--LQHCFNCKR--CDKFADCD--VWNKKCVCKNGYMGNGLTCISVNGCNNK----CDSNALCVN----RHCICLPGFT-----GDGTRFCFDCSSCPKNS-NCLPEEQ--------KCI--CQEGYIMNGAKCQPI-------VHEC--RPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKK----CHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLK----------------------------------------CNENALCVNQKCICLPGFIGDGIKFCFDCSACPAN 5891
            E KC+ +C     C+      +C C  G  G+   LQ    C    C   A C   + + +C C  GY GNG  C  ++ C++K    C  ++ C+N     +C C  GFT     G G   C D + C   + NC  +E         KC+  C  GY +   KC+ +       +H+C  R  C         +CE      G   Q    C+K    C + A C +    C CK GY G+G  C  IN C+ K                                        C +NA+C N  C C+ GF GD  K C D + C  N
Sbjct:   96 EHKCQSTCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLEHPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVEN 426          

HSP 43 Score: 56.6102 bits (135), Expect = 7.102e-7
Identity = 79/272 (29.04%), Postives = 105/272 (38.60%), Query Frame = 3
Query: 11550 CHKNAYC--NIGVCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKS----NPYSCKCPSGYEIDNNKCIA--KKCLLP---CDPNAVCVLGECICKVGFTGNGLQCMPTSKCNPLSGCS--DTNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVC---EPSCHPKAACIIGSCICMKPLIGNGITECKLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVD-CPTRKICV-NSKCICPEQYTSSP 12311
            CH  A C  + GVC C   +IGDG T+C KK+     +DC  + S C  K+    +  SC+C +GY  D   C    + C+L    C P AVC    C C  GFTG+G++C+  S     S CS  D N+ C+         C C PGY  +    +  P+ C      CHP A C                                       NS   Q  C C  GF      C  ++ CR +   C    IC+    CIC   +   P
Sbjct: 2093 CHSLATCEQSTGVCICRDGFIGDGTTACSKKST----ADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCV--SIHERASNCSQCDANAHCV-----GGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVC---------------------------------------NSESRQ--CQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDP 2312          

HSP 44 Score: 56.225 bits (134), Expect = 9.523e-7
Identity = 139/544 (25.55%), Postives = 208/544 (38.24%), Query Frame = 3
Query: 2064 AECYPEISKCKCKPGFVGSG-----YECREEVNCDIKCHENASC---VNGY-CKCNRNLIGDGINSCFDCLKCNTEADCS-----------PYENRCYCRPGYTGNGFTCI----KSCDKICHKDALCQNSRCICKPNFEGDGVNYCFDCSKCHK------------LAQCHP-----------KTGNCTCRPPYVGDG-----VSECETFLPKGNCFPPCANHAICT-VENT--CQCRKNYYGNPLEKCNIDCSKCHTDSD--CDKTN---------------GYCKCRYGFFGDGFTCNKTCCV--EKCHE--------QAQCVDG----KCLCKPGFSGDG-----VETCFH-CSQCDSNAICDQNNKACICK--SGFEGNGINCLRAINCKQKCHKQA-------RCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGN-----CKCNNNLIGDGISSCFDCDKCSMNARCDVSNQR---------CICQPGYEGNGIKCV 3350
            A C      C+C+PGF G+       +  E    D  CHE+A C   V GY C C          SC D  +C TE + +           P    C C  G+ G+G+ C+    K CD      + C  S   C+ +   DG   C +C   +K            +A+  P            T +C+C+  Y GDG     ++EC+          PC  HA CT +E +  C+C   + G+ ++KC     +   D +  C + +                 C+C  GF    F      CV  ++C E         A CV+     +C C  G+ G+G     ++ C    + CDS A+C     +C CK  +G+ G+G  C++ I  + K  K A        C L K  C   ++   V  C  C   H      P   TC+         +Q   L      C+  A CI+ +     C C +  IGDG+  C D D+C+    CD  N +         C+C  G++    KCV
Sbjct: 1405 ALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDEC-TEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTV-DGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERH-------PCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFR---FEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIK-IEEEPKSDKTACTDEWSRLCELEKKQCT--VDEEEVPQCGACLPGHH-----PINGTCQS--------LQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGM-ICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCV 1919          

HSP 45 Score: 55.4546 bits (132), Expect = 1.365e-6
Identity = 103/401 (25.69%), Postives = 148/401 (36.91%), Query Frame = 3
Query: 10200 TSKCHKNAKCE--GGMCQCLSGFIGDGINC---QRPFEC-GIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGDGIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLC---SPI-------ACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIE---------------ETCPNKCHNFA-YCRQKVCQCRLGFQGD----GVFNCHDCSVCHPN-------AICSPSLG---CTCPGPHLIGDGRSCKPK-DQCRIDSDCRDSNAVCTLTYDSLKCQCKL 11261
            T  CH  A CE   G+C C  GFIGDG      +   +C  + + C D+        D     C C  G+      C P P               CV +  L             C   AVC    C+C+PG+ G+G+ C +  +   +    D NA C  G      C+C PG+   N LC    P+        C P    NS+ +   C C  G+S   NG+SC P   C+++      N  C+  G      C+CR GF     ++C                  +C   C +    C    C C+ GF+ +    G   C D   C          A C  + G   CTCP  H +GDG +C P  +Q ++   C        L  ++   + K+
Sbjct: 2090 TVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKC-----DNSTRSCECDAGYIGDGYVCSPHP-------------QDCVLRDNL-------------CSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGT----TCKCNPGY-FGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQ--CQCSSGFSG--NGVSCFPQKSCRTDKSVCAKNAICLPTG-----SCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGH-VGDGITCVPHVNQGKLSVYCEADGMTLVLGNETADFEGKI 2444          

HSP 46 Score: 54.299 bits (129), Expect = 3.491e-6
Identity = 101/355 (28.45%), Postives = 141/355 (39.72%), Query Frame = 3
Query: 8826 CHKKALCHDQRG-CVCSHGYSGDGIQC----RIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVP--LTCLSK---CHKYANCENGVCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVP--IDC---NPKCHRSALCVIGT--CKCPPSFKGNGYSGCF-------DCSKCHANADCDESKGCTCKPGFEGNGCY----------CRPEDKCKFNS---DCNDPLKICVQSPDTSRNCVCKPG----TTPSTNGKCIILG----CPVQCDKNAVCL----SNNCVCKTGYSGTGLNCKPN 9743
            CH  A C    G C+C  G+ GDG          D  SL S C D  K C  ST   + C C + +I     C P    C+ +   C   A C+N  C+C+ G+ GDG+ C    E  S+      N  CV        C C  G+           N +           CVP  +DC      CH +A+C   +  C+C   F GNG S CF       D S C  NA C  +  C C+ GF+G+  Y             +D    +S    C+   ++C+     S  C+CK G    +T S +  C  +        +CD+ A C     S+ C C  G+ G G+ C P+
Sbjct: 2093 CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAK-CDNST---RSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVG----GTTCKCNPGY---------FGNGLC----------CVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCI-----SGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPH 2414          

HSP 47 Score: 53.5286 bits (127), Expect = 5.968e-6
Identity = 98/353 (27.76%), Postives = 140/353 (39.66%), Query Frame = 3
Query: 6621 CHHYASCVQD----KCECLPGFIGDGIKFCFKCSSCDPNADCV----PEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAK-------CFPSVK--KCI--CVIGYKGDGFRCYPV----ILECPKCHYRAQCV--IG--KCQCKNGLQGDGIN-----FCM-NCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPK---CHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKRCDQN-AICRPTEQRCV 7568
            CH  A C       +C CLPG+ G+G     +C+  D  +D +    PE  KC+   G Y                     +CN ++     G +G G+  C + ++C+  A        C  S+   KC+  C  GY+    +C  V      +  KC  RA CV  IG  +C+C+ G +GDG N      C  N + CD++A C      C+C+ GY GDG  C  I+EC  K   C     C+N           +G   C    Q DA          C+  QG              C+  C  +A+C   +C C  G  GD    C D   C +N ++C     RCV
Sbjct:  142 CHMMAQCQNTLGSYECRCLPGYEGNG----HECTDIDECSDKLTSRCPEHSKCINLPGTY---------------------YCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNL----------DGGYVCCKNGQDDAT---------CIKDQGAF------------CSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCV 438          

HSP 48 Score: 53.1434 bits (126), Expect = 7.483e-6
Identity = 118/438 (26.94%), Postives = 153/438 (34.93%), Query Frame = 3
Query: 10992 CHNFAYCRQK--VCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIP--CVKQ---CDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPINCYQPCHKNAYCNIGV-CTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCDPNAVC--VLGECICKVGFTGNGLQCMPTSKCNPLSGCSDTNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVC-EPSCHPKAA---------------CIIGSCICMKPLIGN----GITECKLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCI 12215
            CH+ A C Q   VC CR GF GDG   C   S    + I  PSL               C  K +C  D+  R              C+C  GYI  +  +C P P  CV +   C     C   +CQC PGF  +  K CV      ++  AS                                  NC Q C  NA+C  G  C CNP Y G+G+        C+ D               P  C   +G                C PNAVC     +C C  GF+GNG+ C P   C         N++C+   PT    C+C+ G+ K      C  +V  EP+     +               CI G CIC      N    G   C   DEC+   H  ++ A C+N T G   C C  G   +   C+
Sbjct: 2093 CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTA--DCISLPSL---------------CADKAKC--DNSTR-------------SCECDAGYIG-DGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVK-CVS-----IHERAS----------------------------------NCSQ-CDANAHCVGGTTCKCNPGYFGNGL-------CCVPD---------------PLDCVHFTGI---------------CHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICL---PTG--SCICRHGF-KGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRN-TFGSHVCTCPDGHVGDGITCV 2412          

HSP 49 Score: 52.7582 bits (125), Expect = 8.998e-6
Identity = 102/407 (25.06%), Postives = 154/407 (37.84%), Query Frame = 3
Query: 4701 ECSCKSEFVGDGKICTLR---ADICRPTCGENAICVN----GQCQCQSGL-----QGNPLKHCFDCRPCHSFA-------VCD--VENRRCI--CQSGFEGDGRNCKKIKEC-SPKCHR---NAVCINQ----NCVCIPEYIGDGIN-----FCF-NCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIE---------------------------------------LKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRC-DKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICLPG--FTGDGTRFCFDCSSCPKNSN-CLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKC 5681
            EC C   + G+G  CT     +D     C E++ C+N      C C  G      QG+ L  C D   C + A       +C+  + + +C+  C  G+E     C+ + EC S K H+    A C+N      C C   + GDG N      C  N + CDR+A C    + C C  G+TG+G+TC+ I                                          C   CG+NA C N  C C+ G +G+P + C +   C +  + C     +CV     +  G  C        +C   A   +   I   G  FT  G +      S   +S   +   +  I ++  +    +       C   C  N++CV G CEC+ G  GN +  C D  +C
Sbjct:  156 ECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCV----NLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLA-----CTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDEC 553          
BLAST of Neurogenic locus notch-like protein protein 1 vs. Ensembl Celegans
Match: fbn-1 (FiBrilliN homolog [Source:UniProtKB/TrEMBL;Acc:I7LFE6])

HSP 1 Score: 104.76 bits (260), Expect = 1.844e-21
Identity = 107/334 (32.04%), Postives = 145/334 (43.41%), Query Frame = 3
Query: 2154 IKCHENASC--VNGYCKCNRNLIGDGINSC-----FDCLK----CNTEADCSPYENRCYCRPGYTGNGFTCI---KSC---DKICHKDALCQNSRCICKPNFEGDGV------NYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGV------SECETFLPKGNCFPPCANHAICTVEN-TCQCRKNYYGN-----PLEKCNIDCSKCHTDSDCDKTNGYCKCRYGFFGDGF----------------TCNKTCCVEKCHEQAQ-CVDGKCLCKPGFSGD----GVETCFHCSQC-DSNAICDQ--------NNKACICKSGFEGNGINCLRAIN 2960
            + CH  A+C    G C C    IGDG  +C      DC+     C  +A C      C C  GY G+G+ C    + C   D +C  +A+CQN RC C P F GDGV          +CS+C   A C   T  C C P Y G+G+       +C  F   G C P    +A+C  E+  CQC   + GN     P + C  D S C  ++ C  T G C CR+GF GD F                  + + CV  C    Q C+ G+C+CK GF  +    G ETC    +C + +  CD+         +  C C  G  G+GI C+  +N
Sbjct: 2105 VTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGT-TCKCNPGYFGNGLCCVPDPLDCVHFT--GICHP----NAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPT-GSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVN 2430          

HSP 2 Score: 92.0485 bits (227), Expect = 1.127e-17
Identity = 105/352 (29.83%), Postives = 144/352 (40.91%), Query Frame = 3
Query: 4869 CHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKC---EPSCGENAKCVNGKCECLPGLQGNPL------QHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGL-------TCISVNGCNNKCDSNALC--VNRHCICLPGFTGDGTRFCF-------DCSSCPKNSNCLPEEQKCICQEGYIMNG-AKCQPIVHE-------------CRPGCGENAK-CVNGKCECLPGLQGNPM----QHCFD-------CKKCHKFADC--DVWNKKCVCKNGYFGNGYMCTP 5765
            CHS A C+     CIC+ GF GDG        CS K          +C+ +P             S C   A C+     C C  G+ G+G  C+     C   +  C   A C N +C+CLPG  G+ +      +   NC +CD  A C V    C C  GY GNGL        C+   G    C  NA+C   +R C C  GF+G+G   CF       D S C KN+ CLP    CIC+ G+  +   KC  +V +             C   C  + + C++G+C C  G + N      + C D         KC + A C     +  C C +G+ G+G  C P
Sbjct: 2107 CHSLATCEQSTGVCICRDGFIGDGTTA-----CSKKS-------TADCISLP-------------SLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHC-VGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGI---CHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLPT-GSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVP 2427          

HSP 3 Score: 92.0485 bits (227), Expect = 1.401e-17
Identity = 105/352 (29.83%), Postives = 148/352 (42.05%), Query Frame = 3
Query: 2448 CHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPP--CANHAIC-TVENTCQCRKNYYGNPL------EKCNIDCSKCHTDSDCDKTNGYCKCRYGFFGDGFTC----NKTCCVEKCHEQAQCVDGK-CLCKPGFSGDGV------ETCFHCSQ-CDSNAICDQNNKACICKSGFEGNGINCLRAINC---KQKCHKQARCL-LGKCICNKGLNGNGVEYCFNCTSCH-LNAKCIPRQNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGNCKCNN----NLIGDGISSCFDCDKCSMNA-RCD--------VSNQRCICQPGYEGNGIKCVKTCFQSCHKLAV 3386
            CH LA C   TG C CR  ++GDG + C           P  CA+ A C     +C+C   Y G+        + C +  + C  ++ C   N  C+C  GF GDG  C     +     +C   A CV G  C C PG+ G+G+        C H +  C  NA+C+  ++ C C SGF GNG++C    +C   K  C K A CL  G CIC  G  G+    C +  S    N + +   ++C                   TP       CI+G C C +    N    G  +C D D+C+  + +CD          +  C C  G+ G+GI CV    Q   KL+V
Sbjct: 2107 CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQ--NRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSC------------------VTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVNQG--KLSV 2436          

HSP 4 Score: 89.7373 bits (221), Expect = 6.389e-17
Identity = 117/397 (29.47%), Postives = 156/397 (39.29%), Query Frame = 3
Query: 4251 TCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEK---CHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQ-CQCQSGLQGNPL---KHCFDCRP----CHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPK---CHRNAVCI-NQNCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNP----------LQHCFN-CKRCDKFADC--DVWNKKCVCKNGYMGNGLTCI 5357
            TC   A CE     C+C  GF G+G             AC KK+      C  LP L       C D + CDN+T        C C+ GY GDG  C    Q C  +   C P A C NR+C+C     GDGV     C S H                           RA  C   C  NA CV G  C+C  G  GN L       DC      CH  AVC+ E+R+C C SGF G+G +C   K C      C +NA+C+   +C+C   + GD     + CSS       EP N +              + +     P       C++G+C C  G + N           +  C     +CD+ A C     +  C C +G++G+G+TC+
Sbjct: 2106 TCHSLATCEQSTGVCICRDGFIGDGTT-----------ACSKKSTA---DCISLPSL-------CADKAKCDNST------RSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVK----CVSIHE--------------------------RASNCS-QCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPF---YKCSSL---VSKEPANQQ------------DLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCV 2426          

HSP 5 Score: 85.1149 bits (209), Expect = 1.584e-15
Identity = 109/373 (29.22%), Postives = 141/373 (37.80%), Query Frame = 3
Query: 5067 SCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCI-SVNGC---NNKCDSNALCVNRHCICLPGFTGDGTR------FCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLK---CNENALCV-NQKCICLPGFIGDGIKFCFD-CSACPAN-------SNCVPE---------KKECKCAKDYFMNEKI-----CSPIKQPVLCTSKCHKNAKCL----KGNCECLPGFVGDGI 6065
            +C   A CE     C C  GF G+G T          +C   +K     C  LP L             C   A CD   + C C  GY+G+G  C      C   +N C   A+C NR C CLPGFTGDG +         +CS C  N++C+     C C  GY  NG  C P                            +P+        CH  A C+  +++C C +G+ GNG  C P   C      C +NA+C+    CIC  GF GD    C    S  PAN       S+CV             EC C   +  N  +     C+ I +    + KC + A C        C C  G VGDGI
Sbjct: 2106 TCHSLATCEQSTGVCICRDGFIGDGTT----------AC---SKKSTADCISLPSL-------------CADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVG-GTTCKCNPGYFGNGLCCVP----------------------------DPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGI 2423          

HSP 6 Score: 83.5741 bits (205), Expect = 4.441e-15
Identity = 142/541 (26.25%), Postives = 197/541 (36.41%), Query Frame = 3
Query: 4647 CFNCTSCHPDALCFPDQQECSCKSEFVG--------------------------------------------------DGKICTLRADICRPTCGENAICVNG----QCQCQSGLQGNPLKHCFDC--RPCHSF----AVCDVENRRC------------ICQSGFEGDGRNCKKIKECSPK---CHRNAVCINQN----CVCIPEYIGDGINFCFNCSSCDRNADCEPHNN--------RCTCYQGFTGNGLT--CNAIELKCEPS---CGE-------NAKCVNGK----CECLPGLQ-GNPLQHCFNCKRCDKFA-DCDVWNKKCV---------CKNGYMGNGLTCISVNGCNN---KCDSNALCVNRH----CICLPGFTGDGTRFCFDCSSCPKNSN----------CLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECL--PGLQGNPMQHCFDCKKCHKFADC-DVWNKK--CVCKNGYFGNGYMCTPINGCNLKC---NENALCVNQ----KCICLPGF 5840
            C +   C  DALC      C C+  F G                                                  D   CT     C   CG NA CVN      C+C++G  G+  + C     +PC S     + C   N  C             C  G++  G+ C+ I EC  +   C  NA C+N N    C C   Y GDG   C + + CD    C PH          +C C+ GF G+G+    N +E  CE     CG        + +  NG     CEC PG +       C +   C++   +CD  +  CV         C  GY G G  C  ++ C+     CDS A+C+NR     C C+ G+TGDG   C      PK+            C  E+++C   E  +     C P  H            +NG C+ L   GL       C     C+K A+C D+      C C +G+ G+G +C  ++ CN      +EN  C N      C+CL GF
Sbjct: 1397 CTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTC---CGANAKCVNKPGTYSCECENGFLGDGYQ-CVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGF-MCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGAT-CIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHP-----------INGTCQSLQISGL-------CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGF 1913          

HSP 7 Score: 82.4185 bits (202), Expect = 9.130e-15
Identity = 103/331 (31.12%), Postives = 137/331 (41.39%), Query Frame = 3
Query: 3747 SFSCHPNAKCIK--GRCRCLSNLIGDGTTYCFNCSS---------CARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPE--------CGVNAQCINGKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCV------CQSGYIGNGFTCT-KIINCV---TKCHVNGFC--ENQECKCLPGLIGDGINFCF-------DCSTCDINAFCEPFNERCVCSVGFTGNG-KKCSILAP------------ITCKRACHKKAK-CVKGKCECLPGLRGD----GVQSCFDCS-------ICDNNTVCYPD--QEKCVCNPGYYGDGTTCF 4544
            + +CH  A C +  G C C    IGDGTT C   S+         CA  + C    ++C C  GY+ DG  CS      HP+        C   A C N +C+CL G  G+  +     +R S  + CD  N  CV      C  GY GNG  C    ++CV     CH N  C  E+++C+C  G  G+G++ CF       D S C  NA C P    C+C  GF G+   KCS L               +C   C    + C+ G+C C  G R +    G ++C D          CD    C        C C  G+ GDG TC 
Sbjct: 2104 TVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSP-----HPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCD-ANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLPTG-SCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCV 2426          

HSP 8 Score: 82.4185 bits (202), Expect = 9.130e-15
Identity = 94/322 (29.19%), Postives = 129/322 (40.06%), Query Frame = 3
Query: 1959 CHIDATCYENN-MCICNSGHQGDGXXXXXXXXXXX----------XAECYPEISKCKCKPGFVGSGYECREE----VNCDIKCHENASCVNGYCKCNRNLIGDGI------NSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKS------CDKICHKDALC--QNSRCICKPNFEGDGVNYCF-------DCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPK-----------GNCFPPCANHAICTVENTCQCRKNYYGNP----------LEKCNIDCSKCHTDSDCDKTNG--YCKCRYGFFGDGFTC 2747
            CH  ATC ++  +CIC  G  GDG    +                 A+C      C+C  G++G GY C       V  D  C   A C N  C+C     GDG+          +C +C+  A C      C C PGY GNG  C+           ICH +A+C  ++ +C C   F G+GV+ CF       D S C K A C P TG+C CR  + GD   +C + + K            +C  PC +     +   C C+  +  N           +++C     KC   + C  T G   C C  G  GDG TC
Sbjct: 2107 CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGG-TTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLP-TGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2425          

HSP 9 Score: 82.4185 bits (202), Expect = 1.027e-14
Identity = 144/525 (27.43%), Postives = 202/525 (38.48%), Query Frame = 3
Query: 4881 AVCDVENRRCICQSGFEGD--GRNCKKIKECSP---KCHRNAVCINQNCVCIPEYIGDGINFC------FNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNG----KCECLPGLQGNPLQHCFNCKR-CDKF----ADCDVWNKKC------------VCKNGYMGNGLTCISVNGC---NNKCDSNALCVNRH----CICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQ--------KCICQEGYIMNGAK--CQPIVHECRPG---CGE-------NAKCVNGK----CECLPGLQ-GNPMQHCFDCKKCHKFA-DCDVWNKKCV---------CKNGYFGNGYMCTPINGCN---LKCNENALCVNQK----CICLPGFIGDG---IKF----CFDCSACPANSN--CVPEKKECKCAKDYFMNEKICSPIKQPV-----------LCTSK--CHKNAKCLKGN-----CECLPGFVGDGIQVCFNCSTCDKNANCFPYQERC 6131
            A+C+     C C+ GFEG    ++C  + EC+     CH +A C N        Y+G    FC       +  SC    +C  HN+ C                       CG NAKCVN      CEC  G  G+  Q     K+ CD      + C   N  C             C  GY  +G  C  +N C      C  NA CVN +    C C  G+ GDG   C D + C +   C P  +        KC C  G+  +G K    P+   C      CG        + +  NG     CEC PG +       C D  +C +   +CD  +  CV         C  GY G G +CT I+ C+     C+  A+C+N+     C C+ G+ GDG   IK       D +AC    +  C  EKK+C   ++       C P   P+           LC  K  C+K+A+C+  +     C C  GF+GDG+ +C +   C+    C     +C
Sbjct: 1407 ALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQN--------YVGGYACFCPTGFRKADDGSCQDIDECTEHNSTC-----------------------CGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDG-FMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGM-ICDDVDECNNAGMCDDENTKC 1898          

HSP 10 Score: 82.4185 bits (202), Expect = 1.145e-14
Identity = 101/348 (29.02%), Postives = 149/348 (42.82%), Query Frame = 3
Query: 4662 SCHPDALCFPDQQECSCKSEFVGDGKI-CTLRAD---ICRPT-CGENAICVNG--QCQCQSGLQGNPL---KHCFDC----RPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHR---NAVCIN-QNCVCIPEYIGDGI-------NFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIEL-KCEPS-CGENAKCV-NGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNA-LCVNRHCICLPGF----TGDGTRFCFDCSSCPKNSNCLPE---------EQKCICQEGYIMNGAKCQPIVHECR 5579
            +CH  A C      C C+  F+GDG   C+ ++    I  P+ C + A C N    C+C +G  G+      H  DC      C   AVC  +NRRC C  GF GDG  C  I E +  C +   NA C+    C C P Y G+G+       +       C  NA C   + +C C  GF+GNG++C   +  + + S C +NA C+  G C C  G +G+P   C +    +     D+ +                  V+ C   CDS+  LC++  CIC  GF    T  G+  C D   C + S+                C C +G++ +G  C P V++ +
Sbjct: 2106 TCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVC--QNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSD------------------VSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVNQGK 2433          

HSP 11 Score: 81.2629 bits (199), Expect = 2.093e-14
Identity = 113/366 (30.87%), Postives = 149/366 (40.71%), Query Frame = 3
Query: 4053 CSQFADCDPWNERCVCQSGYIGNGFT-CTKI-----INCVTKCHVNGFCEN--QECKCLPGLIGDGI---NFCFDC----STCDINAFCEPFNERCVCSVGFTGNGKKC-SILAPITCKRACHKKAKCVKGK-CECLPGLRGDG---VQSCFDC----SICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEK--CHPNAKCV-NRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCFDCRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCH---RNAVCIN----QNCVCIPEYIGDGIN 5048
            C   A C+     C+C+ G+IG+G T C+K      I+  + C     C+N  + C+C  G IGDG        DC    + C   A C+  N RC C  GFTG+G KC SI    +    C   A CV G  C+C PG  G+G   V    DC     IC  N VC  +  +C C+ G+ G+G +CF      T+K  C  NA C+    C C     GD    C +  S  P      +QQ+ S  S  V              P      +C++G+C C+SG                         RR    SG E     C  I EC+ K H   R A C N      C C   ++GDGI 
Sbjct: 2107 CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQ--NRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEP-----ANQQDLSDVSSCV-------------TPCDSSTQLCISGECICKSGF------------------------RRNSTLSGSE----TCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGIT 2424          

HSP 12 Score: 81.2629 bits (199), Expect = 2.111e-14
Identity = 154/584 (26.37%), Postives = 229/584 (39.21%), Query Frame = 3
Query: 3921 NNCSIISARC--HPECGVNAQC--INGKCECLAGLQGNPFQQ-CFDCKRCSQF-ADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCST--CDINAFC--EPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDC--------SICDNNTVCYPDQE---------------KCVCNPGYYGDGTTCFLFSQLCTEK--CHPNAKCVNR----KCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGD-GKICTLRADICRPTCGENAICVNGQCQCQSGLQ-GNPLKHCFD----------CRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECS---PKCHRNAVCINQ----NCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCE------PSCGE---NAKCVNGKCECL--PGLQGNPLQHCFNCKRCDKFADC-DVWNKK--CVCKNGYMGNGLTCISVNGCNNKC---DSNALCVNR----HCICLPGF 5435
            N+ S+ + +C    ECG++A C    G C C  G +G P ++ C D   C+    +C   +E   CQ+ Y+G G+ C              FC     K   G   D I+ C + ++  C  NA C  +P    C C  GF G+G +C       C      K+ C +    C      DG   C +C         +C++   C  ++                 C C  GY GDG  C   ++ C E+  CHP+A+C N     KC+C+    GDG+  C N           P ++ C    +F G    +  L   I   +       ++  C+C+ G +       C D          C P  +  V    + RC C  G+EG+G  C  I EC      C   A+CIN+     C C+  Y GDG   C            EP +++  C   ++     C   + +C       P CG        +NG C+ L   GL       C     C+K A+C D+      C C +G++G+G+ C  V+ CNN     D N  C N     +C+CL GF
Sbjct: 1388 NDSSVENTKCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNC---HESARCQN-YVG-GYAC--------------FCPTGFRKADDGSCQD-IDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTV-DGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINE-CDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDVEKFCGRVDHVSCLSVRIYNGS-------LSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGAT-CIKIEE-------EPKSDKTACTDEWS---RLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGL-------CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGF 1913          

HSP 13 Score: 80.4925 bits (197), Expect = 4.128e-14
Identity = 107/337 (31.75%), Postives = 139/337 (41.25%), Query Frame = 3
Query: 3063 SCHLNAKCIPRQNTCECNSGFHGDGI---------QCKLLPLCTPACHPQASCING--NCKCNNNLIGDGI------SSCFDCDK-CSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQS-----CHKLAVCKEG-TCKCSNGLTGDG---VNFCFNC----SLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDC---SSRCGENAFCY-NGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLS----NLIGDGTTYCFNCSSCA-------RNSDCKPE--QQTCTCKRGYVKDGNNC 3929
            +CH  A C      C C  GF GDG           C  LP     C  +A C N   +C+C+   IGDG         C   D  CS  A C   N+RC C PG+ G+G+KCV    ++     C   A C  G TCKC+ G  G+G   V    +C     +C  NA C     +C+C   F G+G +C  +  C    S C +NA C   G+C C+ GF+G+P   C    V   PA     +    C+        TPC  S      CI G C C S    N    G+  C +   CA       R + C+       CTC  G+V DG  C
Sbjct: 2106 TCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSL---CADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVC--QNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSL-VSKEPANQQDLSDVSSCV--------TPCDSSTQ---LCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2425          

HSP 14 Score: 79.7221 bits (195), Expect = 7.360e-14
Identity = 103/373 (27.61%), Postives = 134/373 (35.92%), Query Frame = 3
Query: 5679 CHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQP-VLCTSKCHKNAKCLKGNCECLPGFVGDGI------QVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPK--CHSNAL-RVNQQCICLPGFIGD--------------GKNFCFDCSTCPPNSDCLPQ---EQRCICKKDYFMNDT-----QCIHTGRTPQCVPKCHHYASCV----QDKCECLPGFIGDGI 6689
            CH  A C+     C+C++G+ G+G        C+ K   +       CI LP             S C   + C    + C+C   Y  +  +CSP  Q  VL  + C   A C    C+CLPGF GDG+      +   NCS CD NA+C      C C P Y GNG  CV                               D +        C   A+C  +  +C C +GFSGNG  C       + K  C  NA+      CIC  GF GD               +    D S+C    D   Q      CICK  +  N T      C       +   KC   A+C        C C  G +GDGI
Sbjct: 2107 CHSLATCEQSTGVCICRDGFIGDG-----TTACSKKSTAD-------CISLP-------------SLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCV-GGTTCKCNPGYFGNGLCCVP------------------------------DPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGI 2423          

HSP 15 Score: 78.9518 bits (193), Expect = 1.055e-13
Identity = 97/343 (28.28%), Postives = 139/343 (40.52%), Query Frame = 3
Query: 2757 CCVEKCHEQAQCVD--GKCLCKPGFSGDGVETCFHCSQCD---------SNAICDQNNKACICKSGFEGNGINCL-RAINCKQK---CHKQARCLLGKCICNKGLNGNGV------EYCFNCTSCHLNAKCIPRQNTCECNSGFHGDGIQCKLLPL----CTPACHPQASCINGNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCV-----KTCFQSCHKLAVC-KEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDCSSRCGENAFCYNGTCKCKLGFQGNPL----EHCFDCRVCHYPAY 3680
            C    CH  A C    G C+C+ GF GDG   C   S  D           A CD + ++C C +G+ G+G  C     +C  +   C  +A C   +C C  G  G+GV      E   NC+ C  NA C+    TC+CN G+ G+G+ C   PL     T  CHP                               NA C+  +++C C  G+ GNG+ C      +T    C K A+C   G+C C +G  GD     + CS        L+++E     ++   D  +C    D S++      C +G C CK GF+ N      E C D   C   ++
Sbjct: 2102 CSTVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCV-GGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHP-------------------------------NAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPF---YKCS-------SLVSKEPAN--QQDLSDVSSCVTPCDSSTQ-----LCISGECICKSGFRRNSTLSGSETCADIDECAEKSH 2395          

HSP 16 Score: 78.9518 bits (193), Expect = 1.148e-13
Identity = 130/515 (25.24%), Postives = 189/515 (36.70%), Query Frame = 3
Query: 4764 CRPTCGENAICV----NGQCQCQSGLQGNP--LKHCFDC--RPCHSFAVCD--VENRRCICQSGFEGDGRNCKKIKECSPK----CHRNAVCIN----QNCVCIPEYI-----GDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIEL--------KCEPSCGENAKCVNGKCE------------------CLPGLQG----------------NPLQHCF-NCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNK---CDSNALCVNRHCICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKC-HKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCICLPG--FIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGDGIQVCFNCSTC 6092
            C+ TC     C+      QC C SG  G+   L+   +C   PCH  A C   + +  C C  G+EG+G  C  I ECS K    C  ++ CIN      C C   +      G G++ C + + C+  A    HN               C+A E+        KC   C    + ++GKCE                  C+  + G                 P   C  N   CD+ A C +    C CK GY G+G+TC  +N C+ K   C     C+N           DG   C       KN     ++  CI  +G              C  GCG+NA C N  C C+ G +G+P + C D  +C    + C     +CV     FG G+ C        +C + A   +   I   G  F   G +      +   +S            KD  +           + CTS C  N++C+ G CEC+ G+ G+ +  C +   C
Sbjct:   99 CQSTCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLEHPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGA----HN---------------CDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNL----------DGGYVCC------KNGQ---DDATCIKDQGAF------------CSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCV---NLFG-GFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELT------TSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDEC 553          

HSP 17 Score: 78.5666 bits (192), Expect = 1.716e-13
Identity = 100/348 (28.74%), Postives = 136/348 (39.08%), Query Frame = 3
Query: 7119 CDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSC---NTNCHKDALCFKDSCICKSGLSGDG------KNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLK--TTCQNDCHPNAV--RVNNCCRCKNGFFGDGFSFCF-------NCSNCSPNADCFPHLSKCQCKEEFTGNGF----------------ICQRKECKPACSEATSLCIKNQCFCRPGL-----IGDGYNCLDCRKCHEK-------ATC--NIRSMKCECLPGYIGNGFECI 8012
            C   A C  +   C CR G+ GDG        CS K         ++C  LP       S C + A+CD +         C C  G+ G+G  C      C   +  C  +A+C    C C  G +GDG           +C +CD NA C      C C P + G+G  C  +          CHPNAV    +  C+C +GF G+G S CF       + S C+ NA C P  S C C+  F G+ F                +     C   C  +T LCI  +C C+ G      +     C D  +C EK       ATC     S  C C  G++G+G  C+
Sbjct: 2107 CHSLATCEQSTGVCICRDGFIGDGTTA-----CSKKS-------TADCISLP-------SLCADKAKCDNST------RSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGG-TTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLPTGS-CICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCV 2426          

HSP 18 Score: 76.6406 bits (187), Expect = 6.397e-13
Identity = 99/347 (28.53%), Postives = 128/347 (36.89%), Query Frame = 3
Query: 7428 NCHKDALCFKDS--CICKSGLSGDGKNYC-----FDC----KRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQND--CHPNAVRVNNCCRCKNGFFGDGF------SFCFNCSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRK-CHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISK--------------LCINPNCQPPCHPKA-VCVKGKCIC----NRNLVGDGYQ-CRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRD 8348
             CH  A C + +  CIC+ G  GDG   C      DC      C   A C  + + C C   + GDG+ C+ + +     D  C P AV  N  C+C  GF GDG           NCS C  NA C    + C+C   + GNG  C                           + D  +C+     CH  A CN  S +C+C  G+ GNG  C    SC         N IC +    CIC      DP  K              L    +C  PC     +C+ G+CIC     RN    G + C   +EC   +        CR    S   +C C DG V D
Sbjct: 2106 TCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTT-CKCNPGYFGNGLCC---------------------------VPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAIC-LPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGS--HVCTCPDGHVGD 2421          

HSP 19 Score: 75.8702 bits (185), Expect = 8.871e-13
Identity = 82/256 (32.03%), Postives = 115/256 (44.92%), Query Frame = 3
Query: 6819 PPCAPGGF---CNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGF-----RCYPVILECPK-CHYRAQC--VIGKCQCKNGLQGDGINFCMNCSECD-KNAQCFPNF----SKCECRQGYRGDGKNCVKIDECSPKCHQ---NAVCIN-SNCHCLPMYTGNG---VSFCFNCAQ----CDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTN---CHKDALCF-KDSCICKSGLSGD 7493
            PP + GG+    N  + Q  S    +  + C   + C   A C  S   CIC  G+ GDG      +     +  P  C  +A+C      C+C  G  GDG     +  +C  ++  C P       +C+C  G+ GDG  CV I E +  C Q   NA C+  + C C P Y GNG   V    +C      C  NA+C  +   C C+ GF+GNG++C     SC T+   C K+A+C    SCIC+ G  GD
Sbjct: 2072 PPPSNGGYGEETNQEEEQVTSTTTTEAPSLCSTVT-CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFP-QKSCRTDKSVCAKNAICLPTGSCICRHGFKGD 2325          

HSP 20 Score: 75.0998 bits (183), Expect = 1.569e-12
Identity = 145/542 (26.75%), Postives = 206/542 (38.01%), Query Frame = 3
Query: 2847 CFHCSQCDSNAICDQNNKACICKSGFEGN--GINCLRAINCK---QKCHKQARC--LLG--KCICNKGLNGNGVEYC--------FNCTSCHLNAKCI--PRQNTCECNSGFHGDGIQCKLLPLCTPACHPQAS----CINGNCKCNNNLIGDGISSCFDC---------------------DKCSMNARCDVSNQ--RCICQPGYEGNGIKC--VKTCFQS--CHKLAVCK--EGT--CKCSNGLTGDGVNFCFNCSLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDCSSRCGENAFCYNGT----CKCKLGFQGNPLEH-CFDCRVCHYPA-YCDIPNRKCICITEN-----------------DIFSRTPCSFSCHPNAKCIKGR----CRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQTCTCKRGYVK----DGNNCSIISARCHPECGV---NAQCINGKCECL--AGLQGNPFQQCFDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKC 4202
            C    +C  +A+C++    C C+ GFEG     +C+    C      CH+ ARC   +G   C C  G        C         N T C  NAKC+  P   +CEC +GF GDG QC  +P     C    S    C   N  C  + + DG   C +C                       CS+NA C   N    C C+ GY G+G  C  +  C +   CH  A C   EG+  C+C +G  GDG+  C N             E  CE +E+F G      D V C S        YNG+    C+C+ GF+     + C D   C      CD  +  C+    +                 DI         C   A CI       C+C++   GDG T C            +P+     C   + +    +   C++      P+CG        ING C+ L  +GL      Q  DC + ++  D  P +  C C  G+IG+G  C    + V +C+  G C+++  KC
Sbjct: 1397 CTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQC--VPTTKKPCDSTQSSKSHCSESNMSCEVDTV-DGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDVEKFCGR----VDHVSCLS-----VRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGAT-CIKIEE-------EPKSDKTACTDEWSRLCELEKKQCTVDEEEV-PQCGACLPGHHPINGTCQSLQISGL----CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMIC----DDVDECNNAGMCDDENTKC 1898          

HSP 21 Score: 75.0998 bits (183), Expect = 1.663e-12
Identity = 114/405 (28.15%), Postives = 150/405 (37.04%), Query Frame = 3
Query: 7833 ACSEATSLCIKNQCFCRPGLIGDGYNC------LDC----RKCHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICNRNLVGDGYQCRAPEE-------CNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKP------ACNGACHSKAVCVKSSNLESR-CLCLPGFVGDGMT-----TC-TDCSGCDKNAICTEKQGCICKSGFIGDGR---QCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPC-AKNAVCIYQKCECLPGLVGN----GFIKCTNCSECHKK-------ALCHDQRG---CVCSHGYSGDGIQC 8903
             C ++T +CI     CR G IGDG          DC      C +KA C+  +  CEC  GYIG+G+ C          DC+  + +C+                               P+AVC   +C C     GDG +C +  E       C+ +A CV                CKC  G   +  G C  P         G CH  AVC    N ESR C C  GF G+G++     +C TD S C KNAIC     CIC+ GF GD       +V  E A+  D + +                                 SC+ PC +   +CI  +C C  G   N    G   C +  EC +K       A C +  G   C C  G+ GDGI C
Sbjct: 2112 TCEQSTGVCI-----CRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVC-----SPHPQDCVLRDNLCS-------------------------------PEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVG------------GTTCKCNPGYFGN--GLCCVPDPLDCVHFTGICHPNAVC----NSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVS--------------------------------SCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2425          

HSP 22 Score: 71.633 bits (174), Expect = 1.798e-11
Identity = 106/388 (27.32%), Postives = 155/388 (39.95%), Query Frame = 3
Query: 3366 SCHKLAVCKE--GTCKCSNGLTGDGVNFCFN---------CSLCDKNAKCLINEEKCECMERFEGDGFTC----QDKVDCSSRCGENAFCYNGTCKCKLGFQGNPL------EHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPC-----------SFSCHPNAKC--IKGRCRCLSNLIGDGTTYCF-------NCSSCARNSDCKPEQQTCTCKRGYVKDG-NNCSIISAR-------------CHPECGVNAQ-CINGKCECLAGLQGNPF----QQCFDCKRCSQFA-DCDP--------WNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCSTCDINA--FCEPFNERCVCSVGFT 4316
            +CH LA C++  G C C +G  GDG   C            SLC   AKC  +   CEC   + GDG+ C    QD V   + C   A C N  C+C  GF G+ +      E   +C  C   A+C +    C C      F    C           +  CHPNA C     +C+C S   G+G + CF       + S CA+N+ C P   +C C+ G+  D    CS + ++             C   C  + Q CI+G+C C +G + N      + C D   C++ +  CD          +  C C  G++G+G TC   +N   +  ++ +CE            DG+       T D     F +   E   CS  F+
Sbjct: 2106 TCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHC-VGGTTCKC--NPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVS-CFPQKSCRTDKSVCAKNAICLP-TGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCVPHVN---QGKLSVYCE-----------ADGMTLVLGNETADFEGKIFVKGQAENPYCSKSFS 2474          

HSP 23 Score: 69.3218 bits (168), Expect = 9.214e-11
Identity = 141/564 (25.00%), Postives = 204/564 (36.17%), Query Frame = 3
Query: 2532 ETF-LPKGNCFPPCANHAICTVENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDKTNGYCKCRYGFFGDGFTCNKTCCVE---------KCHEQAQC---VDG-KCLCKPGFSGDGVETCFHCSQC-DSNAICDQNNKACI---------CKSGFEGNGINCLRAIN--CKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTS---------------------CHLNAKCIPRQNT--CECNSGFHGDGIQCKLLPLCTP--ACHPQASCINGN----CKCNNNLIGDGIS--------SCFDCDK----------CSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEE---KCECMERFEGDGFTCQDKVDCS---SRCGENAFCYNGT----CKCKLGFQGNPL-------EHCFDCRVC--HYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGDGTTYCFNCSSCARNSDC---KPEQQTCTCKRGYVKDGNNCSII 3938
            +TF LP      P AN +  +VENT             KC     +C  D+ C++  G C+C  GF G      K  CV+          CHE A+C   V G  C C  GF      +C    +C + N+ C   N  C+         C++GF G+G  C+      C      ++ C      C        VE C  C                       C LNA C+    T  C C  G+ GDG  C  +  C     CHP A C N      C+C++   GDGI         SC D +K           S+       +  C C+PG+        +    SC  +  C+E                    + CD  +   +N E   +CEC E +EG+G  C D  +C    + C   A C N      CKC  G+ G+         E   D   C   +   C++  ++C    E       P   +C P    I G C+ L  + G     C   + C ++++C    P+   C+C  G++ DG  C  +
Sbjct: 1373 DTFALPTTTTGAPQANDS--SVENT-------------KC-TSSDECGLDALCERRTGVCRCEPGFEG---APPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVE-CKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFR------FEKESNSCVDIDECEESR------------------NNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEE-----EVPQCGACLPGHHPINGTCQSL-QISG----LCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDV 1882          

HSP 24 Score: 68.1662 bits (165), Expect = 2.060e-10
Identity = 106/392 (27.04%), Postives = 143/392 (36.48%), Query Frame = 3
Query: 6255 GFSGDGIKTCFNCSS---------CSIEAICVPDQEKCICKAGFSGNGEQCVENIEG---SSPKCHSNALRVNQQCICLPGFIGDG------KNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGDGIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGF-RCYPVILECPK--------------CHYRAQ-CVIGKCQCKNGLQGD----GINFCMNCSE-------CDKNAQCFPNFSK--CECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGN 7289
            GF GDG   C   S+         C+ +A C      C C AG+ G+G  C  + +        C   A+  N++C CLPGF GDG           +CS C  N+ C+     C C   YF N                      CV D  +C+  F G           C PNA C  E ++C C +GF GNG             C P   C   K                  S C  NA C P+   CIC  G+KGD F +C  ++ + P               C    Q C+ G+C CK+G + +    G   C +  E       CD+ A C   F    C C  G+ GDG  CV      P  +Q  + +      + +  GN
Sbjct: 2125 GFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGG-TTCKCNPGYFGNG-------------------LCCVPDPLDCV-HFTG----------ICHPNAVCNSESRQCQCSSGFSGNGVS-----------CFPQKSCRTDK------------------SVCAKNAICLPT-GSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITCV------PHVNQGKLSVYCEADGMTLVLGN 2449          

HSP 25 Score: 68.1662 bits (165), Expect = 2.297e-10
Identity = 74/234 (31.62%), Postives = 107/234 (45.73%), Query Frame = 3
Query: 8385 ACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCD---KNAICTEK-------QGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGI---QKCQCSQGFKLLNGKC----EPLSCIYPCAKNAVCIY-QKCECLPGLVGNGF------IKCTNCSE-CHKKALCHDQ-RGCVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSF 9008
             CHS A C +S+ +   C+C  GF+GDG T C+  S  D     ++C +K       + C C +G+IGDG  C          DC     R + C  S E +   ++CQC  GF     KC    E  S    C  NA C+    C+C PG  GNG       + C + +  CH  A+C+ + R C CS G+SG+G+ C  +  C  +      N IC+ +      C+C+  F
Sbjct: 2106 TCHSLATCEQSTGV---CICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVC-----SPHPQDCVL---RDNLC--SPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPT----GSCICRHGF 2322          

HSP 26 Score: 66.6254 bits (161), Expect = 5.679e-10
Identity = 111/403 (27.54%), Postives = 159/403 (39.45%), Query Frame = 3
Query: 6282 CFNCSSCSIEAICVPDQEKCICKAGFSGN--GEQCVENIE--GSSPKCHSNALRVNQ----QCICLPGFIGDGKNFCFDCSTCP--------PNSDCL--PQEQRCICKKDYFMNDTQCIHTGRTP---QCVPKCH---HYASCVQDKC-------ECLPGFIGDG-----IKFCF-KCSSCDPNADCVPEQQ--KCVCKTGFYGNGNKCDKIESTCEP-PCAPGGFCNNS----KCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGY--KGDGFRCYPVILECPKCHYRAQCVIGKCQCKNGLQGDG-INFCMNCSECDKNA-QCFPNFS---------KCECRQGYRGDGKNCVKIDECS---PKCHQNAVCINS----NCHCLPMYTGNGVS 7298
            C +   C ++A+C      C C+ GF G    + CV+  E       CH +A   N      C C  GF       C D   C          N+ C+  P    C C+  +  +  QC+ T + P       K H      SC  D         EC+ G+   G     I  C  + + C  NA+CV       C CK G+ G+G  C  I    E  PC P   C N     KC+C+SG +GDG+  C N           P  + C  V  +  + D   C  V +      Y    +   C+C+ G + +   N C++  EC+++   C P  +         +CEC +GY G+G  C  IDEC      C   A+CIN      C C+  YTG+G +
Sbjct: 1397 CTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDVEKFCGRVDHVSCLSVRI------YNGS-LSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGAT 1781          

HSP 27 Score: 66.6254 bits (161), Expect = 6.073e-10
Identity = 117/465 (25.16%), Postives = 170/465 (36.56%), Query Frame = 3
Query: 2961 CKQKCHKQARCLLG----KCICNKGLNGNGVEY-----CFNCTSCHLNAKCIPRQNT-----CECNSGFHGDGIQCKLLPLC----TPACHPQASCIN--GNCKCN-------NNLIGDGISSCFDCDKCSMNAR-CD--------VSNQRCI--CQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTG-----------DGVN-----FCF-NCSLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDCSSR----------------------------------------CGENAFCYNGTCKCKLGFQGNPLEHCFDCRVC-HYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCI-KGRCRCLSNLIGDGTTYCFNCSSCARNSDC--KPEQQTCTCKRGYV-KDGNNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFDCKRC 4055
            C+  C  +  CL      +C C+ G +G+  E      C     CH+ A+C   QNT     C C  G+ G+G +C  +  C    T  C   + CIN  G   CN           G G+  C D ++C   A  CD        + + +C+  C PGYE    KC         KL  C +    C N + G           DG N      C  N ++CD++A C I  + C+C   + GDG TC D  +C ++                                        CG+NA C N TC C  GF+G+P + C D   C    + C     +C+     ++F    C       A+C  +      S +   G  +          S         + T  RG + KD    +     C   C  N++C+ G CEC++G  GN    C D   C
Sbjct:   99 CQSTCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLE-HPCHMMAQC---QNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKC-DVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCV-----NLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDEC 553          

HSP 28 Score: 65.4698 bits (158), Expect = 1.540e-9
Identity = 115/394 (29.19%), Postives = 148/394 (37.56%), Query Frame = 3
Query: 9246 EKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALC--VIGTCKCPPSFKGNGYSGC-----FDC----SKCHANADCDES-KGCTCKPGFEGNGCYCRPEDK-CKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPV----QCDKNAVCLS-NNCVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICITQT--CYCVPGYFGDGI-----KSC-TSCSVCHKNAQCLPDRGCVCKSDFIGDGF-NCRPL--DECRINEDCRDPNKMCLLNPSMKNL----QCTCKPLHILINNYCLP--------KECTSKCHK---NAKCE----GGMCQCLSGFIGDGINC 10283
            E+++    Q+    +  A S C  +     CH  A C    G C C   F G+G + C      DC    S C   A CD S + C C  G+ G+G  C P  + C    +   P  +C      +R C C PG T     KC+ +        QCD NA C+    C C  GY G GL C P+                         CV   G                CH  A+C +++  C C  G+ G+G+     KSC T  SVC KNA CLP   C+C+  F GD F  C  L   E    +D  D +       S   L    +C CK       N  L          EC  K HK    A C       +C C  G +GDGI C
Sbjct: 2081 EETNQEEEQVTSTTTTEAPSLCSTV----TCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVC-----QNRRCQCLPGFT-GDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDP----------------------LDCVHFTGI---------------CHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICK--SGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGITC 2425          

HSP 29 Score: 65.4698 bits (158), Expect = 1.579e-9
Identity = 142/586 (24.23%), Postives = 203/586 (34.64%), Query Frame = 3
Query: 7101 CMNCSECDKNAQCFPNFSKCECRQGYRGD--GKNCVKIDECSP---KCHQNAVCINSNCHCLPMYTGNGVSFC--------------------FNCAQCDANAIC--KPDENLCVCAQGFTGNGITC-KAIDPSCNTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNC--CRCKNGFFGDGFSFCFNCSNCSPNADCFPHLS--------KCQCKEEFTGNGFICQRKECKPACSEATSLC-----------------IKNQCFCRPGLI--GDGYNCLDCRKCHEK--------ATC--NIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICNRNLVGDGYQC-RAPEECNNDAD---------CVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSK------AVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAICTEKQ----------GCICKSGFIGDGRQCIV 8579
            C +  EC  +A C      C C  G+ G    K+CV +DEC+     CH++A C N        Y G    FC                     N   C ANA C  KP    C C  GF G+G  C       C++     + C + +  C+     D  +   +CK C      + + + C    E   +   C+LN           N V +N    C CK G+ GDGF  C + + C     C PH          KC+C   F G+G        + +C +    C                 + + C C PG     +  +C+D  +C E         A C     S +CEC  GY G G  C  I             + C+  ++ C   A         +CIN            C    C C     GDG  C +  EE  +D           C   ++ C  D+  + +   C  G    + G CQ    +G C  K      A C+        C C  GF+GDGM  C D   C+   +C ++            C+C  GF     +C+V
Sbjct: 1397 CTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQN--------YVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEV----DTVDGSVECKEC--MGGYKKSGKVCEDINECVAEKAPCSLNA----------NCVNMNGTFSCSCKQGYRGDGF-MCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDI-------------DECDRGMAGCDSMA---------MCIN--------RMGSC---GCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGH-HPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGM-ICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCVV 1922          

HSP 30 Score: 62.3882 bits (150), Expect = 1.210e-8
Identity = 132/514 (25.68%), Postives = 194/514 (37.74%), Query Frame = 3
Query: 3243 SSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIK--CV-----KTCFQSCHKLAVCKE----GTCKCSNGL--TGDG----VNFC--FNCSLCDKNAKCL--INEEKCECMERFEGDGFTC--QDKVDCSSRCGENAFCYNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITEND-IFSRTPCSFSCHPNAKCIKG----RCRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQ--------TCTCKRGYVKDG---------NNCSIISARC----HPECGVNAQCINGK----CECLAGLQ-GNPFQQCFDCKRCSQFA-DCDPWNE---------RCVCQSGYIGNGFTCTKIINC---VTKCHVNGFCENQE----CKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCSVGFTG----NGKKCSILAPITCK-RACHKKAKCVKGKCECL--PGLRGDGVQSCFDCSICDNNTVC---YPDQEKCVCNPGYYGDGTTC 4541
            + C   D+C ++A C+     C C+PG+EG   K  CV      T   +CH+ A C+       C C  G     DG    ++ C   N + C  NAKC+       CEC   F GDG+ C    K  C S     + C      C++    + ++   +C+ C             +C   N+ +  + PCS     NA C+       C C     GDG   C + + C     C P  +         C C  G+  DG          +C  +   C    H  C ++ +  NG     CEC  G +       C D   C +   +CDP +          RC C  GY G G  CT I  C   +  C     C N+     CKC+ G  GDG       +TC I    EP +++  C+  ++       K+C++      +  AC      + G C+ L   GL       C   + C+ +  C   +PD   C C  G+ GDG  C
Sbjct: 1395 TKCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEV----DTVDGSVECKEC----MGGYKKSGKVCEDINECVAEKAPCSL----NANCVNMNGTFSCSCKQGYRGDG-FMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSC-LSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDG-------ATC-IKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGL-------CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMIC 1879          

HSP 31 Score: 61.6178 bits (148), Expect = 2.051e-8
Identity = 168/646 (26.01%), Postives = 223/646 (34.52%), Query Frame = 3
Query: 5052 CFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYM-GNGLTCISVNGCNNK----CDSNALCVNR----HCICLPGFTGDGTRFCFDCSSCP------KNSNCLPEEQKC------------ICQEGYIMNGAKCQPI---VHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLK--CNENALCVNQ----KCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGDG-IQVCFNCSTCDKNA-NCFPYQE---------RCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICK--AGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPK--CHHYASCVQDK-----CECLPGFIGDGIKFCFKCSSCDPNADCVPEQQK---------CVCKTGFYGNGNKC 6794
            C +   C  +A CE     C C  GF G            + SC +  +C  G              +C    RC  +    V    C C  G+   +  +C  ++ C       C +NA CVN+     C C  GF GDG + C   +  P        S+C      C             C  GY  +G  C+ I   V E  P C  NA CVN             M   F C                 CK GY G+G+MCT IN C+ +  C+ +A C N     KC C  GF GDGIK C +           P ++ C+        EK C  +   V C S    N   L   CEC PGF  +     C +   C+++  NC P            RC C   Y G G  C  I                     +C +G +G           C   A+C+     C CK  AG++G+G  C++  E   PK    A       +C      + K    D    P    CLP          + +N T C     +  C  K  C+ +A C+        C C  GFIGDG+  C     C+    C  E  K         CVC  GF     KC
Sbjct: 1397 CTSSDECGLDALCERRTGVCRCEPGFEG---------APPKKSCVDVDECATGD------------HNCHESARCQNY----VGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQ-CVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAP-CSLNANCVN-------------MNGTFSCS----------------CKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTN-----------PLERSCEDV------EKFCGRVDH-VSCLSVRIYNGS-LSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDI--------------------DECDRGMAG-----------CDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEE--EPKSDKTACTDEWSRLCEL----EKKQCTVDEEEVPQCGACLPGH--------HPINGT-CQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGM-ICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKC 1920          

HSP 32 Score: 61.6178 bits (148), Expect = 2.139e-8
Identity = 139/551 (25.23%), Postives = 202/551 (36.66%), Query Frame = 3
Query: 9159 DCKYENQECVAR----LDS-----SLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALC--VIG--TCKCPPSFKGNGYSGCFDCSKCH--------ANADCDESKG---CTCKPGFEGNGCYCRPEDK------CKFNSDCNDPLKIC-VQSPDTSRNC------VCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNN----CVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQ-DDNGKCS---PKECQP--------------KCHMFAICITQTCYCVPGY-FGDGIKSCTSCSVCHKN--------AQCLPDRG---CVCKSDFIGDGFNCRPLDEC------------------------------------RINEDCRDPNKMCLLNPS----MKNLQCT-----------CKPLHILINNYCLPKECT------SKCHKNAKC-----EGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKC 10412
            D   EN +C +     LD+     + +C C+ GF+    K S V+              C   D N  CH SA C   +G   C CP  F+      C D  +C         ANA C    G   C C+ GF G+G  C P  K          S C++    C V + D S  C        K G       +C+    P  C  NA C++ N    C CK GY G G  C   ++C +   C  P++ C  + + + KC C  GF+ D   KC+    + C+                  ++   ++  C C PG+ F     SC     C ++        A C+   G   C C   + G+G  C  +DEC                                    +I E+ +     C    S    ++  QCT           C P H  IN  C   + +      + C+K+A+C     +   C C  GFIGDG+ C    EC     C D+ + C+ T     F CVC+ GF+ ++ KC
Sbjct: 1389 DSSVENTKCTSSDECGLDALCERRTGVCRCEPGFEGAPPKKSCVD-----------VDECATGDHN--CHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAP--CSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPC-HPHAECTNL-EGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENT--IGSFNCVCLEGFKKVDEKC 1920          

HSP 33 Score: 61.2326 bits (147), Expect = 2.821e-8
Identity = 98/347 (28.24%), Postives = 140/347 (40.35%), Query Frame = 3
Query: 8496 CDKNAICTEKQG---CICKSGFIGDGRQCIVLNECAD------NSDCTTIRGR-----------------ASECIRSSEGIQK-----------------------CQCSQGFKLLNGKCEPLSC--IYPCAK--------NAVCI----YQKCECLPGLVGNGFIKCTNCSECHK-------KALCHDQR---GCVCSHGYSGDGIQC-RIEDQC-SLNSDCTD--------PNKICITSTDTVKRC-VCKSSFISSNSGCVPLT----CLSK--CHKYANC-----ENGVCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEK 9251
            C  NA C    G   C CK G+ GDG  C  +NEC +      +++CT + G                   +   RS E ++K                       C+C  GF+    + E  SC  I  C +        +AVC+      +CEC  G  G G + CT+  EC +        A+C ++    GC C  GY+GDG  C +IE++  S  + CTD          K C    + V +C  C       N  C  L     C  K  C+K+A C     ++  C C  G++GDG+IC   DEC ++  C  EN +C   +  S  C C  GF+   EK
Sbjct: 1578 CSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRF---EKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGV-CTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTI-GSFNCVCLEGFKKVDEK 1919          

HSP 34 Score: 60.077 bits (144), Expect = 5.608e-8
Identity = 110/453 (24.28%), Postives = 155/453 (34.22%), Query Frame = 3
Query: 4089 RCVCQSGYIGNGFTCTKIINCVTKCHVNGFC-ENQECKCLPGLI--------------GDGINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSC---FDC--------------------------------SICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEK---CHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCFDCRPC-HSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCI--PEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLT-CNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRC 5276
             C C  GY GNG  CT I  C  K  +   C E+ +C  LPG                G G++ C D + C+  A     +E C  S+G               C   C    + + GKCE +     + +  C    DC                                +ICD +  C+   + C C  GY GDG TC   ++ C  K   C    +C+N           DG   C  C +   DA C  DQ                      C   CG+NAIC N  C C  G +G+P K C D   C  + +VC     RC+   G    G  C +      +C   A   + + +     ++   G        S   ++         T  +G     +    +  L C   C  N++CV G CEC+ G  GN L  C +   C
Sbjct:  156 ECRCLPGYEGNGHECTDIDECSDK--LTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGS------------FKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINE-CDAKDTPCSDGGRCLNL----------DGGYVC--CKNGQDDATCIKDQ-------------------GAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCVNLFG----GFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSS-----GGSITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDEC 553          

HSP 35 Score: 59.3066 bits (142), Expect = 1.115e-7
Identity = 84/285 (29.47%), Postives = 120/285 (42.11%), Query Frame = 3
Query: 10788 CVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVF-QCIEETCPN--KCHNFAYC-RQKVCQCRLGFQGDGV------FNC-HDCSVCHPNAIC-SPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFN----NSLCYPIP-----------CVKQCDRNEE-CLFGQCQCKPGFIHNS----NKTCVEPNDCDV-----NNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIP 11531
            C C  GY    +G  CSP  H Q   DC   ++ C    + Q +RC C  GF    V    I E   N  +C   A+C     C+C  G+ G+G+       +C H   +CHPNA+C S S  C C      G+G SC P+  CR D      NA+C  T     C C+ G+        +SL    P           CV  CD + + C+ G+C CK GF  NS    ++TC + ++C       +  A+C++             +C C  G +     C+P
Sbjct: 2162 CECDAGYIG--DGYVCSP--HPQ---DCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQCQCSS-GFSGNGVSCFPQKSCRTDKSVCAKNAICLPTG---SCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTF--------GSHVCTCPDGHVGDGITCVP 2427          

HSP 36 Score: 58.9214 bits (141), Expect = 1.212e-7
Identity = 127/513 (24.76%), Postives = 181/513 (35.28%), Query Frame = 3
Query: 7863 KNQCFCRPGLIG------DGYNCLDCRKCHEKATC--NIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICN-------RNLVGDGY-QCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGA-----CHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKN-AICTEKQG-------CICKSGFIGDGRQCIVLNE-------CADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSG------DGIQCRIEDQC---------SLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVP----------LTCLSKCHKYANCENGVCKCILGYVGDGII-CRLPDECKSSLDCKYENQECVARLDSSLMC 9215
            K QC+C  G  G      D   CL+   CH  A C   + S +C CLPGY GNG EC  I  C+                           D ++  C       P H K + + G   CN       +   G G  +C    EC   A      E+C     S K + KC  G    + G+C+     G+     C  +A CV +  +                 C   S C KN AIC            C CK+G+ GDG  C  +NE       C+D   C  + G    C ++ +    C   QG            C   C  NA+C    C C+ G  G+   KC + +EC +        G  C + + G         +    DQ          S  +D T   +  I  + +++     S  I+   G +P          L C S C   + C  G C+C+ GY G+ ++ C   DEC + + C  E  E    L    +C
Sbjct:  115 KPQCYCDSGFSGSACELQDKNECLE-HPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECS---------------------------DKLTSRC-------PEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYEL-IDGKCEDVNECGSEKLHKCDVRADCVNT--IGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDG-GYVCCKNGQDDATCIKDQG----------AFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCVNLFGGFKCCQHGSTEAECTDQAFSSDSSTISSHGADFTTTGEQIIEGSGSIQTSSGGS--ITVTRGLIPKDVELTTSGRLACTSYCPPNSECVGGYCECVSGYGGNALVGCEDIDECITEI-CNIEANEWCVNLIGGFVC 575          

HSP 37 Score: 58.5362 bits (140), Expect = 1.546e-7
Identity = 146/603 (24.21%), Postives = 236/603 (39.14%), Query Frame = 3
Query: 10602 CQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFS--------LENSLCSPIACRPKCGKNSQCQLGV----CVCKDGYSPSVNGLSCSPIDHCQSEND-CPDSNHKCVYH-GLFQGKRCMCRKGFIPKSVFQCIEET---CPNKCHNFAYCRQKVCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEEC--------LFG--QCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPINCYQPCHKNAYCNIGVCTCNPDYIGDGIT-SCKKKNLCLED-SDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIA----KKCLLPCDPNAVCV--LGECICK--VGFTGNGLQCMPTSKCNPLS---GCSDTNSVCIQ-------VPPTNYYDC-MCKPGY--IKSS--NLSICKPIVCEPSCHPKAACI-----IGSCICMKPLIGNGITECKLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVN 12239
            C + D+C  D+ C  R   C          +C+PGF         ++   C+       C ++++CQ  V    C C  G+  + +G SC  ID C   N  C  +N KCV   G +    C C  GF+    +QC+  T   C +   + ++C +    C +    DG   C +C   +  +                  G+ C+  ++C  +      NA C     +  C CK GY + +  +C  I    +CD    C        L G  +C+C  GF  +  K C  P +       SC+   + C              G ++    C+ +  Y     +      VC C P +  +  + SC   + C E  ++C    + C+     Y C+C  GYE +   C       + +  CD  A+C+  +G C CK   G+TG+G  C+   +  P S    C+D  S   +       V       C  C PG+  I  +  +L I      +  C+  A CI        C C    IG+G+  C   DEC+ +  C ++N  C+N T G   C+C  GF+  + KC+  ++ + N
Sbjct: 1397 CTSSDECGLDALCERRTGVC----------RCEPGFEGAPPKKSCVDVDECA--TGDHNCHESARCQNYVGGYACFCPTGFRKADDG-SCQDIDECTEHNSTCCGANAKCVNKPGTYS---CECENGFLGDG-YQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTV-DGSVECKECMGGYKKS------------------GKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGY-RGDGFMCTDI---NECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLE------RSCEDVEKFC--------------GRVDHV-SCLSVRIYNGSLSS------VCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEE-EPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMI-CDDVDECNNAGMCDDENTKCEN-TIGSFNCVCLEGFKKVDEKCVVDEKKQPN 1929          

HSP 38 Score: 58.5362 bits (140), Expect = 1.639e-7
Identity = 98/348 (28.16%), Postives = 147/348 (42.24%), Query Frame = 3
Query: 9054 CHKYANCE--NGVCKCILGYVGDGIICRLPDEC--KSSLDCKYENQECVARL---DSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGNG------YSGCFDCSKCHANADCDESKGCTCKPGFEGNGCYCRPE--DKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQ---------CDKNAVCL-SNNCVCKTGYSG-------TGLNCKPNDQ--CSQNSDCPEP-NSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQP---------KCHMFAICI----TQTCYCVPGYFGDGI 9953
            CH  A CE   GVC C  G++GDG        C  KS+ DC      C  +    +S+  C C +G+       S      +++ ++          C+P+    A+C    C+C P F G+G      +    +CS+C ANA C     C C PG+ GNG  C P+  D   F   C+ P  +C      SR C C  G   S NG    + C  Q         C KNA+CL + +C+C+ G+ G       + ++ +P +Q   S  S C  P +S  ++    + +C+C  GF+ ++     + C           KC   A C     +  C C  G+ GDGI
Sbjct: 2107 CHSLATCEQSTGVCICRDGFIGDGTTA-----CSKKSTADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNL----------CSPE----AVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICH-PNAVCNSE---SRQCQCSSGF--SGNG----VSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLC--ISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGHVGDGI 2423          

HSP 39 Score: 58.5362 bits (140), Expect = 1.955e-7
Identity = 159/702 (22.65%), Postives = 241/702 (34.33%), Query Frame = 3
Query: 6267 DGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALR-VNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRT--PQCVPKCHHYASCVQ-DKCECLPGFIGDGIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCD--------VNAKCF--PSVKKCICVIGYKGDGFRCYPVILE-CPKCHY-RAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPK---CHQNAVCINSN----CHCLPMYTGNGVSFCFNCAQCDANAICKPDE---NL-----CVCAQGFTGNGI---------TCKAIDPSCNTNCHKDALCFK-------DSCICKSGLSGDGK-NYCFDCKRCDQN--------AICRPTE--QRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFG-DGFSFCFN-CSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKP-----ACS-EATSLCI--KNQCF-----------CRPGLIGDGYNCL------------DCRKCHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQ--CIC 8093
            DG+    + ++  +           + ++G     +   E +E ++P     +      +   LP   G G++      T  P +   PQ +    +K     DT  + T  T  PQ          C   D+C  L          C     C+P  +  P ++ CV       + ++C   +  C        +     C C +G +     SC +  +C          NAKC   P    C C  G+ GDG++C P   + C      ++ C      C    + D ++  + C EC                 GY+  GK C  I+EC  +   C  NA C+N N    C C   Y G+G   C +  +CD    C P     NL     C C  GF G+GI         +C+ ++  C    H   L  +         C C+ G   + + N C D   C+++        A+C  TE   RC C   + G+G  C                    +   C  G  G D  + C N   +C            C+C   +TG+G  C + E +P     AC+ E + LC   K QC            C PG       C             DC K  E    +  S  C C  G+IG+G  C  +  C  +  C   N  C   I    C+C
Sbjct: 1273 DGVSPTSSATAPEVPTTSASSTPDAVEESGIPSTSKPTAEPLETTAPSTEVTSPEGSGTEESTLPPTEGSGESTTSSAPTVEPATVLPPQNRN---EKPEPTKDTFALPTTTTGAPQANDSSVENTKCTSSDEC-GLDALCERRTGVC----RCEPGFEGAPPKKSCV-------DVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSC----EVDTVDGSVECKEC---------------MGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGF-MCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCT-------------------DIDECDRGMAGCDSMAMCINRMGSCG-----------CKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCGACLPGHHPINGTCQSLQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDDVDECNNAGMCDDENTKCENTIGSFNCVC 1909          

HSP 40 Score: 57.7658 bits (138), Expect = 3.178e-7
Identity = 137/556 (24.64%), Postives = 210/556 (37.77%), Query Frame = 3
Query: 2235 CFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKSC---------DKICHKDALCQN----SRCICKPNFEGDGVNYCFDCSKCHKL--------AQC--HPKTGNCTCRPPYVGDGVS-------ECE-TFLPKGNCFPPCANHAICTVENTCQCRKNYYG--------NPLEKCNIDCSKCHTDSDCDKTNGY--CKCRYGFFGDGFTCNKTC-CVEK--CHEQAQC--VDG--KCLCKPGFSGDGVETCF------------------HCSQCDSNAICDQNNKACICKSG--FEGNGINCLRAINCKQKCH----KQARCLLG----KCICNKGLNGNG-----VEYC-FNCTSCHLNAKCIPRQNT--CECNSGFHGDGIQC---------------------------------KLLPLCTPACHPQASCINGNCKCNNNLIGDGISSCFDCDKCSMNARC-DV--SNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNC----SLCDKNAKCLINEEKCECMERFEGD 3530
            C    +C  +A C      C C PG+   G    KSC         D  CH+ A CQN      C C   F       C D  +C +         A+C   P T +C C   ++GDG          C+ T   K +C     +  + TV+ + +C++   G          + +C  + + C  +++C   NG   C C+ G+ GDGF C     C E+  CH  A+C  ++G  KC C  GF GDG++ C                   H S           +  C C+ G  FE    +C+    C++  +      A C+      +C C +G  G G     ++ C      C   A CI R  +  C+C +G+ GDG  C                                 + +P C  AC P    ING C+   +L   G+  C   + C+ +A C D+   +  C C  G+ G+G+ C       C+   +C +   KC N +        FNC         + KC+++E+K    E+ E D
Sbjct: 1397 CTSSDECGLDALCERRTGVCRCEPGF--EGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDECTEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTVDGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERHPCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFRFEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIKIEEEPKSDKTACTDEWSRLCELEKKQCTVDEEEVPQCG-ACLPGHHPINGTCQ---SLQISGL--CAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGMICDD--VDECNNAGMCDDENTKCENTI------GSFNCVCLEGFKKVDEKCVVDEKKQPNREKIEID 1936          

HSP 41 Score: 56.9954 bits (136), Expect = 5.714e-7
Identity = 89/331 (26.89%), Postives = 124/331 (37.46%), Query Frame = 3
Query: 5160 ELKCEPSCGENAKCV----NGKCECLPGLQGNP--LQHCFNCKR--CDKFADCD--VWNKKCVCKNGYMGNGLTCISVNGCNNK----CDSNALCVN----RHCICLPGFT-----GDGTRFCFDCSSCPKNS-NCLPEEQ--------KCI--CQEGYIMNGAKCQPI-------VHEC--RPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKK----CHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLK----------------------------------------CNENALCVNQKCICLPGFIGDGIKFCFDCSACPAN 5891
            E KC+ +C     C+      +C C  G  G+   LQ    C    C   A C   + + +C C  GY GNG  C  ++ C++K    C  ++ C+N     +C C  GFT     G G   C D + C   + NC  +E         KC+  C  GY +   KC+ +       +H+C  R  C         +CE      G   Q    C+K    C + A C +    C CK GY G+G  C  IN C+ K                                        C +NA+C N  C C+ GF GD  K C D + C  N
Sbjct:   96 EHKCQSTCSGKGACLYDGAKPQCYCDSGFSGSACELQDKNECLEHPCHMMAQCQNTLGSYECRCLPGYEGNGHECTDIDECSDKLTSRCPEHSKCINLPGTYYCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNLDGGYVCCKNGQDDATCIKDQGAFCSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVEN 426          

HSP 42 Score: 56.6102 bits (135), Expect = 7.472e-7
Identity = 79/272 (29.04%), Postives = 105/272 (38.60%), Query Frame = 3
Query: 11550 CHKNAYC--NIGVCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKS----NPYSCKCPSGYEIDNNKCIA--KKCLLP---CDPNAVCVLGECICKVGFTGNGLQCMPTSKCNPLSGCS--DTNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVC---EPSCHPKAACIIGSCICMKPLIGNGITECKLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVD-CPTRKICV-NSKCICPEQYTSSP 12311
            CH  A C  + GVC C   +IGDG T+C KK+     +DC  + S C  K+    +  SC+C +GY  D   C    + C+L    C P AVC    C C  GFTG+G++C+  S     S CS  D N+ C+         C C PGY  +    +  P+ C      CHP A C                                       NS   Q  C C  GF      C  ++ CR +   C    IC+    CIC   +   P
Sbjct: 2107 CHSLATCEQSTGVCICRDGFIGDGTTACSKKST----ADCISLPSLCADKAKCDNSTRSCECDAGYIGDGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVKCV--SIHERASNCSQCDANAHCV-----GGTTCKCNPGYFGNGLCCVPDPLDCVHFTGICHPNAVC---------------------------------------NSESRQ--CQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICLPTGSCICRHGFKGDP 2326          

HSP 43 Score: 55.8398 bits (133), Expect = 1.019e-6
Identity = 139/544 (25.55%), Postives = 208/544 (38.24%), Query Frame = 3
Query: 2064 AECYPEISKCKCKPGFVGSG-----YECREEVNCDIKCHENASC---VNGY-CKCNRNLIGDGINSCFDCLKCNTEADCS-----------PYENRCYCRPGYTGNGFTCI----KSCDKICHKDALCQNSRCICKPNFEGDGVNYCFDCSKCHK------------LAQCHP-----------KTGNCTCRPPYVGDG-----VSECETFLPKGNCFPPCANHAICT-VENT--CQCRKNYYGNPLEKCNIDCSKCHTDSD--CDKTN---------------GYCKCRYGFFGDGFTCNKTCCV--EKCHE--------QAQCVDG----KCLCKPGFSGDG-----VETCFH-CSQCDSNAICDQNNKACICK--SGFEGNGINCLRAINCKQKCHKQA-------RCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGN-----CKCNNNLIGDGISSCFDCDKCSMNARCDVSNQR---------CICQPGYEGNGIKCV 3350
            A C      C+C+PGF G+       +  E    D  CHE+A C   V GY C C          SC D  +C TE + +           P    C C  G+ G+G+ C+    K CD      + C  S   C+ +   DG   C +C   +K            +A+  P            T +C+C+  Y GDG     ++EC+          PC  HA CT +E +  C+C   + G+ ++KC     +   D +  C + +                 C+C  GF    F      CV  ++C E         A CV+     +C C  G+ G+G     ++ C    + CDS A+C     +C CK  +G+ G+G  C++ I  + K  K A        C L K  C   ++   V  C  C   H      P   TC+         +Q   L      C+  A CI+ +     C C +  IGDG+  C D D+C+    CD  N +         C+C  G++    KCV
Sbjct: 1407 ALCERRTGVCRCEPGFEGAPPKKSCVDVDECATGDHNCHESARCQNYVGGYACFCPTGFRKADDGSCQDIDEC-TEHNSTCCGANAKCVNKPGTYSCECENGFLGDGYQCVPTTKKPCDSTQSSKSHCSESNMSCEVDTV-DGSVECKECMGGYKKSGKVCEDINECVAEKAPCSLNANCVNMNGTFSCSCKQGYRGDGFMCTDINECDERH-------PCHPHAECTNLEGSFKCECHSGFEGDGIKKCTNPLERSCEDVEKFCGRVDHVSCLSVRIYNGSLSSVCECEPGFR---FEKESNSCVDIDECEESRNNCDPASAVCVNTEGSYRCECAEGYEGEGGVCTDIDECDRGMAGCDSMAMCINRMGSCGCKCMAGYTGDGATCIK-IEEEPKSDKTACTDEWSRLCELEKKQCT--VDEEEVPQCGACLPGHH-----PINGTCQS--------LQISGLCAQKNDCNKHAECIDIHPDSHFCSCPDGFIGDGM-ICDDVDECNNAGMCDDENTKCENTIGSFNCVCLEGFKKVDEKCV 1921          

HSP 44 Score: 55.4546 bits (132), Expect = 1.485e-6
Identity = 104/405 (25.68%), Postives = 151/405 (37.28%), Query Frame = 3
Query: 10200 TSKCHKNAKCE--GGMCQCLSGFIGDGINC---QRPFEC-GIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGDGIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLC---SPI-------ACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIE---------------ETCPNKCHNFA-YCRQKVCQCRLGFQGD----GVFNCHDCSVCHPN-------AICSPSLG---CTCPGPHLIGDGRSCKPK-DQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIK 11273
            T  CH  A CE   G+C C  GFIGDG      +   +C  + + C D+        D     C C  G+      C P P               CV +  L             C   AVC    C+C+PG+ G+G+ C +  +   +    D NA C  G      C+C PG+   N LC    P+        C P    NS+ +   C C  G+S   NG+SC P   C+++      N  C+  G      C+CR GF     ++C                  +C   C +    C    C C+ GF+ +    G   C D   C          A C  + G   CTCP  H +GDG +C P  +Q ++   C        L  ++   + K+ ++K
Sbjct: 2104 TVTCHSLATCEQSTGVCICRDGFIGDGTTACSKKSTADCISLPSLCADKAKC-----DNSTRSCECDAGYIGDGYVCSPHP-------------QDCVLRDNL-------------CSPEAVCQNRRCQCLPGFTGDGVKCVSIHERASNCSQCDANAHCVGGT----TCKCNPGY-FGNGLCCVPDPLDCVHFTGICHPNAVCNSESRQ--CQCSSGFSG--NGVSCFPQKSCRTDKSVCAKNAICLPTG-----SCICRHGFKGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRNTFGSHVCTCPDGH-VGDGITCVPHVNQGKLSVYCEADGMTLVLGNETADFEGKI-FVK 2461          

HSP 45 Score: 53.1434 bits (126), Expect = 6.827e-6
Identity = 98/353 (27.76%), Postives = 140/353 (39.66%), Query Frame = 3
Query: 6621 CHHYASCVQD----KCECLPGFIGDGIKFCFKCSSCDPNADCV----PEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAK-------CFPSVK--KCI--CVIGYKGDGFRCYPV----ILECPKCHYRAQCV--IG--KCQCKNGLQGDGIN-----FCM-NCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPK---CHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKRCDQN-AICRPTEQRCV 7568
            CH  A C       +C CLPG+ G+G     +C+  D  +D +    PE  KC+   G Y                     +CN ++     G +G G+  C + ++C+  A        C  S+   KC+  C  GY+    +C  V      +  KC  RA CV  IG  +C+C+ G +GDG N      C  N + CD++A C      C+C+ GY GDG  C  I+EC  K   C     C+N           +G   C    Q DA          C+  QG              C+  C  +A+C   +C C  G  GD    C D   C +N ++C     RCV
Sbjct:  142 CHMMAQCQNTLGSYECRCLPGYEGNG----HECTDIDECSDKLTSRCPEHSKCINLPGTY---------------------YCNCTQGFTPKGNQGSGLDKCADINECETGAHNCDADEICENSIGSFKCVNKCSPGYELIDGKCEDVNECGSEKLHKCDVRADCVNTIGGYECECEEGFEGDGKNCQPKSSCRKNSAICDRHASCHIVLDICDCKTGYTGDGITCHDINECDAKDTPCSDGGRCLNL----------DGGYVCCKNGQDDAT---------CIKDQGAF------------CSGGCGDNAICSNATCACIDGFRGDPHKKCVDINECVENDSVCGGVGDRCV 438          

HSP 46 Score: 52.7582 bits (125), Expect = 8.560e-6
Identity = 118/438 (26.94%), Postives = 153/438 (34.93%), Query Frame = 3
Query: 10992 CHNFAYCRQK--VCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIP--CVKQ---CDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPINCYQPCHKNAYCNIGV-CTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCDPNAVC--VLGECICKVGFTGNGLQCMPTSKCNPLSGCSDTNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVC-EPSCHPKAA---------------CIIGSCICMKPLIGN----GITECKLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCI 12215
            CH+ A C Q   VC CR GF GDG   C   S    + I  PSL               C  K +C  D+  R              C+C  GYI  +  +C P P  CV +   C     C   +CQC PGF  +  K CV      ++  AS                                  NC Q C  NA+C  G  C CNP Y G+G+        C+ D               P  C   +G                C PNAVC     +C C  GF+GNG+ C P   C         N++C+   PT    C+C+ G+ K      C  +V  EP+     +               CI G CIC      N    G   C   DEC+   H  ++ A C+N T G   C C  G   +   C+
Sbjct: 2107 CHSLATCEQSTGVCICRDGFIGDGTTACSKKSTA--DCISLPSL---------------CADKAKC--DNSTR-------------SCECDAGYIG-DGYVCSPHPQDCVLRDNLCSPEAVCQNRRCQCLPGFTGDGVK-CVS-----IHERAS----------------------------------NCSQ-CDANAHCVGGTTCKCNPGYFGNGL-------CCVPD---------------PLDCVHFTGI---------------CHPNAVCNSESRQCQCSSGFSGNGVSCFPQKSCRTDKSVCAKNAICL---PTG--SCICRHGF-KGDPFYKCSSLVSKEPANQQDLSDVSSCVTPCDSSTQLCISGECICKSGFRRNSTLSGSETCADIDECAEKSHKCDRVATCRN-TFGSHVCTCPDGHVGDGITCV 2426          
BLAST of Neurogenic locus notch-like protein protein 1 vs. Ensembl Fly
Match: dpy (gene:FBgn0053196 transcript:FBtr0332344)

HSP 1 Score: 242.276 bits (617), Expect = 9.405e-63
Identity = 975/4113 (23.71%), Postives = 1360/4113 (33.07%), Query Frame = 3
Query: 2091 CKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGDGINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKSCDKICHKDALCQNSRCICKPNFEGDGVNYCFDCSKCHKLAQCHP--KTGNCTCRPPYVGDGVS-----------ECETFLP------KGNCFPPCANHAICTVEN---TCQCRKNYYGNPLEKCNI----------DCSKCHTDSDCDKTNGY--CKCRYGFFGDGFTCNKTCCVE-KCHEQAQCVDGKCL-----------------------CKPGFSGDGVETCFH-------------CSQCDSNAIC-DQNNKA-CICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPR--QNTCECNSGFHGDG-IQCKLLPLC-----TPACHPQASCIN---------GNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCK----EGTCKCSNGLTGDGVNFCFN---------------CSLCDKNAKCLINEEK--CECMERFEGDGFTCQD-------------------KVDCSSRCGENAFC----YNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFS-CHPNAKC----IKGRCRCLSNLIG---------------DGTTYCFNC-------SSCARNSDCKP--EQQTCTCKRGYVKDG---------NNCSIISARCHPE-CGVNAQCIN----GKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFC----ENQECKCLPGLIGDGINFCF------------------DCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECL--------PGLRGDGVQSCFDCSICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALC----FPDQQECSCKSEFVGDGKICTLRADICRPTCGE------NAICVNGQCQCQSGLQGNPLKHCFDCRPCHSFAVCDVENRRCICQ--SGFEGDGRNCKKIKECSPK---------------CHRNAVCINQN----CVCIPEYIGDGINFCFNCSSCDRNADCEPH----NNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKC--VN--GKCECLPGLQGNPLQHCFNCKR------------CDKFADCDVWNKKCVCK--NGYMGNGLTCISVNGCNNKCDSNALCVNRHCI-----------------------CLPGFTGDGTRFCFDC----------------SSCPKNSNC--LPEEQKCICQEGYIMNGAKCQPIVHECR--PGCGENAKCVNGKCECL-PGLQGNPMQHCFDCKKCHKFADCDVWNKK--CVCKNGYFGNGYMCTPINGCNLK----------------CNENALCVNQ----KCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGN----CECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGS-SPKCHSNALRVNQQCICLPGFIGDGKNFCFDC----------------STCPPNSDCLPQE--QRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCV-----------------------------QDKCECLPGFIGDGIKFCF---------------KCSSCDPNADCVPEQQ--KCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKC----QCNSGLKGDGVTSCFNCSKCDVNAKC--FPSVKKCICVIGYKGDGFRCYPVILECPKCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSK--CECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGIT-CKAI-------DPSCNTNCHKDALCFK----DSCICKSGLSGDG---KNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNA----VRVNNCCRCKNGFFGDGFSFCFNCSNCSPNADCF---------PHLS--------KCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDC--RKCHEKATCNI--RSMKCECLPGYIGNGF---ECISITSCTQSSDCIR----PNEICNVAISQCICEANSFLDPISKLCINPNCQPPC------HPKAVCVKGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAICT---EKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCECLPGLVGNGFIKCTNCSE---------------CHKKALCHDQRGCVCSHGYSGDGIQ-CRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCEN----GVCKCILGYVGDGII-CRL-------------PDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVP---ID-CNPKCHRSALCVI----GTCKCPPSFKGNGYSGCFDC------------------SKCHANADCDESKG---CTCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCL----SNNCVCKTGYSGTG-LNCKPNDQ----------CSQNSDCPEPN--SRCEMMKDYN-------RKCVCLPGFQDDNGKCSPKECQPKC--------HMFAICITQTCYCVPGYFGDGIKSCTSCSV--------------CHKNAQCLPDRG---CVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCL----LNPSMK-------------NLQCTCKPLHIL----------------------INNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDGINCQRPFECGIDNPCK-DQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGDGIRTCFK-CSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPK---------CGKNSQC----QLGVCVCKDGYS--PSVNGLSCSPI--DHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFI---PKSVFQCIEET----------------CPNKCHNFAYCR----QKVCQCRLGFQGDGVFNCHDCS---VCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEP--NDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFI-NKFGYCIPINCYQ--------PCHKNAYCNIGVCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCDPNAVCV----LGECICKVGFTGNG-LQCMPT-----------SKCNPLSGCSDTNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPI--------------------VCEPSCHPKAACIIGS----CICMKPLIGNGITECK----------LPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVDCPTRKICVNSKC 12281
            C C   ++GS   CR E     +C  + +C+N  C+          N C +    N       +   C C   Y G+ F  I    KI  +                GD ++ C+  + C + A C P      CTC  PY GD  S           EC + L       +  C   C  +A CTV N   +C C + + GNP + C            + + C  +S C    G+  C C+ G+FG    C   C V  +C +   C++ KC+                       C   + G+  E C                S C SN+IC + NN+A C C  G  G   NC       Q C     C+  +C           + C     C  NA C  +  Q  C C   F GD    CK+  +      T  C+P     N         G+C C  N  GD   +C    +C  N+ C  +N+ CI         +KC   C  +C   A+C+    +  C C   LTG+ +  C                  S C   + C +  E+  C C+  + G    C+                    K  C   CG NA C    ++  C C  G+ G+P   C             +P RK   I +  I    PC  S C PN++C        C C++N IG                    C N         SC  N+ C        C C+ GY  D              +I   C P  CG+NA C        C+CL    G+P+ +C     C   +DC P +  CV Q            +  C   C  N  C        C+CLPG  G+ I  C                     S C + + C P N   VCS   +       I +P  C+  C   ++C + K  CL        PG  G+       C + ++N +C        C+PG+ GD    F+       +C P  K           +  D ++ C   + C P++ C      +Q  CSC   +VG       RA  CRP C        N  C+N +C+            C     C     C V N R IC+   G+ GD        ECSPK               C  NAVC  +N    C C+PEY GD    C     C  N+DC  +    NN+C                   C   CG +A+C  +N    C C  G  GNP Q C    R            C  ++ C   N   VC     Y+G    C      +++C  +  CVN+ C                        C  G++GD    C                   S C +NS C  + E   C C   ++     C+P   EC     C  N  C+N +C+   PG              C   A C V N    C C +GY G+     P  GCN +                C  NA C  +     C CLP + GD    C     C  NS+C  +K          +N+K   P      C   C  NA+C   N    C CL G+ G+    C             P ++   C+P   G    C ++   ++C                CLQGF G          +C  E I   D     C    +   ++CV+   G+   +     +     C C PGF GD  N C                   S C PNS CL       C C  DY          GR P C P+C   A C                              +  CEC+PG+ GD    C                  S C  NA C        C C   ++G+        S C P C     C+ S+     +C     G           C +NA+C        C C  GY GD  R          C       I    CK              S C   +QC    S   C C +GY G   +C      S +C QN  CIN  C             C N A+C           +C C  G TG+ I+ C+ +       +P   + C  +++C +     +C C +G  G     +  C +   C  +  C+  ++RCV                   C   C  NA    V+ N  C C +G+ G+    C      +P              PH           C C + F GN +  QR  C+  C E    C   Q   R       + C+D     C + A C +      C+C PGY G+ F   + + +T     + C      PN  C    +Q +C   +       +   PNC+P C       P+  CV  KC+               + C +       + +C     S   IC C   +  D   +C + A      + +    S        C+P             S C  NA C        C C   FIG   +C    EC  NS+C    G    CI + +    C  S GF+    KC  L        N + I   C C+ G  G+ F++CT   E               C + A C     C C + Y G+  + CR E  C+L++DC   +K C+ +     RCV                C   C   A CE      VC C+ GY GD  + CR+             P  C S+  C+  N   V        C+C  G+     +      + ++     A   CV    +D C   C   A C +      C CPP   G+ +  C                     S C  N+ C   +    C C+P F G+   CRPE  C  N DC            +++ C+         N KC    CP  C  NA C     + +C C TGY+G   + C P  +          C  N++C E N  + C+ + +Y        R    L      +  C   +CQ  C          +A+     C C  GY GD   SC    V              C  N++C    G   C C   FIG   NC+P  EC +N +C   N+ C      NP  K             N  C+C PL +                       +   C P  C        + E   C CL  FIG   NC RP EC ++  C  DQ  + +   D     C        ++S+C+            Q     C C+G   GD    CF+           + D C   P              C  +++CR+   +C           C+P  +L        AC  K         CG+NSQC     + +C C  GY+  P V+    +P+  D CQ     P+S    + H   QG  C C+ G +   P    +CI  +                CP  C  FA C+       C C  G+ GD    C+         P+  C PS                C P  +C++     + NA C+         C   +I        P  C  +C  N EC        P       + C +P  N C  N  A C           N + IC C  G+  + F  C      +        PC  NA CN GVCTC P+Y GD  + C+ +  C+  +DC          S   +C          NKC    C   C PNA+C     +  C C  G+ GN  +QC PT           S C P S C + N   +         C C PGYI +  L  C+P                      C  SC   A C + +    C C+    GN    C+          +P +      C   N+ C+ + E    C C   F      C  K EC  N +CP+   C+N KC
Sbjct: 9504 CSCVANYIGSPPYCRPECTLSSECPSDKACINEKCQ----------NPCANVCGHNARCTVIAHSAHCSCDEDYEGDAF--IGCSKKITER---------------PGDHIDPCYP-NPCAENAVCTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRDPCTAACGANAECTVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFNAKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVINQDCPSNRACIRQRC----------EDPCIGI--CGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIVVLDPPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCRP--ECVQNSDCP-NNRACI--------NMKCRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACVERPSNMYLPLPKDPCRPSPCGLFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPSDRACINQRCKDPCPGTCGYNARCRCTNHSPICSCYDGYTGDPFHQC-------------VPERKPPPIAD-PIVPPNPCVPSPCGPNSQCQVSSSGAVCSCVTNYIGRPPGCRPECSINSECPARMACINARCADPCIGSCGNNALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQP-CRPSPCGLNALCEERNQAAACKCLPEYFGDPYVECR--PECVINSDC-PRSRACVNQKC----------VDPCPGMCGHNALCAVFNHAPNCECLPGYTGNPIVGCHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPS------YIGSPPNCRPECMSSSECAQDK-SCLNERCKDPCPGTCGNNAL----CRVVNHNPICS-------CSPGFSGDP---FV-------RCFPQEK--------RPPITHDRIDPCVP-SPCGPNSECRVSAANEQAVCSCLQHYVG-------RAPNCRPECTSDSECPGNLACINLRCR----------DPCVGT--CGIQTTCLVNNHRPICRCIDGYAGD-----PFSECSPKINVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTECR--PECVLNSDCSKNRACLNNKC----------------RDPCPGVCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVCSCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPGTCGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPNCRP---ECTINTECPANLACINERCQDPCPG-------------SCGFNAFCSVVNHSPICTCDSGYTGD-----PFAGCNPQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCR--PECVVNSDCSRDKS--------CVNQKCVDP------CPGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPPP----PERDENPCRPSPCGPYSQCREVDGHAVC---------------SCLQGFIGSA-------PNCRPECIISSD-----CAQNLNCQNQKCVDPCPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYL---------GRPPNCRPECLSSADCPANLACVNQRCSNPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAICRERNGAGSCACLPEYFGDP------YSGCRPECVQNDDCDRSRACINNKCQDPCPG----------ACGINAECRVLNHGPNCNCFDGYTGDPHR---------SCSLIEVVTIRPEPCKP-------------SPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPECVVSSECPQNRACINQKCE------DPCRGSCGNNAKCQVVN----HNPICTCQPGMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQ--QERCV-----------------DPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRG-CRREC-ENNDDCTAVQACSR-------FKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGF-----INQPPNCKPECVVSAECAPEKACVHKKCV---------------DPCQHTCG---IRAICTTKNHS--PICTCPRTMTGDPFVECTRVAITNDNTTPSPAPAS--------CVP-------------SPCGPNAKCQIVGNSPACSCLPNFIGAPPRC--RPECVLNSEC----GPTEACI-NQKCADPCSGSCGFE---AKCHVL--------NHLPI---CNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGE-CRCQNNYQGNAYEGCRPE--CTLSADCPR-DKACMRN-----RCV--------------DPCPGICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAV--------CSCLEGYIGAPPQ---CRPECVVSSECSALQACVNKKCVDPCAAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPE--CIINPDCQ-----------STQACI---------NNKCS-NPCPESCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAVNHVPNCVCNDGYTGDPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPPNCKP--ECTVNAECPS-NRACHKFRCANPCAKTCGLNAKCEVINHNPICSC-PLDMTGDPFARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNC-RP-ECVVNTDCSPDQACIAEKCRDPCDGSC-------GVDSECR-----------VQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQDPCDLQP--------------CGSNAECRNGICSCLADYQGDPYTGCRPECTLSTDCAPTKACLNKKCVDPCPGVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNS----LCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPGACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPS---------------PCGPNSECKV----LNGNAACS---------CAATFIG------TPPSCRPECSINPEC--------PPTKACIRQKCSDPCVNACGFN--ARCN--------VANHQPICTCDVGYTGDPFTGCQKEQAVKLDDPCNPSPCGPNAQCNNGVCTCIPEYHGDPYSGCRPE--CITSADC----------SRELACS--------RNKCF-DPCPGTCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQAV---------CSCVPGYIGTPPL--CRPECTSNSECLSHLACVNQKCNDPCPGSCGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPSPC-GPNSECRAAGE-TATCTCLGDFVGSPPYC--KPECVANSECPSNLACINQKC 13051          

HSP 2 Score: 216.853 bits (551), Expect = 3.955e-55
Identity = 1065/4480 (23.77%), Postives = 1482/4480 (33.08%), Query Frame = 3
Query: 1755 PENGAFYVGKAIVTTNPCLVSEAACPMPNSLCIAEMSSAPYKCI---------CSPGYSMINNICDKTYS--NFKCVPPC----HIDATCY---ENNMCICNSGHQGD---GXXXXXXXXXXXXAECYP-------------EISKCKCKPGFVGSGY-ECREEVNCDIKCHENASCVNGYCKCNRNLIGDGINSCFDCLKCNTEADCSPYEN--RCYCRPGYTGNGFT-CIKSCDKICHKDALCQNSRCICKPNFEGDGVNYCFDCSKCHKLAQCHPKTGN--CTCRPPYVGD---------GVSECETFLP------KGNCFPPCANHAICTVEN---TCQCRKNYYGNPLEKC------------NIDC---SKCHTDSDCDKT----NGYCKCRYGFFGDGFTCNKTC--------------------CVEKCHEQAQCVDGK----CLCKPGFSGDGVETCF-------------HCSQCDSNAICDQNNKACICKSGFEGNG---INCLRAINCKQKCHKQARCLLGKCICN-KGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGDGIQ-CKLLPL-------CTPA-CHPQASC--INGN--CKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCK----EGTCKCSNGLTGDGVNFCFNC----------------SLCDKNAKCLINEEK--CECMERFEGDGFTCQD-------------------KVDCSSRCGENAFC----YNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFS-CHPNAKCIK----GRCRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCING----KCECLAGLQGNPFQQCFDCKRCS----------QFADCDPWNE--------RCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCSTCDINAFCEPFNE--RCVCSVGFTGNG-KKCS--ILAPITCKRA--------CHKKAKC--VKGK--CECLPGLRGDGVQ---SCFDCSICDNNTVCY---------------------PDQEKCVCNPGYYGDG-TTCFLFSQLCTE-----KCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRA-------DICRPTCGENAICV----NGQCQCQSGLQGNPLKHCF------------DCRPCHSFAVCDVENRRCICQ--SGFEGDGRNCKKIKECSPKCHRNAVCINQNC-----------------------VCIPEYIGDGINFCFNC------------SSCDRNADCEPHNNR--CTCYQGFTGNGLTCNAI---------ELKCEP---------SCGENAKCV----NGKCECLPGLQGNPLQHCFNCKRCDKF------------------ADCDVWNKK--CVCKNGYMGNGL----------------TCIS-------VNGCNNKCDSNALC-VNRH---CICLPGFTGDGTRFCFDCSSCPK-------------NSNC--LPEEQKCICQEGYIMNGAKCQP---IVHECRP---------------GCGENAKCVNGK----CECLPGLQGNPMQHCFDC------------------KKCHKFADCDVW--NKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCI-----------------------CLPGFIGDGIKFCFD---------------CSACPANSNCVPEKKECKCAKDYFMN-----------------EKICSPIKQPVLCTSKCHKNAKCLKGN----CECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIK---TCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALRVN---QQCICLPGF-IGDGKNFCFDC---STCPPNSDCLPQEQ--RCICKKDYFMNDTQCIHTGRTPQCV--PKCHHYASCVQDKCECLPGFIGDGIKFCFKCSSCDPNADC--VPEQQKCVCKTGFYGNG-NKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFP--SVKKCICVIGYKGDGFR-CYPVILECPKCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFP--NFSKCECRQGYRGDG-KNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCA--QGFTGNGITCKAIDPSCNTN--CHKDALCFKDSCICKSGLSGDGKNYCFDCKRCDQNAICRPTEQR--CVCKPEFRGDGFQ---------CALNLKTTCQNDCHPNAVRVNNCCRCKN---------GFFGDG---FSFCFNCSNCSPNADCFP---------------------HLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYIGNGF-----ECISITSCTQSSDCIRP------------NEICNVA--ISQCICEANSFLDPI------SKLCINPNCQP-PCHPKAVC-VKGK---CICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAICTEKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYP-CAKNAVCIYQKCECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSGDGIQ-CRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDGII-CRLPDECKSSLDCKYE------------------NQECVARLDSSLMCTCKSGFQW-------KSEKSSLVN----------------NQMMIKRSMRAYSGCVPIDCNPKCH-------------------------RSALCVIGT----CKCPPSFKGNGYSGCFDC----------------SKCHANADCD---ESKGCTCKPGFEGNGCYCRPE----DKCK-----FNSDCNDPLKICVQSPDTSR------NCVCKPGTTPSTNGKC--------IILGC-PVQCDKNAVCLSNN----CVCKTGYSGTGLN-CKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICITQTCYCVPGYFGDGIKSCTSC--------------SVCHKNAQCLP---DRGCVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCE----GGMCQCLSGFIGDGINCQRPFECGIDNPCKDQF--------SVCQLTSDAK----RFVCVCVFGFQMINSKCQPE--------------------PCPINCHPLAQCKS----GKCVCQGELQGDGIRTCFKC---------------SSCHARAVCSMDG-CKCMPGYVGNG-IVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCK-PGFSLENSLCSPIACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSPI-----------DHCQSENDCPDSNHKCV------YHGLFQGKRCMCRKGFIPKSVFQCIEE----TCPNKCHNFAYCR----QKVCQCRLGFQGDGVFNCH---------------DCSVCHPNAIC-----SPSLGCTCPGPHLIGDGRSCKPK-------DQCRI--DSDCRD-------SNAVCTLTYDSLKCQCKLGYIKFNNSLCYP------IPCVKQCDRNE-----ECL----FGQCQCKPGFIHNS----NKTCVEPNDCD-----VNN------PASCKSPLEVCLGFPNAKAICVCRKGFI-NKFGYCI----PINCY------QPCHKNAYCN----IGVCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCDPNA---------VCVLGECICKVGFTGNGLQCMPTSKCNPLSGCSDTNSVCIQVPPT----NYYDCMCKPGY-------IKSSNLSICK--------PIVCEPSCHPKAACI-----------------------------IGSCICMKPLIGNGITEC-----------KLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVDCPTRKICVNSKCICP 12290
            PE     +   IV  NPC+ S      PNS C    S A   C+         C P  S IN+ C    +  N +C  PC      +A C+      +C+C  G+ GD   G +            C P             + + CKC P + G  Y ECR E   +  C  + +CVN  C          ++ C     C   A C+ + +   C C PGYTGN    C    +   + D +   + C   P               C   + C P  G+  C+C P Y+G            SEC           K  C   C N+A+C V N    C C   + G+P  +C             ID    S C  +S+C  +       C C   + G    C   C                    CV  C  Q  C+       C C  G++GD    C              + S C +NA+C + N    C    E NG     C         C K   CL  KC     G+ G   E       CH+    I    +C C SGF G+  Q C+ +P        C P+ C P + C  +NG+  C C  N IG    +C    +CS+++ C   ++ C+ Q        +C   C  +C   A+CK       C C  G +GD    C                   S C +N++C +  E   C C+  F G    C+                    +  C   CG NAFC    ++  C C  G+ G+P   C        P    IP+ +            TPC  S C PNA+C +    G C CL    GD  + C     C  NSDC  ++   +C      D          C   CG+NAQC        C CLAG  GNP   C +  +            + + C P+++         C C  G+IG+   C       + C  N  C+NQ+C          ++ C    TC I A C+  N    C C+ GFTG+   +C+  +L P   +++        C   +KC  V+G   C CLP   G        C   + C  N  C                        +  C C PGY GD  + C +  Q+         C+P+    N  C+  ER   +G   C    +C P+    P      C+ E V +      RA       D C   CG NA C        C C  G  G+P + C                PC  ++ C   N   +C    G+ G   +CK     S +C +N  CINQ C                        C P   GD I+ C               S C  N+ C    N+  C+C  G+ G   TC             L C+          SCG NA C     N  C C  G +G PL   F C+                       A+C   N    C C +G+ GN                  T +        V+ CNN C   A+C V++H   C C PG+TGD    C      P+             NSNC  +  +  C CQ G+I     C+P   +  EC P                CG  A C        C C   + G+P   C                       C   A C +   +  C C   + G    C P    N +C     C+NQKC                        C+ G+ GD    C                  + C  N++C     EC+C  +Y  N                 +K C   +    C   C  NA C   N    C C+ G+ GD      NC    K     P  E   C P   G+   C  +   ++C                CL+G+ G   +    C   S CS    CV   +KC+     +   E   E I   SP C     R     +QC+ LP   + D K+   D    S C PNS C        C C+ ++F +   C      P+C+  P C    +C+ +KC             C +  SC  NA+C  +     C C TG+ GN   +C   +     PC P                          S C  NA+C        C C+  Y+G+ +  C P  +    C     C+  KCQ        GI        C  NAQC+   +   C C  GY GD   +C +++  +P    +         C+P             + C AN+ C+    L VC+  + F G    CK   P C  N  C  +  C K  C           N C   K C  NA C        C C  +  GD F                   +  C P+   +N+ CR ++          F G        C   ++CSP+  C                       HL+ C C+  FTG+ F+         C E      K+     P L  D     D + C   A C  R+  C CL  Y G+ +     EC   T C  +  C+              N  C+V+  I  C C      DP       + +  +P CQP PC P ++C + G+   C C   ++G    C+   EC   ++C            SL   C         +  +C  P C GAC   A C +  N    C C  G+ GD  T C      ++    T    C                + C  NS+C  + G A+           C C+  F      C P   I P C     CI QKC   P +   GF    N        + + Q  C C  GY+GD    C+ E    L+  C                                    S C   A C NGVC CI  Y GD    CR   EC +S DC  E                  N  C   L+   MCTC  G+          +   +LV                 NQ  +   +  Y G  P+ C P+C                          R+A C +      C C P F GN + GC                   S C  N++C    E+  CTC   F G+  YC+PE     +C       N  C DP      S  T R       C+C  G T     +C        II  C P  C  NA C+  N    C C T Y G     C+P  +C  NSDCP  N  C+  K  +      PG    N +C+     P C+ FA           G+ GD  + C+                S C  N+ C        C C+S+F G   NCRP  +C  + +C   N+ C                   IN  C+   C   C + A CE      +C+C +  IGD      P       P +D          S C L +  +    + VC C+  +      C+PE                    PCP  C    +C+       CVC     GD    C                  S C + A+CS  G CKC+  Y G+  + C+ E  C   S+C  RN AC       +KC    PG    N++C  +             + +C C D  + +   + C+P+             C S  +C + N + V      Y G+    R  C   +       C  +     CP  C  +A CR       C CR G+ G+ +  CH                 S C PN+ C     +PS  C     +  G   +C+P+        Q  +  ++ C+D       ++AVC +   S  C C+ GY       C P      I  V+ C+ N      EC      G CQC P +  N        CV  +DC      VN       P SC    E  +   N    C C  G++ + + YC     PI  Y       PC  N+ C     +  C+C P+++G     C+ +  C   S+C +                       +  C+  KCL PC P A         V     C C+ G+TG+     P ++C P           I  PPT    +Y    C+P          +S   +IC         P  C P C   + C+                             + SC C    +G+  T C            L D C+ S      NA C+N   GQ  CI ++           + EC +N DCP  + CV  KC+ P
Sbjct: 10107 PERKPPPIADPIVPPNPCVPSPCG---PNSQCQVSSSGAVCSCVTNYIGRPPGCRPECS-INSECPARMACINARCADPCIGSCGNNALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALCEERNQAAACKCLPEYFGDPYVECRPECVINSDCPRSRACVNQKC----------VDPCPG--MCGHNALCAVFNHAPNCECLPGYTGNPIVGCHIVPESPRYPDPIVPENPCQPSP---------------CGLYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSSSECAQDKSCLNERCKDPCPGTCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTSDSECPGNLACINLRCRDPCVGTCGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRACLNNKCRDPCPGVCGVSAE-------CHV----INHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVCSCVTNYIGTP-PACRP--ECSVSSEC-AQDRACVNQ--------RCADPCPGTCGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPNCRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGC-------NPQPPAIPDER-----------LTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCR--PECVVNSDCSRDK---SCVNQKCVDP---------CPGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQNLNCQNQKC----------VDPCP--GTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAICR--ER---NGAGSC----ACLPEYFGDPYS---GCRPECVQNDDCDRSRACINNKCQDPCPGACGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPECVVSSECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPL---FGCQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVDPCQHTCGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSPACSCLPNFIGAPPRCRPECVLNSECGPTEACINQKCADPCSGSCGFEAKCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCF--AGECRCQNNYQGNAYEGCRPECTLSADCPRDKACMRNRCVDPCPGICGNNAVCEVMNHIPVCSCVKGYEGDPF---VNCRV--KPVVEDPIIE--ACSPSPCGSNSQCRDVNGHAVC---------------SCLEGYIGAPPQCRPECVVSSECSALQACV--NKKCVDPCAAACGLEARCEVI-NHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPNC-----RPECIINPDCQSTQACINNKCS----------NPCPE--SCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQP--------------------------SPCGPNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQ----DPCPGI--------CGLNAQCYAVNHVPNCVCNDGYTGDPFASCRRVEVTTPSPVSDP--------CIP-------------SPCGANSKCRVANGLAVCSCMETFIGAPPNCK---PECTVNAECPSNRACHKFRC----------ANPCA--KTCGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCRPECVVNTDCSPDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFV--------RCFEFVEETTKS-----PPLTQDP---CDLQPCGSNAEC--RNGICSCLADYQGDPYTGCRPECTLSTDCAPTKACLNKKCVDPCPGVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDP-CQPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKP--ECIVSSEC------------SLHTAC---------VNRKCVDP-CPGACGQFARC-QVINHNPSCSCNTGYTGDPFTRCYQE---ERKPPTTPDNPC--------------QPSPCGPNSECKVLNGNAA-----------CSCAATFIGTPPSCRPECSINPECPPTKACIRQKCS-DPCVNACGFNARCN--------VANHQPICTCDVGYTGDPFTGCQKEQAVKLDDPCNP----------------------------------SPCGPNAQCNNGVCTCIPEYHGDPYSGCR--PECITSADCSRELACSRNKCFDPCPGTCAPNAICTV-LNHVPMCTCPEGYNGNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPL-CRPECTSNSECLSHLACVNQKCNDPCPGSCGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECPSNLACINQKCRDPCPGLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGANAECIQRNGAGACQCLTDYFGNPYEGCRP--ECVLNSDCPS-NRACQQQKCRDP----CPGSCGQNAECNVVNHTPMCNCFA-----------GFIGDPYRYCSQPPEPIVHEYVNPCQPSPCGPNSNCREVNEQAVCSCRSEFEGAPPNCRP--QCTSSSECAS-NRAC-------------------INQKCV-DPCPGVCGQQAICEVRNHSPICRCPTAMIGDPFVRCIPRPTIAPPPLRDVAPYRDPCLPSPCGLYASCRNQQNQAVCSCLPNYFGTPPHCRPECSINAECPSHLACIGERCRDPCPGACGQQTECRVISHVPSCVCLRGYVGDAFLACHPAPPPPSREEPRDPCNPSPCGSNAICSNQGECKCVADYQGDPYVACRPE--CVLSSEC-PRNLACI-----QQKCTDPCPGTCGTNAICDVVN-----------HIAMCHCPDRMTGNA-FVQCTPVQLDVYRNPCNPSPCGSYAECREQNGQAVCSCLPNYFGVPPSCRPECSTNYDCSPSLACQNQRCVDPCPGACGAYAECRTVNHSPFCSCRPGYTGNPIVQCHMIIEPQRDITPKDPCQPSPCGPNSECRRVGETPSCSCLS---NFFGTPPNCRPECVSNSECSQVHVCSNNRCKDPCPGLCGTDAVCRVISHSAMCYCQPGYSGDPFVRCAPHIQRESIEIVQPCNPNPCGAFAECRQQNGVGSCQCLPEYFGNPYEGCRPECVLDSDCPSQLACVNQKCRDPCPGSCGQNAECFVR--NHLPTCNCLSGYVGDPYRYCSIEPKPIREYVNPCQPSPCGPNSQCREQNGVATCSCLPEFVGTP-PGCRPE--CTVSSECNL-----------------------DKACVRHKCLDPC-PGACGSSANCQVVNHAPLCSCQAGYTGD-----PFTRCYP-----------IPSPPTHIVHDYARHPCQPSPCGANAQCRQSQGQAICSCIPNYFGVPPNCRPECTQSSECLSSLACINQRCADPCPGSCAYNAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQPPPKPVALDDPCNPSPC--GANAVCQN---GQCSCIPEYQGDPYTG---CRPECVLNADCPRNRACVRHKCVDP 14119          

HSP 3 Score: 211.46 bits (537), Expect = 1.868e-53
Identity = 994/4155 (23.92%), Postives = 1380/4155 (33.21%), Query Frame = 3
Query: 2064 AECYP--EISKCKCKPGFVGSGY-ECREEVNC--DIKCHENASCVNGY----CKCNRNLIGDGIN-----SCFDCLKCNTEADCSPYENR--------------------CYCRPGYTGNGF-TCIKSCDK----ICHKDALCQ----NSRCICKPNFEGD--------GVNYCFDCSKCHKLAQCHPKT---GNCTCRPPYVGDGVSECETFLPKGNCFP-PCANHAIC--TVENTCQCRKNYYGNPLEKCNIDC--------SKCHTDSDC--DKTNGYCKCRYGFFGDGF-----TCNKTCCVEKCHEQAQCV---DGK--CLCKPGFSGDGVETCF-HCSQCDSNAICDQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNC----------TSCHLNAKC--IPRQNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGNCKCNNNLIGDGIS----SCFDC---DKCSMNARCDVSNQR--CICQPGYEGNG-IKCVKTCFQSCHKLAVCKEGTCKCSN--GLTGDGVNFCFNC--SLCDKNAKCLINEEKCECMERFEGD------GFTCQDKVDCSSRCGENAFC----YNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGR----CRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQ---------------------------TCTCKRGYVKDGN-NCSII----SARCHP----ECGVNAQCIN-----GKCECLAGLQGNPF---QQCFDCKRCSQFADC------DP---------------WNERCVCQSGYIGNGF-TCTKIIN-----------CV-TKCHVNGFCENQE----CKCLPGLIGDGI---NFCFDCSTCDINAFCEPFNERCVCS-VGFTGNGKKCSILA-PITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSICDNNTVCYP--DQEKCVCNPGYYGDGTT------CFLFSQ--------------LCTEKCHPNAKC--VNR--KCKCNERLVGDGVNFCFNCTSCHPDALCFPD-------------QQECSCKSEFVGDGKICTLR------------------ADICRPTCGENAICV----NGQCQCQSGLQGNPLKHCFD-------------CRPCHSFAVC-DVENR-RCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNC--VCIPEYIGDGINFCFNCSSCDRNADC--EPHNNRCTCYQGFTGNGLT-CNAIEL--------KCEPS-CGENAKCV----NGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISV---NGCNNKCDSNALCVNRH----CICLPGFTGDGTRFCFDCSS-----CPKNS------------NCLPEEQKCICQEGYIMNGAKCQP--------------IVHECR---PG-CGENAKCV----NGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCV--------------------CKNGYFGNGYMCTPINGCNLKCNENALCVNQK-----------------------CICLPGFIGDGIKFCF-----------DCSACPANSNCVPEKK----ECKCAKDYFMNEKI-CSP--------------IKQPVL--CTSKCHKNAKCL----KGNCECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNAL-RV---NQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVP-------KCHHYASCVQDKCECLPGFIGDGIKFCFKCSSCDPNADCVPEQQKCV---CKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSK--CQCNSGLKGDGVTSCF-------------NCSKCDVNAKCFP--SVKKCICVIGYKGDGF-RCYPVIL------------------ECPK-CHYRAQCVI----GKCQCKNGLQGDGINFCMNC------------SECDKNAQC--FPNFSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDEN--LCVCAQGFTGNG-ITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDG----------FQCALNL-------KTTCQNDCHPNA----VRVNNCCRCKNGFFGDGFSFCF--------------NCSNCSPNADCFPH--LSKCQCKEEFTGNGFICQRKEC--KPACSEATSLCIKNQCFCR-PGLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQP-PCHPKAVC--VKGKCICN--RNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQK--PACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAICTEKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQK----CECLPGLVGNGFIKCT---------------NCSECHKKALCHDQRG---CVCSHGYSGDGIQ-CRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCE----NGVCKCILGYVGDG--------IICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRS----ALCVI----GTCKCPPSFKGNGYSGCFDC------------SKCHANADCDE---SKGCTCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVC--LSNN--CVCKTGYSGTGL-------NCKPNDQCSQNSDCPE--PNSRCEMMKDYNRKCVCLPGFQ--------------DDNGKCSPKE----------CQPKCHMFAICITQ----TCYCVPGYFGDGIKSCTSCSV-------------CHKNAQCLP---DRGCVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDG-INCQR-------------PFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPIN--CHPLAQCKSGKCV--CQGELQGDGIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNFAYCRQ----KVCQCRLGFQGDGVFNCHDCSVCHPNAI--CSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEP--------NDCDVNN--------PASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPINCYQPCHKNAYC----NIGVCTCNPDYIGDGI---------TSCKKKNLCLED---SDCPI---IGSKCMTKSNPYSCKCPSGYE-------IDNNKCIAKKCLL-PCDPNAVCV----LGECICKVGFTGNGL-----QCMPTSKC------------NPLSGCSDTNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVCEPSCHPKAACIIGSCICMKPLIGNGITECKLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVDCPTRKICVNSKCICP 12290
            AEC P    ++C+C PGF+G+ Y +C     C  D +C  + +C+NG     C+C    + D +N      C      N +  CSP ++                     CYC  G TGN F  CI   D+     C  ++ C+    N  C C P +EG           N C D S C    QC   +     CTC P YV    +      P   C P PC   AIC  +    C C  N  GNP   C+             C  +++C        C CR G+ GD +          C    C   A CV   DG+  C+C  G SGD       H  +C  +A C  N+KAC+    ++     C +  +C+ + H         C CN GL GN    C+            + C  N++C  +  +  C C  G+ GD         C P C      IN +C       GD +S     C D      C +NA C+V      C+C  G+ G+  ++CV            C    C   +   + GDGV  C  C      +N +C     + EC+   +        G  C D   C   CG NA C    +N  C C  G  GNP E C    V   P     P   C                 C  NA+C +      C C     GD    C     C  NSDC  E+                             C C  GY  D +  C+        R HP     CG N++C         C CL   +G P     +C     C+    C      DP                N  C C++ + G+ F  C+ I +           CV + C  N  C+ ++    C C+   IG        C   S C  +  C   NE+C        G+  +C+++A    C      +     G  + +    GD +  C+  + C  N VC P  +  +C C   Y GD  +      C   S+               CT  C  NA+C  VN    C C     G+  + C       P+ +C P+                CSC+  + G    C                      D C  TCG NA C     N  C C +  +GNP + C                 PC S ++C +V NR  C C  G  G   NC+     +  C  N  CI Q C   CI      GI        C  NA C  + H  +C+C + F G+  T C   E+         C PS CG NA C      G C C+    G+P  +C     C + +DC               N   CI++   + C N C  NA+C   H    C C P  TG+  R C +  S      PK+             + + E   C C   Y+     C+P              I   C+   PG CG NA+C     +  C C  G  G+P   C   +K    AD  V    CV                    C   Y G    C P    N +C     C+N +                       C+C PG+ GD    C+            C   P   N + E++     CKC  +YF +  + C P              + Q  +  C   C  NA C       NCECLPG+ G+ I  C       +  +  P      C+P   G   NC  +   ++C                   G   +    C + S C+ +  C+                E+C +   G+   C +NAL RV   N  C C PGF GD            P   C PQE+R     D            R   CVP       +C   A+  Q  C CL  ++G       +C+S   +++C P    C+   C+    G       I++TC          NN +  C+C  G  GD  + C              N S C  NA C     V  C C+  Y GD +  C P  +                   CP  C   A+C +      C C +G  G+   FC               S C   +QC      + C C   Y G    C      S +C Q+  C+N  C             C     C   AICK   +  +C C  G++G+  + C             +  C    C         G+N    C+   +  +C        C P F G             +C  NL       +  C   C  NA    V  +  C C +G+ GD F+ C                 S C PNA+C        C C  E+ G+ +   R EC     CS   S C+  +C    PG+ G    C        + + ++ S  C CL GY GN                  P+  C   I Q        L P  +   NP C+P PC P + C  V G  +C+  +  +G    CR   EC   +DC Q                        +L  Q QK    C G C  +A C +  N    C C PGF GD    CT           TEK G  C     G   +C+ +      S      GR   C    E +    C      +N +C    CI  C  ++VC   K    CEC+PG  G+ F  C                N S C   A+C ++ G   C C   Y GD    CR E  C  N DC D ++ CI                  N+ C    C   C   A C        C C  GY GD         ++   P+ CK S    Y   +C+   +S  +C+C  G+            + ++         C+   C   C  S    A C +      C C P   G+  SGC               S C  N+ C +      C+C  G+ G    CRPE  C  N +C + L  C Q                    +C+   CP  C  NA+C  + +N  C C  GY G  L          P +  S   +     P++ C   ++    C C  GF+              ++N  C+  +          C   C  +AIC       TC C PGY GD   SC    V             C  N+ C        C C++ FI    NC+P  EC ++ +C  P K C+    +   Q TC    I          CT+K H        +C C     GD  + C R             P  C + +PC    + CQ+  ++    C C+  F     +C+PE C +N  C P   C + KC   C G        +C   + CH   +  +  C C+ GY G+  V  T+ +        DR+                                  CG+N+ C  G C C++ Y  +     C P   C    DCP            + K CM  +   P          CP  C N A C       VC C  G++GD   NC    V     I  CSPS                      C  +S CRD N           C C  GYI        P  C  +C  + EC   Q           NK CV+P          C+V N        P     P + C+  P      V           C+P     PC  N+ C    N  VC C P++ G              C+    C+ +   + CP      ++C    +  SC CP+GY        +   +   K C   PC PNA C+       C C   + GN       +C+ +S C            +P  G    N+ C  V   +  +C+C  GY                           SC  ++    + +++  +P  C A+  C+  N        G   C C   F      C  K EC VN +CP+ + C   +C  P
Sbjct: 8646 AECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKCSSPCQCGAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNPICYCPKGLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPC-DPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICDSSRHPVCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDADC-PNSKACMGYRCYDPCPGACGQGAHCQVEEHHPV------CSCNSGLTGNPGIRCYALDHPKKNPCVPSPCGRNSECKLLNNRAVCSCIPGYLGDPQS-----GCQPECD-----INSDC-------GDTLSCINHKCVDPCAGAICGINAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGPHDVCSVYGDGVALCDPCFGPNAQQNPRC-----RPECVGNSDCPFDRACLGQRCLDP--CPGSCGRNAICNVYEHNPVCACPTGLFGNPYEQCTTKSVVETP-----PQPSCA-------------KLHCGANAECKRQHSGLACVCRKGYFGDPHIGCR--PECVLNSDCPAEKACLNSKCVEACTGVCGVNAVCRVVNHAPVCICAEGYSGDASIACNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQPECVVSSECAPNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFEGDPFVACSPIQDPGRDIPVPKNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSDKAC--INEKCQNPCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYP-NPCAENAVCTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRDPCTAACGANAECTVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFNAKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVINQDCPSNRACIRQRCEDPCI------GI--------CGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIVVLDPPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCR--PECVQNSDCP--------------NNRACINMKCRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACVERPSNMYLPLPKDPCRPSPCGLFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPSDRACINQRCKDPCPGTCGYNARCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIVPPNPCVPSPCGPNSQCQVSSSGAVCSCVTNYIGRPPGCRPECSINSECPARMACINARCADPCIGSCGNNALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALCEERNQAAACKCLPEYFGDPYVECRPECVINSDCPRSRACVNQKCVDPCPGMCGHNALCAVFNHAPNCECLPGYTGNPIVGCHIVPESPRYPD--PIVPENPCQPSPCGLYSNCRPVNGHAVC------------SCVPSYIGSPPNCRPECMSSSECAQDKSCL---------------NERCKDPCPGT---CGNNALCRVVNHNPICSCSPGFSGD------------PFVRCFPQEKRPPITHD------------RIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTS---DSEC-PGNLACINLRCRDPCVGTCG----IQTTC--------LVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRACLNNKCRDPCPGVCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVCSCVTNYIGTPPACRPECSVSSECAQDRACVNQRC----------ADPCP--GTCGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPC---------GRNS--QCRVVGETGVCS-------CLPNFVGRAPNCRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGCNPQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCRPECVVNSDCSRDKS-CVNQKCVDPCPGVCGLNAQC--------RVSNHLPS--CSCLAGYTGN------------------PSSACR-EIPQ--------LPPPPERDENP-CRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRP--ECIISSDCAQ------------------------NLNCQNQKCVDPCPGTCGIEARC-QVINHYPACSCAPGFTGDPFNRCTKIL---LEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNC--RPECLSSADCPANLACVNQRCS-NPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAICRERNGAGSCACLPEYFGDPYSGCRPE--CVQNDDC-DRSRACI------------------NNKCQ-DPCPGACGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPY--SQCL-DTNSHAVCSCLEGYIGAPPS---CKPECVVSSECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPE--CTNNDECQNHLS-CQQE-------------------RCVDP-CPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECR-ERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKP--ECVVSAECA-PEKACVHKKCVDPCQHTCGIRAI----------CTTKNHS------PICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASC-VPSPCGPN-AKCQIVGNSP--ACSCLPNFIGAPPRCRPE-CVLNSECGPTEACINQKCADPCSG--------SCGFEAKCH--VLNHLPICNCIEGYEGDPFVRCTKKE-------EDRSPPPPNDPCNPN----------------------PCGQNADCFAGECRCQNNYQGNAY-EGCRP--ECTLSADCP------------RDKACMRNRCVDP----------CPGICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIEACSPS---------------------PCGSNSQCRDVNG-------HAVCSCLEGYIGA------PPQCRPECVVSSECSALQACV--------NKKCVDPCAAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSP----PQDPCVP----SPCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSNPCPESCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAV--NHVPNCVCNDGYTGDP---------------------FASCRRVEVTTPSPVSDPCIPSPCGANSKCRVAN--------GLAVCSCMETFIGAPPNC--KPECTVNAECPSNRACHKFRCANP 12318          

HSP 4 Score: 211.075 bits (536), Expect = 2.322e-53
Identity = 1042/4380 (23.79%), Postives = 1451/4380 (33.13%), Query Frame = 3
Query: 2091 CKCKPGFVGSGYE-CREEVNCDIKCHENASCVNGYCKCNRNLIGDGINSCFDCLKCNTEADCSPYENR--CYCRPGYTGNGFTCIKSCDKICHKDALCQN-SRCICKPN---------FEGDGVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPC----ANHAICTVEN---TCQCRKNYYGNPLEKCNI----------DCSKCH--TDSDCDKTNG--YCKCRYGFFGDGFTCNKTCCV--EKCHEQAQCVDGKCLCKPGFSGDGVETCFHCSQCDSNAICDQNNKA--CICKSGFEGNG-INC--------LRAINCK-QKCHKQARCL-----LGKCICNKGLNGNGV---EYCFNCTSCHLNAKCIPRQNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGNCKCNNNLIGDGISSCFDC----------------DKCSMNARCDVSNQR--CICQPGYEGNGIKCVKTCFQS--CHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLI--NEEKCECMERFEGDGFT-CQDKVD----------CSSRCGENAFC--YN--GTCKCKLGFQGNPLEHCFDCRV-CHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIK----GRCRCLSNLIGDGTTYCFNCSSCARNSDCKPE-------------QQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFD--CKRCSQFADC--DPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCSTCDINAFCEPFNER--CVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSICDNNTVCYPD--QEKCVCNPGYYGDGTTCFLFSQLC-----TEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLR-ADICRPTCGENAICVNGQ----CQCQSGLQGNPLKHCFD-------------CRP--CHSFAVCDVENRR--CICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCE--PHNNRCTCYQGFTGNGLTCNAIELKCEP--------------SCGENAKC----VNGKCECLPGLQGNP---------------LQHCFNCK-------RCDKFADCDV--WNKKCVCKNGYMGNGL--------TCISV-NGCN-NKCDSNALCVNRH----CICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCV----NGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCVCKN-GYFGNGYMCTPINGCNLKCNENALCVNQKCICLPGFIGDGIKFCFDCSACPANSNCVPE-KKECKCAKDYF-MNEKICSPIKQPVLCTSKCHKNAKCLKGN----CECLPGFVGDGIQVCFNCS-----TCDKNANCFPY---------------QERCVCKPRYSGNGENC-VKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFN-------CSSCSIEAICVPDQEKCICK--AGFSGNG-EQCVENI----EGSSP----KCHSNALRVNQ----QCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCV----QDKCECLPGFIGDGIKFCF------------KCSSCDPNADC--VPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGF-RCYPVILEC--PK----------CHYRAQCVI----GKCQCKNGLQGDGIN---FCMNCSECDKNAQCF--------------------PNFSK-CECRQGYRGD----------GKNCVKIDECSPK-CHQNAVCINSN----CHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALC----FKDSCICKSGLSGDGKNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGDG---FSFCFNCSNCSPNADC---------------------FPHLSKCQCKEEFTGNGF-ICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYIGNGF----ECISITSCTQSSDCIRP------------NEICNVAISQCICE--ANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRD---LQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAICTEKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGR-------ASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQK----CECLPGLVGNGFIKCTNCSE------------CHKKALCH---DQRGCVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCE----NGVCKCILGYVGDGII-CRLPDECKSSLDCKY--------ENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPID----------CNPKCHRSALCVIG----TCKCPPSFKGNGYSGCFDC-------------SKCHANADC---DESKGCTCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNN----CVCKTGYSG-----------TGLNCKPNDQCSQNSDCP-EPNSRCEMMKDYNRKCVCLPGFQDDNGKCSPK-----ECQP---------------------KCHMFAICITQTCYCVPGYFGDGIKSCT---------------SCSVCHKNAQCLPDRGCVCKSDFIGDGFN-CRPLDECRINEDC-RDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCEG----GMCQCLSGFIGDG-INCQ-------------RPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPE--------------------PCPINCHPLAQCK----SGKCVCQGELQGDGIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDS---NHKCVYHGLFQGKRCMCRKGFIPKSVFQCI--EETCPNKCHNFAYCRQKVCQCRLGFQGDGVFNCHDCSVCHPNAIC---SPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFP----------NAKAICVCRKGFINKFGYCIP----------------INCYQPCHK----NAYCNI----GVCTCNPDYIGDGITSC--KKKNLCLEDSDCPI----------IGSKCMTKSNPYSCKCPSGYE----------------IDNNKCIAKKCLLPCD----PNAVCV----LGECICKVGFTGNGLQCMPTSKCNPLSGCSDTNSVCIQVPPTNYYDCMCKP---------------GYIKSSNLSICKPI-VCEPSCHPKAACIIGSCICMKPLIGNGITECKLPDECS-----------ASVHCKNK---------------NAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVDCPTRKICVNSKCI--CPEQYTSSPDGKLCELPMIMVVPS-KLDVPETKDVEVLCFFENGIGNVNYLSWRRISPLMTMNFIRQPASVKLIIQKATVGDSGIYQCCIDSNSSPLNCKFA-SVNI--------FTKKCS-----PCSLNQHCDPVTSN--CICDAGFQFDSNGICQRRNCLYFPEICDQVT----MICDKGNCVCKSELYMDNKV-CVPKDQCKTNEDCD-------------------PNAICKTDKR---CHCGVLFNGPGKF-CAPIKLGCEV----TKDCDPNGECFAIGISPTRLCQCKPGYVGDGKTCKP 13061
            C C PG++G     C+ E + +  C +  SC+N  C          ++ C   + C   A C+  ++   C C  G+ G+ F         C    + +N SR  C P+           GDGV  C  C   +  AQ +P+     CRP  VG+     +       C  PC      +AIC V      C C    +GNP E+C             C+K H   +++C + +    C CR G+FGD     +  CV    C  +  C++ KC          VE C     C  NA+C   N A  CIC  G+ G+  I C         R   C+   C   +RC         C C     G        C   + C  N  C+ ++ T  C  G  G G +C++L              N  C C  N  GD   +C                     C  N+ C +   R  C C   Y G+   C   C  S  C     C    C+          N C N  +C  NA+C +  +   C C E +EGD F  C  K+             + C ENA C  YN    C C   + G+P  +   CR  C Y + C        CI ++    R PC+ +C  NA+C        C C     G+    C         + C+P                TC+C+ GY            +C PEC V+++C      C+        Q+C D     C   A C  +  N  C C + Y GN F                    ++C   P      ++ C   S C  N+ C   N R  C C+ G  G    C     I   + C     C++ +CE            C    IC  N VC     Q KC C   + GD  T     ++      T+ C+P+    N  C+      G G   C       P   C P   EC   S+   +     ++  D C   CG NAIC        C C+  L GNPL+ C +             CRP  C  F+ C V   R  C C   + G   NCK     S +C  +  CINQ C           + C    +C  NA C    H+  C+CY G+TG+       E K  P               CG N++C        C C+    G P                  C N +        C   A C V      C+C+ GY G+          T I V   C  + C  NALC  R+    C CLP + GD    C     C  NS+C P  + C+ Q        KC   V  C   CG NA C        CECLPG  GNP+  C    +  ++ D  V    C     G + N   C P+NG            +  C C+P +IG             +  NC PE     +CA+D   +NE+   P      C   C  NA C   N    C C PGF GD    CF        T D+   C P                Q  C C   Y G   NC  +   +S CP                       G   C N         +C I+  C+ +  + IC+   G++G+   +C   I    + + P     C +NA+   +     C CLP + GD            P ++C P+   C+   D   N   C++      C   C   A C        C C  GF G+  +FC             + S C P + C  V     C C T + G           C P C+    C   +   N         +C N + C V          C C  GY GD F RC P   E   PK          C   +QC +    G C C     G   N    C   +EC  N  C                      N S  C C  GY GD               ++  C P  C  NA C   N    C CLP Y G+  S C    +C  N+ C  D++            +  K +DP C   C  +A C       SC C +G +G+  + C +  +        P      C+P   G   QC                V  +  C C  GF G        C   S+C+ N +C                       H   C C   FTG+ F  C +   +P  +E      K+   C P   G    CLD R           S  C CLP Y+G       EC+S   C  +  C+              + +C V   +  CE       DP S   I     PP        + +  CN +  G    CR   E N    C    E      S  +  C   D   R    +  +CQ P C GAC   A C +  N    C C  G+ GD   +C   S  +   I  E     CK    G   QC+  N    ++ C+ + G          EC+ SSE      C Q    +N KCE   C   C  NA C        C C PG+ G+    C    E            C   ++C    +Q  C C+ GY G    CR E  C+ N +C   N +        +RCV                C   C   A C+    N VC C  GY G+ +  C+L      +              + EC  R + +  C C  GF+         + Q   +R       C  +           CN  C   A+C +     TC CPP + G+ +  C                S C  N++C   +    C+C+ GF      C+PE  C  +++C  P K CV                     KC+   C   C   A+C + N    C C    +G           T  N  P+   +     P  PN++C+++ + +  C CLP F     +C P+     EC P                     KCH+        C C+ GY GD    CT               + + C +NA C     C C++++ G+ +  CRP  EC ++ DC RD  K C+                    N C+   C   C  NA CE      +C C+ G+ GD  +NC+              P  CG ++ C+D              VC C+ G+     +C+PE                    PC   C   A+C+    S  C C     GD  + C          V S     C+P   G   +C+            DRN         G  CQC+P F       SP  CRP+C  N  CQ       +  S                 N CP+S   N +C   G      C C  G+   +  QC+  +E  P  C                            S C PNA C   + +  C C   +       C+P  +C + SDC  ++  C       KCQ     I   N+ CY +  V  C            C  G+  +   +C      +V  P+    P   C+  P          N  A+C C + FI     C P                  C  PC K    NA C +     +C+C  D  GD    C            D P+          + S+C  +    SC C   +                   +  CIA+KC  PCD     ++ C     L  C C+ GFTG+           P   C +      + PP     C  +P                  +    + C+P       C P  AC+   C+   P +    ++C + +                VHC+++               N+ C  S +G + C C+ G       C  K EC V+ +C     CVN KC+  CP        G+     +I   PS   +   T D    C+ E               P  T +   QP+      +   +  +    C      +P +C+   S+N           +KCS      C  N  C+       C CD G+  D    CQ+   +   + C+         C+ G C C  E + D    C P  +C T+ DC                    PNAIC        C C   +NG     C P      V       C PN +C  +      +C C PGY+G    C+P
Sbjct: 9075 CSCIPGYLGDPQSGCQPECDINSDCGDTLSCINHKC----------VDPCAGAI-CGINAICNVRQHTPVCLCLDGFVGDAFL-------QCVPIGILKNVSRDPCAPSPCGPHDVCSVYGDGVALCDPCFGPN--AQQNPR-----CRPECVGNSDCPFDRACLGQRCLDPCPGSCGRNAICNVYEHNPVCACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAECKRQHSGLACVCRKGYFGDPHIGCRPECVLNSDCPAEKACLNSKC----------VEACT--GVCGVNAVCRVVNHAPVCICAEGYSGDASIACNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQPECVVSSECAPNQACLNQRCTDPC-PGICGGGARCEVL------------NHNPICSCEANFEGDPFVACSPIQDPGRDIPVPKNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSDKACINEKCQ----------NPCAN--VCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYPNPCAENAVCTPYNNAARCTCIEPYNGDP--YSTGCRPECIYSSECP---SSLACIKQH---CRDPCTAACGANAECTVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVGYFG-------APPQCRPECVVSSECAQ-HLSCIN-------QKCMDPCVGTCGFNAKCQVNNHNPICSCPANYEGNPF--------------------EQCMPKPAEPTRNVDPCLP-SPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVI--NQDCPSNRACIRQRCE----------DPCI--GICGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIVVLDPPTDPCYPSPCGANAICRVRN---GAGSCSCIQNYFGDPYINCRP---ECVQNSDCPNNRACINMKCRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACVERPSNMYLPLPKDPCRPSPCGLFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPSDRACINQRCK----------DPCPG--TCGYNARCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIVPPNPCVPSPCGPNSQCQVSSSGAVCSCVTNYIGRPPGCRPECSINSECPARMACINARCADPCIGSCGNNALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALCEERNQAAACKCLPEYFGDPYVECR--PECVINSDC-PRSRACVNQ--------KC---VDPCPGMCGHNALCAVFNHAPNCECLPGYTGNPIVGCHIVPESPRYPDPIVPENPCQPSPCGLYSN---CRPVNG------------HAVCSCVPSYIG-------------SPPNCRPECMSSSECAQDKSCLNERCKDP------CPGTCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTSDSECP-----------------------GNLACINLRCRDPCVGTCGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGD------------PYTECRPE---CVLNSDCSKNRA-CLNNKCRDPCPGVCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVCSCVTNYIG-------TPPACRPECSVSSECAQDRACVNQRCADPCPGTCGNEAICKVTNH----NPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPNCRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGCNPQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCR--PECVVNSDCSRDKSC-----------VNQKCVDP-CPGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPP----PPERDENPCRPSPCGPYSQC--------------REVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQNLNCQNQKCVDPCPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTE------KSGNPCIPSPCGPNSKCLDVRG----------SPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPP-------DETRNPCNPSPCGANAICR---ERNGAGSCACLPEYFGDPYSGCRPECVQNDDCDRSRACINNKCQDP-CPGACGINAEC-RVLNHGPNCNCFDGYTGDPHRSC---SLIEVVTIRPEP----CKPSPCGPYSQCLDTN---SHAVCSCLEGYIGAPPSCKPECVVSSE------CPQNRACINQKCE-DPCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPE--CTNNDECQ--NHLSCQQ----ERCV--------------DPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECRER-NGAGACYCHDGFEGNP-----YDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKPE--CVVSAECA-PEKACVHK-------------------KCVDP-CQHTCGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGN-SPACSCLPNFIGAPPRCRPECVLNSECGPTEACINQKCADPCSGSCGFEAKCHVLNH--LPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGE-CRCQNNYQGNAYEGCRP--ECTLSADCPRD--KACM-------------------RNRCV-DPCPGICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNG---------HAVCSCLEGYIGAPPQCRPECVVSSECSALQACVNKKCVDPCAAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPNSICK-----------NDRN---------GPVCQCQPEF-----FGSPPNCRPECIINPDCQSTQACINNKCS-----------------NPCPESCGTNAECRVIG--HAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQP--------------------------SPCGPNAECIERNGAAACKCIDEYQGNPYEGCRP--ECVLSSDC-PTDKTCIRN----KCQDPCPGICGLNAQCYAVNHVPNC-----------VCNDGYTGDPFASC---RRVEVTTPSPVSDP---CIPSPCGANSKCRVANGLAVCSCMETFIGAPPNCKPECTVNAECPSNRACHKFRCANPCAKTCGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCRPECVVNTDCSPDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGD-----------PFVRCFEFVEETTKSPPLTQDPCDLQPCGSNAECRNGICSCLADYQGDPYTGCRPECTLSTDCAPTKACLNKKCVDPCPGVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPV-CACQPGMLGSPPAC--KPECIVSSECSLHTACVNRKCVDPCPGAC-----GQFARCQVINHNPSCSCNTGYTGDPFTRCYQE------------ERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIGTPPSCRPECSINPECPPTKACIRQKCSDPCVNACGFNARCNVANHQPICTCDVGYTGDPFTGCQKEQAVKLDDPCNPSPCGPNAQCNNGVCTCIPEYHGDPYSGCRP--ECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQ--AVCSCVPGYIGTPPLCRP 12924          

HSP 5 Score: 200.29 bits (508), Expect = 4.495e-50
Identity = 975/4124 (23.64%), Postives = 1351/4124 (32.76%), Query Frame = 3
Query: 2091 CKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGDGINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFT-CIKSCD---KICHKDALCQNSRCICKPNFEGDGVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCAN--------HAICTVENTCQCRKNYYGNPLEKCN-IDC------------SKCHTDSDCDKTNGY--CKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGDGVETCFHCSQ-----CDSNAICDQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPR--QNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGNCKCNNNLIGDGISSCFDCD-KCSMNARCDVSNQR--CICQPGYEGNG-IKCVKTC---------------FQSCHKLAVCKEGTCKCSNGLTGDGVNFCF-NCSL----------------------CDKNAKCLINEEK--CECMERFEGDGFT-CQDKVDCS------SRCGENAFCY----NGTCKCKLGFQGNPL---EHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCI----KGRCRCLSNLIGDGTTYCFN--------------CSSCARNSDCKP--EQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFD--CKRCSQFADCDPWNER--CVCQSGYIGNGFTCTKIINCV--------TKCHVNGFCENQECKCLPGLIGDGINFC-------FDCS----------------TCDINAFCEPFNE--RCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSICDNNTVCYPDQEKCVCN--PGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKC----KCNERLVGD-GVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKIC------TLRADICRPT-CGENAICV----NGQCQCQSGLQGNPL--------------------KHCFDCRP--CHSFAVCDV--ENRRCICQSGFEGDG--------RNCKKIKECSPK-CHRNAVCINQN----CVCIPEYIGDGINFC-----FNCS------------------SCDRNADCEP--HNNRCTCYQGFTGNGL---------TCNAIELKCEPS-CGENAKC--VNGK--CECLPGLQGNPL---------------QHCFNCK-------RCDKFADCDVWNKK--CVCKNGYMGNGLT-CISVNGCN----------------NKCDSNALCVNRH----CICLPGFTGDGTRFCFDCS---SCPKNSNCLPEE---------------------QKCICQEGYIMNG----------AKCQPIVHECRPG-CGENAKCVN-GKCECLPGLQGNP---------------------MQHCFDC--KKCHKFADCDVWN--KKCVCKNGYFGNGYM-CTPI------NGCNLK-CNENALCVNQK----CICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGN----CECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFN-------CSSCSIEAIC--VPDQEKCICKAGFSGNG---------EQCVENIEGSSPKCHSNALRVNQQ-----CICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGDGIKFCF-------------KCSSCDPNADCVPEQ--QKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGF-RCYPVILECPKCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSK--CECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENL--CVCAQGFTGNGITCKAIDPSCNTNCHKDA------LCFKDSCICKSGLSGDGKNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGDGFSFCFNCSNCSPNA--DCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRKCHEKATCNI--RSMKCECLPGYIGNGFECISITSCTQSSDC-----------IRP-------NEICNVAISQCICE------ANSFL----DPISKLCINPN--CQP-PCHPKAVCV----KGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDC--------------SGCDKNAICTEKQ---GCICKSGFIGDG-----RQCIVLNECADNSDCTTIRGR--------ASECIRSSEGIQKCQCSQGF----------------KLLNGKCEPLSCIYPCAKNAVCIYQK----CECLPGLVG---NGFIKCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSN-SGCVPLT--------------CLSKCHKYANCEN----GVCKCILGYVGDGIICR----LPDECKSSLDCKYE------------NQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGNGYSGCFDCSKCHANADCDESKGCTCKPGFEGNGCYCRPEDKCKFNSDC--NDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGC-PVQCDKNAVCLSNN----CVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCL-PGFQDDNGKCSPKECQPKCH--------MFAICITQTCYCVPGYFGDGIKSCTSCSVCHKNAQCL---PDRGCVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKC----EGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGDGIRTC-------------FKCSSCHARAVCS--------------MDGCKCMPGYVGNGIV-----------------CQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQLGV-CVCKDGYSPSV----NGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEET-----CPNKCHNFAYCR----QKVCQCRLGFQGDGVFNCH-DCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDS-------NAVCTLTYDSLKCQCKLGY---------------IKFNNSLCYPIPCVKQCDRNEEC-LFGQCQCKPGFIHNS----NKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFI----------NKFGYC--------IPINCYQP--CHKNAYC----NIGVCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCDPNA---------VCVLGECICKVGFTGNGL------------------QCMPTSKCNPLSGCSDTN--SVC------IQVPPTNYYDCMCKPGYIKSSNLSI--------CKPIVCEPSCHPKAACII----GSCICMKPLIGNGITEC--KLPDECSASVHCKN----KNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVDCPTRKICVNSKC 12281
            C+C+P F GS   CR E   +  C    +C+N  C           N C +    N E     +   C C  GY GN F  C+   +   K C       N+ CI     E +G   C    KC    Q +P  G   CRP  V       +    +  C  PC          +A+  V N C C   Y G+P   C  ++             S C  +S C   NG   C C   F G    C   C V      A+C   +   K           F C+      C  NA C+  N   IC    +  G                ARC         G     V      + C LN++C  R  Q +C C   F G    C+   +    C P  +CI   C+               CD  C +++ C V N    C C+ G+ G+  ++C +                  Q C   A C+ G C C     GD    C   C+L                      C +N++C ++     C C++ + GD F  C+ +   +      + CG N+ C+       C C+ G  G+P      C     C     C   NRKC+           PC  +C   A+C        C C +   GD  T C+                S C  NS+CK       C+C   ++            C PEC +N +C   K  C+        Q+C D     C   A C+  N +  C C  GY G+ FT  +    V        + C  N  C N  C C+P   GD  + C        DCS                TC  NA C   N    C C  G+ GN                           +C P      VQ C   S C  N+ C    ++ VC+  PGY G          LC  +C  N++C++       KCN+   G  G N   +  + +P   C P        + FVG  +I        +  D CRP+ CG N+ C        C C     G+P                     + C D  P  C S A C V      CIC +G  GD         ++ + I  C P  C  NA CI +N    C C+ +Y G+    C      N                    SC +NA+C    H   C C+ GF G+             +     C+PS CG N+ C  VN +  C C    +G P                + C N K        C + A C+V N    C C    +G+    CI                      + C   A C N+     C CLP + G       +CS    CP +  C+ E                        C+C  GY+ +              +     C P  CG NA C N G+C+C+   QG+P                      Q C D     C   A CDV N    C C +   GN ++ CTP+      N CN   C   A C  Q     C CLP + G       +CS    N +C P             N++   P      C   C   A+C   N    C C PG+ G+ I  C       ++        +  C+P   G    C ++G    C    +        + +C+       +  C N          C  +A+C  +     C C+ G+SG+           + +E ++  +P          QQ     C CLP + G+    C     C  +SDC P +  C+ +K        C   G+  +C  + H         C CL G++GD  ++C              + S C PN+ C  +     C C   F G           C P C     CN  K    + ++   +  C        N +       C C  GY GD F RCYP+    P  H         CQ                S C  NAQC  +  +  C C   Y G   NC      S +C  +  CIN  C             C     C  NAIC    ++  C C  G+ G+  T          NCH +       +   D C               +   C  NA+C+    +C C PE++GD +             C P  V   +C R +          C     C+PNA  D   H++ C+C E  TGN FI    +C+   +   SL   + C+  P              C   + C +   +  C C+  +IG    C     CT +SDC           I P       N +C+V     IC        N FL    +P+ +  + P   CQP PC P A C     + +C C    +G    CR   EC  +++C            S  K C         L  +C+ P C+G C S A C   S+  + C CLPGF GD  T+C                 + C  NA+C ++     C C   + G+       +C+  N+C  N  C   + R         +   R    +  C C  GF                K     C+P     PC  N+ C        C CLP  VG   N   +C   +EC     C  Q+      G  G    CR+     +                    C C++ F     S C+PL                 S C +YA C +      C C+  Y G    CR    +  +C S L C+ +            N  C   ++ +  C C  GF   +  S  V    +++   +    C  I C P    +A+C  G C C P F GN   GC    +C  + +CD SK C        N C       C  N+ C  +  + +C   P+ + N   +    P    + +I  C P  C  NA C + N    C C   + G   +C+P  +C  N++CP        +    R C    PG    N +C      P CH         FA C       +     + I  C   S C  NA+C     +  C C S FIG   NCRP  EC  N DC              NL C        +N  C    C   C  NA+C       MC CL+G  G+                   F  CQ+  D       CV           P PC  N        +G C C  E  G+    C               C + H R  C               +  C C  GY GN  V                 CQ    C  +S CR+ N            C+C P F     + SP ACRP+C  +S+C L + CV +    P      N   C  I+H         S H     G        C++   P        ET      P+ C  F  CR    Q +C C  G+ G    NC  +C++   N  C+  L C                     I   CRD         A C++   +  C C  GY                   +  C P PC      N  C   GQC C P F  N        CV   DC  +         + C G     A+C  R              N F  C        +P+N  QP  C  NA C    +  VC+C P + G      K +  C  +SDC                         +  C+ ++C  PC P A         +  +  C C  GF+GN                     C P S C P + C++ N  ++C      I  PP       C+P  I SS   I        CK   C   C   A C +     SCIC+   IG+  T C  + P +      C       NA C+   E    C C   +   N     + EC +N DC +   C+N  C
Sbjct: 12072 CQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCS----------NPCPESCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECI-----ERNGAAAC----KCIDEYQGNPYEG---CRPECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAVNHVPN-CVCNDGYTGDPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPPNCKPECTV-----NAECPSNRACHK-----------FRCANPCAKTCGLNAKCEVINHNPICSCPLDMTG-------------DPFARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCRPECVVNTDCSPDQACIAEKCR-------------DPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQDPCDLQPCGSNAECRNGICSCLADYQGDPYTGCRPECTLSTDCAPTKACLNKKCVDPCPGVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACV--NRKCV----------DPCPGACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIG-------TPPSCRPECSINPECPPTK-ACIR-------QKCSDPCVNACGFNARCNVANHQPICTCDVGYTGDPFTGCQKEQAVKLDDPCNPSPCGPNAQCNNGVCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGYNGNAF------------------------VQCKPTPPPALVQPCQP-SPCGPNSQCREVNQQAVCSCVPGYIG-------TPPLCRPECTSNSECLSHLACVNQKCNDPCPGSCGRNAQCSVVNHNPFCTCLPRFT----GNPFVGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECPSNLACINQKCRDPCPGLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGANAECIQRNGAGACQCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDPCPGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPIVHEYVNPCQPSPCGPNSNCREVNEQAVCSCRSEFEGAPPNCRPQCTSSSECASNRACINQKCVDPCPGVCGQQAICEVRNHSPICRCPTAMIGDPFVRCIPRPTIAPPPLRDVAPYRDPCLPSPCGLYASCRNQQNQAVCSCLPNYFGTPPHCRPECSINAECPSHLACIGERCRDPCPGACGQQTECRVISHVPSCVCLRGYVGDAFLACHPAPPPPSREEPRDPCNPSPCGSNAICSNQGECKCVADYQGDPYVACRPECVLSSECPRNLACIQQKCTDPCPGTCGTNAICDVVNHIAMCHCPDRMTGNAFVQCTPVQLDVYRNPCNPSPCGSYAECREQNGQAVCSCLPNYFGVPPSCRPECST---NYDCSPSLA--------CQNQRCVDP------CPGACGAYAECRTVNHSPFCSCRPGYTGNPIVQCHMIIEPQRD-----ITPKDPCQPSPCGPNSECRRVGETPSCSCLSNFFGTPPNCRPECVSNSECSQVHVCSNNRCKDPCPGLCGTDAVCRVISHSAMCYCQPGYSGDPFVRCAPHIQRESIEIVQPCNPNPCGAFAECRQQNGVGSCQCLPEYFGNPYEGCR--PECVLDSDC-PSQLACVNQKCRDPCPGSC---GQNAECFVRNH------LPTCNCLSGYVGDPYRYCSIEPKPIREYVNPCQPSPCGPNSQCREQNGVATCSCLPEFVG-------TPPGCRPECTVSSECNLDK----ACVRHKCLDPCPGACGSSANCQVVNHAPLCSCQAGYTGDPFTRCYPI--PSPPTHIVHDYARHPCQP---------------SPCGANAQCRQSQGQAICSCIPNYFGVPPNCRPECTQSSECLSSLACINQRC----------ADPCP--GSCAYNAICHVRNHVPSCQCPVGYVGDPFT----------NCHPEPQPPPKPVALDDPC---------------NPSPCGANAVCQ--NGQCSCIPEYQGDPY-----------TGCRPECVLNADCPRNRACVRHKCVDPCPG--TCAPNAICDVINHIAMCRCPERMTGNAFI----QCE---TPPVSLAPPDPCYPSP--------------CGPNSRCRVFNNNAVCSCIEDFIGTPPNCRP--ECTHNSDCLPRLACQRQHCIDPCPGTCGFNALCHVVNHAPICSCPPKHNGNPFLGCFPEPVRRDEVIPKNPCQPSPCGPYAKCTSVGDQAQCSCLPEYIGTPPNCRP--ECITNSEC------------SFDKAC---------LNQRCRDP-CSGTCGSNANCHVISHT-AMCYCLPGFTGDPFTSCVQVPVIQQAEIVQPCSPNPCGANAVCRQEGHVGSCQCLPEYYGNPYETCRPECVTNNDCPSNKACQQQKCRDPCPGVCALNALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVLKEYINPCQP----SPCGPNSQCRENNEQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPCPGVCGSNADCRVIQHAPI--------------------CSCRAGFTGDAFSRCLPLPPSRPPQLDVYRNPCVPSPCGQYAECRDNQGTATCSCLPSYFGTPPNCRPECTINPDCPSHLSCQQQRCRDPCPGACGFNALCTV-INHNPTCQCAPGFIGNAFTSCHVP-PPIVRDPPQISDPCDLITCGP----NAVCNQGQCNCLPEFVGNPLVGCR--PECVLSTECDWSKACV------RNKCIDPCPGTCGSNAICEVHRHIAMCHCPPEMTGNAFSQCRPLPPAPVRDVIDPCQPSPCGPNAQCRNINGQAVCSCLRDFIGVPPSCRP--ECVSNAECPL------HLACLQRHCRDPCPGVCGLNAECRVINHSPNCHCIGSFTGNPFAACHRPPPPPI---KHEPIDPCQP-SPCGANAECRVQGSNAQCSCLSGFIGTPPNCRP--ECVSNSDC------------PMNLAC--------LNQKCR-DPCPGVCGSNAECYVINHTPMCTCLAGQTGN------------------PFVSCQVVRDVPEPQTPCV-----------PSPCGANALCSEGNGAGACKCLPEFYGNPYEGCRPECVLNSDCPSHLACLNQHCRDPCPGTCGINAECQVRDHLPQCNCHVGYQGNPYVYCSVLRDPLPEPVPSRPCQ-PSPCGPNSQCRESNNQAI--------CKCLPNF-----IGSPPACRPECTISSECDLTLACVQQHCVDPCPGVCGNSAQCRVINH---------SPHCSCLPGFTGDAISGCQR-IPPAITHDAPNETPRDPCVPSPCGAFGQCRAQGNQAICSCLPGYYG-APPNCRPECAI---NPDCASHLAC---------------------ISEKCRDPCPGSCGLQAQCSVINHTPICSCPSGYEGNPFVRCQRTPPTPTPPLHDACNPSPC----GSNAICSPGGQCSCLPDFDGNPYVGCRPECVLNTDCARDKACQRSKCTDPCPGACGIGAVCEVRNHIPTCNCPPGTSGNAFVQCTLVQSSPVVPLNPCQPSPCGNNAQCREVNDQAVCSCLPGFFG---VPPKCRPECTINSDC-----------------------APHLACLNQQCRDPC-PGACGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYP-SPCGPNAECTNQNEQAICKCLKDYIGTPPN------CRPECITSSECPIQLACIGQKCK-DPCSGLCGIAATCQVVSHVPSCICIADYIGDPYTGCYARPPIQREQINPCYQNPCGSNAVCRERGEA-ASCQCLPEY-YGNPYEGCRPECVLNSDCSSHLACLNQHC 15713          

HSP 6 Score: 196.438 bits (498), Expect = 6.421e-49
Identity = 1000/4017 (24.89%), Postives = 1384/4017 (34.45%), Query Frame = 3
Query: 2109 FVGSGYECREEVNCDIKCHENAS------CVNGYCKCNR-----NLIGDGINSCFDCLKCNTEADCSPYENR--CYCRPGYTGNGFTC--IKSCDKICHKDALCQNSRC---------ICKPNFEGDGVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANHAICTVENTCQCRKNYYGN-PLEKCNIDCSKCHTDSDCD--------KTNGYCKCRYGFFGDGFTCN-----KTCCVEKCHEQAQCV--DG--KCLCKPGFSGDGVETCFHCSQCDSNAICDQNNK--------ACICKSGF-----------------------------------EGNGINCLRAINCKQ-----KCHKQARCL----LGKCICNKGLNGNGVEYCFNCTSCH-----LNAKCIPRQNT--CECNSGFHGDGIQ-CKLLPLCTPACHP---QASCING----NCKCNNNLIG--DGISSCFDCD---------KCSMNARCDVSNQRCICQPGYEGNGIKCV-----KTCFQSCHKLAVCKEGT----CKCSNGLTGDGVNFCFNCS----LCDKNAKCLINEEKCECMERFEGDGFT---------CQDKVDCS------SRCGENAFCYNG----TCKCKLGFQGNPLEHCFDCRVCHYPAY--------CDIPNRKCIC------ITENDIFSRTPCSFSCHPNAKC-------IKGRCRCLSNLIGDGTTYCFNCSSCARNSDCKPE--QQTCTCKRGYVKD---GNNCSIISA-RCHPECGVNAQCINGK----CECLAGLQGNPFQQ---------CFDCKRCSQFADC--DPW--NERCVCQSGYIGNGFT--CTKIINCVTK-----CHVNGFCEN----QECKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVK-----GKCECLPGLRGDGVQSCFDCSICDNNT----------VCYPDQEKCVCNPGYYGDGTT--CFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADIC-RPTCGENAICVNG---QCQCQSGLQGNPLKHCFDCRPCH-------SFAVCDVENRRCICQSGFEGDGRNCKKIKEC-SPK--------CHRNAVCINQNCVCIPEYIGDGINFCFNCSS--CDRNADCEP--HNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCV----NGKCECLPGLQGNPL-------QHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNG----KCECLPGLQGNPMQHCFDCKK-------CHKFADCDVWNK--KCVCKNGYFGNGYM-CTPINGC-NLKCNENALCVNQ----KCICLPGFIGDGI--------KFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCT-SKCHKNAKCLKGNCECLPGFVGDGIQVCFNCST----------------------------------CDKNANCFPYQER--CVCKPRYSGNGENCVKIG--PESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNG-----EQCVENIEGSS------PKCHSNALRVNQQCICLPGFIGDGKNFCF-DCSTCPPNSDCLPQEQ--RCIC-----------------KKDYFMNDTQCIHT--------GRTPQCVP-----KCHHYASCV----QDKCECLPG-FIGDGIKFCFKCSS--CDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTC-----EPPCAPGGFC----NNSKCQCNSGLKGDGV--TSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGFRCYPVILECPK---CHYRAQCVIGKCQCK-NGLQGDGI--NFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECS---PKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCA---QGFTGNGITCKAIDPSCNTNCHKDALCFKD-SCICKSGLSGDGKNYCFDCKRCDQNAICRPTEQRCVCK-PEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCC----RCKNGFFGDGFS---FCFNCSNCSPNADCFPHLSKCQCKEEFTGN----GFICQR-KECKPACSE-----ATSLCIKNQCFCRPGLIGDGYNCLDC-----RKCHEKATCN--IRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDP-ISKLC-INPNCQPPCHPKAVCVKGKCICNRNLVGDG---------YQCRAPEECNNDADCVQFQEVCRK--DQSS----------LKKICKCKDG--LVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTT-CTDCSGCDKNAICTEKQGC---ICKSGFIGDGRQCIVLNECADNSDCTTIRGRAS-ECIRSSEGIQKCQCSQ----------GFKL-LNGKC-EPLSCIYPCAKNAVCIYQK----CECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDGIICRLPDECKSSLDCKYE-------------------NQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNP-----------------------KCHRSALCVI----GTCKCPPSFKGNGYSGCFDC-----SKCHANADCDESKG---CTCKPGFEGNGCY--CRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNG--KCIILGCPVQCDKNAVCLSN----NCVCKTGYSGTGLN----CKP-NDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDN----------GKCSPKECQPK-CHMFAICITQT----CYCVPGYFGDGIKSCTSCSVCH----------KNAQCLPDRGCVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCP-INC--HPLAQCKSGKCVCQGELQGDGIRTCFKCSSCHARAVCSMD-GC----KCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPG--VDKGKKCQCKPGFSLENSLC-SPIACRPKCGKNSQCQL----GVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNFAYCRQ-KVCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYI-------KFNNSLCYP--------IPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCI-PINCYQPCHKNAYCNIG----VCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCDPNAVC-------VLG---ECICKVGFTGNGLQCMPTSKCNPLSG-CSD----TNSVCIQVPPTNYYDCMCKPGYIKSSNLS-ICK-PIV---CEPSCHPKAACIIGSCICMKPLIGNGITECKLPDECS---ASVHCKNKNAFCKNSTEG-QMKCICKHGFQLENSKCISKQECRVNVDCPTRKICVNSKCICP 12290
            F+G+  E  +E+ C   C ++ +      C+NG C CN      N +    N C     C+  A C+       C C PGY GNGF C  I  C          +N+ C          CK  +EGDG   C D  +C     C P    CT  P                GN               TC C   Y GN P  +   D  +C   + C         + +  C C  G+ GDG + +       C    C   A C+  DG  +CLC  G+SGD +  C    +C +N  C    +         C C SGF                                    G G+ CL    C Q     KC   A+C+      +C+C  G  G G  +C N   C       NA C     +  C C   + GD  + C  +  CT    P    A C N     NCKC     G  D   +C   D          C+ NA C + NQ C C  G+E  G  CV     +T  + C   A C        C+C  G  G               C  +A C  ++ +  C+     DG+T         C D  +C         CG+NA C N     TC C  GF G+P   C D   C   A          ++P     C      I + D   R     SC  N  C          RC C    IG+   +     +C  ++ C     Q  C C  GY  +      C+ I   R +P C   A C N      C+C  G  G+P+++         C D   C+    C  D +  N  C+C+ GY  N     C  +  C  +     C +N  C+N     EC+C  G  G+    C  C+T             C C   +   G  C +L+  +  +AC   A+C+        C C  G +     SC D   C+             V  P    C C  GY GD     C L  + C           +R+C  NE+ +  G                     EC C   +  D +        C R  CG NA C      QC C++G +G+PL  C D   C        ++ V      +C+C   + GD      I E  +PK        C  N  C+  +CV               CSS  C  NA CE   H   C C  G+  NG   + +    +  CG+ A C+       C+C  G  GNP          C   + C +   C     K  C+    G G TC   NG               CIC P F G+    C             P EQ                    +C PGCGENA C  G    +C C PG  GNP + C    K       C   A+C        C+C  G+ GN Y+ C  ++ C N  C  NA C+N+    +C+CL G  G+          KFC D + C  N       +  +C + Y   +  C       LC+ + C   A C  GNC C  G++GD       CS                                   C  NA C     R  C+C   + GN  N +++G  PE   P +  K               S +GIK C N  S     +C P++   +CK   +G+      E  V N   SS      P C S+A        C P  +G  K     D  TCP NS C+ ++   RC C                 +K +  N  +C  +         +T  C P     KC   A CV    Q +C+C PG F GD       C S  C  N DC P Q               C+++  TC     E  C     C    + + CQC  G KGD +   +C     C     C PS    IC +  +G   +C P+ +   K   C    QC  G   C  N +   G+  N C N   C  NA+C     K  C    R    +    D C+    KC  +  C  + C     Y G     C N   C     C   +N+CV A        +G+ C  ++  C   C  +  C +D SCI    L     N C     C  NA+C   +    C  PE    GF+     +  C        VRV   C    +C +G    G      C   ++C+    C+  + +  C   +T N    G IC   + C+P C        T LC+  +C C  G IG  + C D      + CH  A C     + +C C  G +G+G+   S   C+Q   C +P++  N       C      DP +  +C IN NCQ   H      +  C C    +GD           +C    +C  D  C      C K  D +S           K  C C +G  LV D+     +   +  CHS A C       S C C  G +GD +   C D + C  +A C     C    C+S        C   N C  N++C     +A   C  +S G    +C            G K  L+ KC +P S    C   A C  Q     C C  G  G+  + C     C +   C   +G +CSHG             CS N DC    ++C+     V +  CKS+              S C ++  C N +C          + CR   EC     C  +                   N ECVAR   +  C CK GF                     A SGC  I+C                          C  +ALC        C C P F G+    C        + C   A C  ++G   CTC PG  G+     CR   +C+ N DC  P   C +                 TNG  KC  +   +QC  NA C+       C C++GY G   +    CKP    C    DCP           Y    VC P    D           G+C     QP+ C   A C+ Q     C+C  G+ GD  K C    V            +++ CLP    VC +D            EC  NE C      C+L   + N           + + CL  +C   CH +  C      C +        C  P    ++NPC    + C +++   R  C C+           P P P + C   P  +C+  +        G+G+  CF+ S C  R +C+ D GC    +C  G      +C+ +++C +   C   N  C PG   D+G    C P  S     C  P A    CG N+ CQ       C+C +G   + N     P   C    DC  SN  C Y G  QGK   CR      +  +C+  TC   C+    C Q ++C+ R+   G           C  +  C+    C           + C+  + CR    C    A C +    ++CQC   ++       +     C+P          C  +C R E+C  GQ QC  G   N    C     C V     C+     C+    +   C   +  +N  G C  P    + C +NA C +     +C C   Y G+    C +   C  D+DC                         N +C   KC  PC     C       V+G   +C C   F GN     PTS+C PL G CS      NS C +VP    Y+C C  G I  ++   +C  P+V    +  C   AAC +         + N   EC  P++     A V C          T G ++    + G++    +    ++C  + DCP+ K C+   C  P
Sbjct:   81 FLGAD-ELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGYGGCNCVDKDENECKQ-RPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPN-ALCTNTP----------------GN--------------YTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAEC-IENQ-CFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCE---DGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANP-CAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNT-----------PECQCQSPYKLVGNSC-VLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCA---------ADRECAANEKCIQPG---------------------ECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLLGCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCV-------------SPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDG-DCVSQCQDVICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVCGIGATCDRNNG--------------KCICEPNFVGNPDLICMP-----------PIEQA-------------------KCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCN-------ERVECPEGYSCQKGQCK-----NLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSN-LQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCS---NVVCGPNE---LCKINPAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDA-NCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQM--------------CNRMTHTCFDVCDEESCGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGC-AAGTCHPSA---ICEVTPEGPVCKCPPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDN--ACGSNAECKVINRKPVCSCPLRFQPISDTAKDGCARTISKCLTDVDCGGALC-----YNGQCRIACRNSQDCSDGESCL--KNVCVVACLDHSQCASGLAC--VEGHCTIGCRSNKECKQDQSCIENKCL-----NPCQSANSCGPNALCSIDQHHSQCSCPE----GFEGNPTPEQGC--------VRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAVGERCYQQVCRKVC---YTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGY---SQPGCSQPRQCHKPDDCAN----NLACIHGKCTDPCLHTVCGINANCQSEGH------EALCSCPAGFLGDPNDTGVGCFKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINE-CLSQPCHSTAFCNNLPGSYS-CQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRS-------PCERQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQC--AQGSICSHGI--------CSPLCSTNRDCIS-EQLCLQG---VCQGTCKSN--------------SSCPQFQFCSNNICT-------KELECRSDSECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVAR-SHAPDCLCKEGFFGD------------------AKSGCRKIECTSDDDCSNDKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDC-PPHAACTK-----------------TNGVAKCRDVCAQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCP--------TNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMCLP----VCHNDL-----------ECASNEKCL--KGSCMLTCRVDN--------DCFLGHVCLHNKCVYGCHVDDDCSASE-SCRND------KCVNPC---LENPCGPN-AACSVSN--HRASCSCLESMV-------PNPTPQVGCVRSPPLECRENRDC------GNGL-ACFE-SVC--RPLCADDAGCLTNERCQQGVCK--PLCRHDNECGHGELCLGLN--CVPGCRSDQG----CPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCLCPEGLDGNANVACKVPRIACGRNEDC-QSNQLC-YAGSCQGK---CRNDQNCLADERCMRGTCRTVCNTDEACAQGQICENRMCQTG-----------CRTDLSCATDEACV---------NKKCQ--NPCRTPGQCGQC-ADCLVVNHGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQ-QCARGKCRNK---CGPKRQCTVGQ--LCER--GACIAGCKSNGDCAADQSCVN--GKCSDPCANEKACGRNALCTVSEHRMLCYCPDGYEGEPSKECVQFE-CRVDTDC-----------------------DSNKRCDQGKCRNPCLEYGACGTNAQCRVVGRKAQCSCPPDFFGN-----PTSECRPLEGGCSSKPCGENSKCTEVP--GGYECACMDGCIGDAHQGCLCGGPLVNACRDQPCGLNAACHV---------LENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRTLGCEVGGCVRQGYEYVCQQ--DTEQCYSDTDCPSEKSCLQGHCSDP 3644          

HSP 7 Score: 196.052 bits (497), Expect = 7.039e-49
Identity = 980/4084 (24.00%), Postives = 1340/4084 (32.81%), Query Frame = 3
Query: 2091 CKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGDGINSCFDCLKCNTEADCSPYENR--CYCRPGYTGNGFTCIKSCDKICHKDALCQNS--RCICKPNFE-------------GDGVN---YC-------FDCSK----------------CHKLAQCH--PKTGNCTCRPPYVGDGVSECETFLPK----GNCFP-PCANHAICTVEN---TCQCRKNYYGNPLEKCNIDC---SKCHTDSDCDKTNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQC----VDGKCLCKPGFSGDGVETCFHC--------------SQCDSNAICDQNNK--ACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNT--CECNSGFHGDG-IQCKLLPLCTPA-----------CHPQ-----ASCINGN----CKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKE----GTCKCSNGLTGDGVNFCF---------------NCSLCDKNAKCLINEEKCECMERFEGDGFT-CQDKVDCSSRCGENAFCYNGTC--KCKLGFQGNPLEHCFDCRVCHYPAYCDIPNR-------KCICITENDIFSRTPCSFS-CHPNAKCI----KGRCRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQC--INGK--CECLAGLQGNPFQQC---------FDCKRCSQFADCDPWNE--------RCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCL-PGLIGDGINFCFDCSTCDINAFCEPFNER--CVCSVGFTGNG----------KKCSILAPITCKRACHKKAKCVK----GKCECLPGLRGDGVQSCFDCSICDNNTVCYPDQEKCVCN------PGYYGDGTTCFLFSQLCTEKCHPNAKCVN-------RKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQ--QECSCKSEFVGDGKICTLR------------------ADICRPTCGENAIC--VNGQ--CQCQSGLQGNPLKHCFDC------------------RPCHSFAVCDVENRRCICQ--SGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPHNN--RCTCYQGFTGNGLT-----------CNAIELKCEPS-CGENAKCVNGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALC-VNRH---CICLPGFTGDGTRFCFDC------------SSCPKNSNC--LPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDC--KKCHKFADCDVWNKK--CVCKNGYFGNGYM-----------CTPINGCNLK-CNENALCVN----QKCICLPGFIGDGIKFCFDCSACPANSNCVPE-KKECKCAKDYF-MNEKICSPIKQPVLCTSKCHKNAKCL----KGNCECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNAL-RVNQQ---CICLPGFIGDGKNFCF--------------DCSTCPPNSDCLPQEQRCICK--KDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDK-----------------------------CECLPGFIGDGIKFCFKCSSCDPNA------DCVPE-------------QQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKC--FPSVKKCICVIGYKGDGF-RCY---PVILECPK---------CHYRAQCVIGKCQCKNGLQGDGI----NFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCIN----SNCHCLPMYTGNGVSFCF--------------NCAQCDANAICKP--DENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALC-FKDSCICKSGLSGDGKNYCFDC--KRCDQNAICRPTEQR--CVCKPEFRGDGFQC-----ALNLKTTCQNDCHPNAVRVNNCCR---------CKNGFFGDGFS------------FCFNCSN----------CSPNADCFP--HLSKCQCKEEFTGNGFI-CQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYIGNGFE-----CISITSCTQSSDCIRP------------NEICNVA--ISQCIC----EANSFL------DPISKLCINPNCQP-PCHPKAVCVKGK----CICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAICTEKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYP-CAKNAVCIYQKCE-----------------------CLPGLVGNGFIKCT--------------NCSECHKKALCHDQRGCVCSHGYSGDG-IQCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCEN----GVCKCILGYVGDGII-CRL-------------PDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRS--------ALCVIGTCKCPPSFKGNGYSGCFDC----------------SKCHANADC---DESKGCTCKPGFEGNGCYCRPE----DKCKFN-----SDCNDP------LKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSN----NCVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDNGKCS---PKECQPKCHMFAICITQTCYCVPGYFGDGIKSCTSC---------------SVCHKNAQCLPDRG---CVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCEG----GMCQCLSGFIGDG-INCQ--------RPFECGIDNPCKD----QFSVCQLTSDAKRFVCVCVFGFQMINSKCQPE--------------------PCPINCHPLAQC----KSGKCVCQGELQGDGIRTCF------------------KCSSCHARAVCSMDGCKCMPGYVGNGIV-----CQTEDQCQYDSDC-RDRNAACFPGV----------DKGKKCQCKPGFS-------LENSLCSPIACRP----KCGKNSQCQ----LGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDS----NHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNFAYCR----QKVCQCRLGFQGDGVFNCHDC-----------------SVCHPNAICSPSLG---CTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEECLF----GQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCR--KGFINKFGYCIPINCYQPCHKNAYCN----IGVCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCDP----NAVC----VLGECICKVGFTGNGLQCMPTSKCNPLSGCSDTNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVCEPS--CHPKAACIIGSCICMKPLIG---NGITECKLPDECS---ASVHCK 12125
            C C PG++G+   CR E   + +C  + +CVN   KCN    G           C   A CS   +   C C P +TGN F   +   +   +D + Q+      C PN E             GD V    YC        +C                  C   A C     T  C C     GD  ++C+  +        C P PC  +A C   N    CQC  +Y+GNP E C  +C   S C ++  C +     KCR              C   C + A+C        C C  GF GD    C                 S C  N+ C + N+   C C+S FEG   NC        +C     C+  KC          V+ C     C   A C  R ++  C C +   GD  ++C   P   P            C P      ASC N      C C  N  G     C    +CS+NA C  S+  CI        G +C   C  +C +   C+      +C C  G  GD    C                N S C  NA C  N+ +C+C+  ++GD +  C+ +   SS C  N  C    C   C      N +     C V ++ A C  P+R       +C  + + D++ R PC+ S C   A+C     +  C CL N  G   +    CS+   N DC P   +  C+     D          C   CG  A+C  +N    C C  G  GNP  QC            K   Q + C P +E         C C S + G    C       ++C     C N  CK   PGL             C  +A C   +    C C  G++G+           +   I+ P      C   A+C +    G C+CLP   G+  + C    + D++    P Q  CV        PG  G    CF+ + L      P   C++       R C    + + + VN C   + C P++ C        CSC  EFVG    C                      D C   CG +A C  VN    C CQ+G  G+P   C+                     PC + A C     + IC     + G   NC+     S +C  +  CINQ C           + C    SC  NA C   N+   C C  G+ G+  T             A++  C PS CG NA C NG+C C+P  QG+P   C     C   ADC   N+ CV              V+ C   C  NA+C V  H   C C    TG+    C               S C  NS C        C C E +I     C       RP C  N+       +CLP L     QHC D     C   A C V N    C C   + GN ++             P N C    C   A C +     +C CLP +IG                NC PE     +C+ D   +N++   P      C+  C  NA C        C CLPGF GD    C       +     P      C P   G    C + G    C               +CL  + G+  +TC           CV + +   C +  +   ++C +   G    C  NAL RV      C C  GF+GD   +C                 S C PNS C    ++ IC    +Y          G  P C P+C   A C  DK                             C C  GF GD    C       P         CVP                 C C   ++G    C + E T  P C     C   +C+            C     C  NA C        C C  G+ G+ F  C+   P++ + P+         C   A C  G+C C     G+ +      C+  +ECD +  C  N  KC               ID C   C  NA+C      + CHC P  TGN  S C                 + C  NA C+    + +C C + F G       + PSC   C  +A C    +C+         + +C D     C  NA CR       C C   F G+ F          +K    + C P+    N  CR         C +GF G   +                C N          C  NA+C+   H   C C    TGN F+ CQ     P   E  + C+ + C         G N L    C E       +  C+CLP + GN +E     C+  + C     C+              N  C V   + QC C    + N ++      DP+ +   +  CQP PC P + C +      C C  N +G    CR   EC   ++C                     D  +  +Q  C  P C G C + A C +  N    C CLPGF GD ++ C        +    E     C     G   QC               R + ++ I        C C  G+      C P   I P CA +  CI +KC                        C  G  GN F++C               N S C   A+C     C C   + G+  + CR E               C+ +TD  +   C+ S  +         C   C   A CE       C C  G  G+  + C L             P  C ++  C+  N + V        C+C  GF     K      +  I      +  C+   C   C  +         +  +  C CP  F GN +  C                   S C  NA+C   +E   C C   + G    CRPE     +C          C DP      +    Q      +C+C           C     P+Q ++   C  N    N VC+         C P    +    C      C +  D +    CL      N  C    P  C P      +    +C C PGY GD  + C                  S C  N+QC   +G   C C  D+ G    CRP  EC  N +C + +K C+      + +CT                C   C +NA C        C C  G+ GD  + CQ        R       +PC      QF+ C++  + ++ VC C+  +      C+PE                    PCP  C   A+C        C C     GD    C+                  + S C   A CS   C C+P Y G+  V     C    +C +D  C R+R     PG           +    CQC  G+         +  L +P+   P     CG + +C+      +C C+ GY  S    +C P   C S+ +CP S    N KC                           + CP  C + A C        C C  G+ G     CH                   S C P+A CS   G   C C   +L G    C+P  +C  +S+C    A       + KCQ                PC   C  N  C        C C PG + N   +C+ P   ++  PA+           P   AI V +  + FIN    C P     PC  NA CN    +  C C PDY G+   +C+ +  C+ +SDCP+                       +  C+ +KC  PC      NA C     L +C C  G+TGN L                  + C  VP             I+ S L+ C P  C P+  CHP     +  C C+    G   N   EC L  EC+   A VH K
Sbjct: 12909 CSCVPGYIGTPPLCRPECTSNSECLSHLACVNQ--KCNDPCPG----------SCGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECPSNLACINQKCRDPCPGLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGANAECIQRNGAGACQCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQ----KCRDP------------CPGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPIVHEYVNPCQPSPCGPNSNCREVNEQAVCSCRSEFEGAPPNCRPQCTSSSECASNRACINQKC----------VDPCPGV--CGQQAICEVRNHSPICRCPTAMIGDPFVRCIPRPTIAPPPLRDVAPYRDPCLPSPCGLYASCRNQQNQAVCSCLPNYFGTP-PHCRP--ECSINAECP-SHLACI--------GERCRDPCPGACGQQTECRVISHVPSCVCLRGYVGDAFLACHPAPPPPSREEPRDPCNPSPCGSNAICS-NQGECKCVADYQGDPYVACRPECVLSSECPRNLACIQQKCTDPCPGTCGTNAI-----CDVVNHIAMCHCPDRMTGNAFVQCTPV-QLDVY-RNPCNPSPCGSYAECREQNGQAVCSCLPNYFGVPPSCRPECST---NYDCSP---SLACQNQRCVDP---------CPGACGAYAECRTVNHSPFCSCRPGYTGNPIVQCHMIIEPQRDITPKDPCQPSPCGPNSECRRVGETPSCSCLSNFFGTPPNCRPECVSNSECSQVHVCSNNRCKDPCPGL-------------CGTDAVCRVISHSAMCYCQPGYSGDPFVRCAPHIQRESIEIVQPCN-PNPCGAFAECRQQNGVGSCQCLPEYFGNPYEGCRPECVLDSDC---PSQLACVNQKCRDPCPGSCGQNAECFVRNHL------PTCNCLSGYVGDPYRYCSIEPKPIREYVNPC-QPSPCGPNSQCREQNGVATCSCLPEFVGTPPGCRPECTVSSECNLDKACVRHKCLDPCPGACGSSANCQVVNHAPLCSCQAGYTGDPFTRCYPIPSPPTHIVHDYARHPCQPSPCGANAQCRQSQGQAICSCIPNYFGVPPNCRPECTQSSECLSSLACINQRCA----------DPCPG--SCAYNAICHVRNHVPSCQCPVGYVGDPFTNCHPEPQPPPKPVALDDPCNPSPCGANAVCQNGQCSCIPEYQGDPYTGCR--PECVLNADCP-RNRACVRHK----------CVDPCPGTCAPNAICDVINHIAMCRCPERMTGNAFIQCETPPVSLAPPDPCYPSPCGPNSRCRVFNNNAVCSCIEDFIGTPPNC-------RPECTHNS-------DCLPRLACQ-RQHCIDPCPGTCGFNALCHVVNHAPICSCPPKHNGNPFLGCFPEPVRRDEVIPKNPCQPSPCGPYAKCTSVGDQAQCSCLPEYIG-------------TPPNCRPECITNSECSFDKACLNQRCRDP------CSGTCGSNANCHVISHTAMCYCLPGFTGDPFTSCVQVPVIQQAEIVQP------CSPNPCGANAVCRQEGHVGSC---------------QCLPEYYGNPYETC--------RPECVTNND---CPSNKACQQQKCRDPCPG---VCALNALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVLKEYINPCQPSPCGPNSQCRENNEQAICSCLPEYV---------GAPPNCRPECVTSAECPHDKACIRQKCNDPCPGVCGSNADCRVIQHAPICSCRAGFTGDAFSRCLPLPPSRPPQLDVYRNPCVPSPCGQYAECRDNQGTATCSCLPSYFGTPPNC-RPECTINPDCPSHLSCQQQRCR----------DPCPG--ACGFNALCTVINHNPTCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDLITCGPNAVCNQGQCNCLPEFVGNPLVGCRPECVLSTECDWSKACVRN--KC---------------IDPCPGTCGSNAICEVHRHIAMCHCPPEMTGNAFSQCRPLPPAPVRDVIDPCQPSPCGPNAQCRNINGQAVCSCLRDFIG-------VPPSCRPECVSNAECPLHLACL---------QRHCRDPCPGVCGLNAECRVINHSPNCHCIGSFTGNPFAACHRPPPPPIKHEPIDPCQPSPCGANAECRVQGSNAQCSCLSGFIGTPPNCRPECVSNSDCPMNLACLNQKCRDPCPGVCGSNAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVP---EPQTPCVPSPC---------GANAL----CSEGNG----AGACKCLPEFYGNPYEGCRPECVLNSDCPSHLACLNQHCRDPCPGTCGINAECQVRDHLPQCNCHVGYQGNPYVYCSVLRDPLPEPVPSRPCQPSPCGPNSQCRESNNQAICKCLPNFIGSPPACRP--ECTISSEC---------------------DLTLACVQQHCVDP-CPGVCGNSAQC-RVINHSPHCSCLPGFTGDAISGCQRIPPAITHDAPNETPRDPCVPSPCGAFGQC---------------RAQGNQAI--------CSCLPGYYGAPPNCRPECAINPDCASHLACISEKCRDPCPGSCGLQAQCSVINHTPICSCPSGYEGNPFVRCQRTPPTPTPPLHDACNPSPCGSNAICSPGGQCSCLPDFDGNPYVGCRPE---------------CVLNTDCARDKACQRSKCTD-------PCPGACGIGAVCEVRNHIPTCNCPPGTSGNAFVQCTLVQSSPVVPLNPCQPSPCGNNAQCREVNDQAV--------CSCLPGFFGVPPK---CRPECTINSDCAPHLACLNQQCRDPCPGACGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYPSPCGPNAECTNQNEQAICKCLKDYIGTPPNCRPECITSSECPIQLACIGQKCKDPCSGLCGIAATCQVVSHVPSCICIADYIGDPYTGCYARP-PIQREQINPCYQNPCGSNAVCRERGEAASCQCLPEYYGNPYEGC---RPECVLNSDCSSHLACL------NQHCRDPCPGSCAPNAQCQVVNHVPSCSCYPGYSGDPYRHCHVAQAEPVQVVHFNPCQPSPCGPNSQCTESQGQAVCRCLPDYYGSPPACRP--ECTTNPECPN-DKACV------SRRCT--------------DPCAGACGQNAICRAHQHRAYCSCHPGYTGDAFMRCQSLPSPQPIRDSPVIYRDPCVPSPCGQFAQCRV--EYEQAVCSCLTSYYGTPPYCRPECTQNSDCPSHRACVNQRCVDPCPGACGLNARCDVLNHVPSCSCPEGYLGDPFYRCYPAPAPPPTPVTVVADDPCQPSPCGPNAQCSNGVCSCLPLYQGDPYVGCRPECVLSTECPWDKACIRNRCLDPCPGTCGSGATCQVHNHVAMCQCPVGYQGNPFVLCQQTPLQAPVELHPCQPSPCGHHGECREVGSQAICTCRLGYYGSP--PACRP--ECVSDPECPPSLACVNQKC--------------------------RDPCPGACGHLAQCHVINHSPQCVCPAGYTGSPYSECHLIRADSSPIQRQPIDPCLPSPCGPHAQCSNEGGNAVCRCLTEYL-GVPPYCRP--ECIANSECPSDRACI-----NRKCQ---------------DPCPGLCGYNAICRTYNHQPNCVCAPGLVGNPFNSCLPPTRPEI--PAT-----------PPTTAIQVLQYEEPFING---CEP----NPCGANAQCNQRRGVVSCVCLPDYFGNPYEACRPE--CILNSDCPL-----------------------SRACVQQKCRDPCPGTCGLNAECHVMDHLPQCRCFSGYTGNPL------------------AYCSPVP------------IIQESPLTPCDPSPCGPNAQCHPSLNEAV--CSCLPEFYGTPPNCRPECTLNSECAYDKACVHHK 16478          

HSP 8 Score: 177.948 bits (450), Expect = 2.556e-43
Identity = 841/3431 (24.51%), Postives = 1158/3431 (33.75%), Query Frame = 3
Query: 3711 ITENDIFSRTPCSF--SCHPNAKCIKGRCR-------------CLSN---------LIGDGTTYCFNCSSCARNSDC--KPEQQTCTCKRGY-----VK-----------DGNNCSIISA----------RCHPECGVNAQCIN----GKCECLAGLQGNPFQQCFDCKR--------CSQFADCDPWNERCV--CQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGK---KCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCF------DCSICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTE--KCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDAL-------------CFPDQQ---------ECSCKSEFVGDGKI---CTLRADICRP-TCGENAICVNGQ---CQCQSGLQGNPLKHCFDCR---------PCHSFAVCDVENRR--CICQSGFEGDG-RNCKKIKE--CSP-KCHRNAVCI-----NQNCVCIPEYIGDGINFCFNCS--SCDRNADC---------------------------EPHNNRCTCYQGFTGN-GLTCNAIEL----KCEPS-CGENAKC--VNGK--CECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCIS---VNGCNNK-CDSNALC-VNRH---CICLPGFTGDGTRFCF------DCSSCP-KNSNCLPEEQKCICQEGYIMNGAKCQPIVHE---CRPGCGENAKCVNGKCECLPGLQGNPMQHCFD--CKKCHKFADCDVW--NKKCVCKNGYFGNGY-MCT--------PINGC-NLKCNENALCVNQ----KCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGN----CECLPGFVGDGIQVCFNCSTCDKNANCFPYQERC-VCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQ----EKCICK-AGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGD-----------------GKNFCFDCSTCPPNSDCLPQEQR--CICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGDGIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFN--------------CSKCDVNAKCFP--SVKKCICVIGYKGDGFRCY-----------PVILECPKCHYRAQCV--------------IGKCQCKNGLQGDGINFCMNCSECDKNAQCFPN-------------FSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDEN--LCVCAQGFTGNGI---------TCKAIDPSCNTNCHKDALCF----KDSCICKSGLSGDGKNYCFDC--------------KRCDQ--------NAICRPT--EQRCVCKPEFRGDGFQC----ALNLKTTCQNDCHPNAVRVNNCCRCKNG---------FFGDGFSFCFNCSNCSPNADCFPHLSKC---QCKEEFT---GNGFICQRKECKPACSEATSLC--IKNQCFCRPGLIGDGYNCLDCR--KCHEKATCNIRSMK--CECLPGYIGNG----FECISITSCTQSSDCIRPNEICNVA-------ISQCICEANSFL---------------------DPISKLCINPN-CQP-PCHPKAVCVKGK----CICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDC-------------SGCDKNAICTEKQ---GCICKSGFIGDGR-QCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIY----QKCECLPGLVGNGFIKCTNCSE------------------CHKKALCHDQRG---CVCSHGYSGDGIQCRIE---------DQCSLNSDCTDP----------------NKICI----TSTDTVKRCVC--KSSFISSN--SGCVPLTCL--SKCHKYANCENGVCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPK---------------CHRSALCV----IGTCKCPPSFKGNGYSGC-------FDCSK----------------CHANADC---DESKGCTCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSP--------DTSRNCVCK-----PGTTPSTNGKCIILG----------------CPVQCDKNAVCLSNN----CVCKTGYSGTG-LNCKP------NDQCSQNSDCPEP---NSRCEMMKDYNRKCVCLPGFQDDNGKCSPK--------------------ECQPKCHMFAICI----TQTCYCVPGYFGDGIKSC------------TSC--SVCHKNAQCLPDRG---CVCKSDFIGDGFN-CRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCEGG----MCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGDGIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRD----RNAACF---PG----------VDKGKKCQCKPGFSLEN-SLCSPIACRP-------------KCGKNSQCQ----LGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNFAYC----RQKVCQCRLGFQGDGVFNCH---------------DCSVCHPNAICSPSLG---CTCPGPHLIGDGRS-CKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEECLF----GQCQCKPGFIHNSNKTC-------VEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIP--------------IN--CYQPCH----KNAYCNI----GVCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKS------NPYSCKCPSGY---------EIDNN-------KCIAKKCLLPCD----PNAVCVLGE----CICKVGFTGNGL 11843
            +   D     PC+   +C PN  C  G CR             C SN          +G     C     CA  + C  K  +  CTC +G+     VK           D ++C +  A            H  C  NA CIN      C C  G QGN F  C   +         C     CD  N RC+  CQ    G    C  + +              EC+CLPG +G+    C     C  ++ C+  ++ C+       NGK    C   A   C    H      +G C+C PG  G+    C       D + C  N +C  D    +C   Y   G T   F     E  +C PN    N  C+   R+ G+ V FC       P ++             C P+ Q         +C+C   +V        C    + C P  CG  AIC + +   C C     GNP + C             PC   A C V   R  C C+SG+ GD  + C++     C P  C  NA C+        CVC     GD  +    C    C  +ADC                           E H+  C+C  G TGN G+ C A++      C PS CG N++C  +N +  C C+PG  G+P   C     CD  +DC              G+ L+CI+   V+ C    C  NA+C V +H   C+CL GF GD    C       + S  P   S C P +   +  +G  +      P   +   CRP C  N+ C   +  CL        Q C D     C + A C+V+  N  C C  G FGN Y  CT        P   C  L C  NA C  Q     C+C  G+ GD    C     C  NS+C P +K C       +N K          CT  C  NA C   N    C C  G+ GD    C        N    P  ER   C+P   G    C K  P+                 C CL  F G     C     C + + C P+Q    ++C     G  G G +C               L  N  C C   F GD                  KN C   S C PNS C  ++ R  C C  +Y          G  P C P+C   + C  DK                          C+ E+ +  C     G+  +C  I              +++ C C+   +GD    C                 + C  NA C P  +  +C C+  Y GD +              P  L C K H R  C               +  C C  G +G+  + C           C PN                C C+ GY G    C      S +C Q+  CIN  C          +  C     C  NA C+ + +  +C C   + GN             + +DP   + C  +++C     +  C C  G+ G   N   +C              +RC+         NA+C     + +C C   F GD +       + +     + C+P+    N  CR +NG         +FGD +  C     C  N+DC P+   C   +C++      G   IC+    +P CS    L       C  RP  +        CR   C   +TC++   +  C CLP Y+G       EC++   C     CI  N+ C           ++C C  +S +                      PI+   + PN C P PC P + C        C C  N +G    CR   EC+ +++C              +  C         +  +C  P C G+C + A+C  S +    C+C PG+ GD  + C                S C  NA+C E+     C C   + GD   +C    EC  NSDC     R+  C+      QKC                 C   C  NA+C        CECLPG  GN  + C    E                  C   + C    G   C C   Y G    CR E         D+  LN  C DP                N IC      S D   RC    K   I+ +    CVP  C   S+C   A  E  VC C+  YVG    CR   EC S  +C   N  C+  L     C    G Q     + LVNN   I R +  Y+G    +C+PK               C  +A+C     +G+C C P + G+ Y+ C        DCSK                C  +A+C   + +  C+C  GF GN     P   C+       P++ C  SP        + + + VC       GT P+   +C +                  CP  C   A+C   N    C C  GYSG   + C P        + ++N   P P   NS+C ++ +    C CLP F      C P+                     C   C   A C     +  C C  GY GD    C            T C  S C  NA+C    G   C C  ++ GD ++ CRP  EC +N DC   +K C                   +N  C+   C   C  NA+C        C CL+G+ G              NP      + QL    +R             + C+P P    C P +QC+        E+ G  +                   C C+ G++G+   C+ E  C   SDC      +N  C    PG          ++    C C PGF+ +  + C+ I   P              CG NS+C        C C   Y       +C P   C S  DCP +N  CV       +RC                  C   C   + C     +  C+C  G+ GD    C                + S C  NAIC    G   C C  P   GD  S C+P  +C  + DC  S A       + KCQ                PC   C  N EC        C C  G+  + +++C       + P  C    P+ C  P   CL   N+ A+C C +G+I     C P              IN  C  PC      NA C +     +CTC P   GD I+ C+     +++ + P + S C   S      N  +C C +GY         E  NN        C  ++C+ PC      NA+C + +    C C  G+ G  L
Sbjct: 8442 VNTTDTSLINPCTVDTNCAPNEHCKLGHCRKKEPPGSPKTPEPCQSNNDCIESEACYMGLCQDPCEFAKICAATAKCTAKSHRPVCTCPQGHEGNPMVKCVTTQTSIECTDDSDCGVTEACINQLCQHPCDVHDPCATNAVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCINPCQEDSCGENAECIPVNH------------GTECRCLPGFLGNAYVQCLPSQGCRSDSECD-SSQACI-------NGKCSSPCQCGAYALCDVVNH------RGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNPIC---YCPKGLTGNPFKNCIPEGDECTPNPCGPNSGCR---RVGGNPVCFCLPEYEGQPPSIPCELPSNPCDPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICDSSRHPVCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSV-IGCHGYECQVDADCPNSKACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALDHPKKNPCVPSPCGRNSECKLLNNRAVCSCIPGYLGDPQSGCQ--PECDINSDC--------------GDTLSCINHKCVDPCAGAICGINAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGPHDVCSVYGDGVALCDPCFGPNAQQNPRCRPECVGNSDCPFDR-ACL-------GQRCLDPCPGSCGRNAICNVYEHNPVCACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAECKRQHSGLACVCRKGYFGDPHIGCR--PECVLNSDC-PAEKAC-------LNSKCVE------ACTGVCGVNAVCRVVNHAPVCICAEGYSGDASIAC--------NPFYLPPPERPHPCEPSPCGPNSRC-KATPDGY-------------AACSCLPNFKG-APPVCQ--PECVVSSECAPNQACLNQRCTDPCPGICGGGARC-------------EVLNHNPICSCEANFEGDPFVACSPIQDPGRDIPVPKNPCVP-SPCGPNSICQIKQNRPVCSCVANYI---------GSPPYCRPECTLSSECPSDKA-------------------------CINEKCQNPCA-NVCGHNARCTVIA-------------HSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYPNPCAENAVCTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRDPCTAACGANAECTVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKC----------MDPCV--GTCGFNAKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVINQDCPSNRACIRQRCEDPCIGICGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIVVLDPPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCR--PECVQNSDC-PNNRACINMKCRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACVERPSNMYLPLPKDPCRPSPCGLFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPSDRACI--NQRCKDPCPGTCGYNARCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIVPPNPCVPSPCGPNSQCQVSSSGAVCSCVTNYIGRPPGCRP--ECSINSEC------------PARMAC---------INARCADP-CIGSCGNNALCHVSLHAPV-CMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALCEERNQAAACKCLPEYFGDPYVEC--RPECVINSDCP----RSRACVN-----QKCV--------------DPCPGMCGHNALCAVFNHAPNCECLPGYTGNPIVGCHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSSSECAQDKSCLNERCKDPCPGTCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCR--PECTSDSECPG-NLACI-NLRCRDPCVGTCGIQT----TCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRACLNNKCRDPCPGVCGVSAECHVINHAPSCSCPSGFTGN-----PSQFCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVCSCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPGTCGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETG-VCSCLPNFVGRAPNCRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGCNPQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCRP--ECVVNSDCSR-DKSC-------------------VNQKCV-DPCPGVCGLNAQCRVSNHLPSCSCLAGYTG--------------NPSSACREIPQLPPPPERD-----------ENPCRPSP----CGPYSQCR--------EVDGHAV-------------------CSCLQGFIGSAPNCRPE--CIISSDCAQNLNCQNQKCVDPCPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDY--LGRPPNCRP--ECLSSADCP-ANLACV------NQRC---------------SNPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAICRERNGAGSCAC-LPEYFGDPYSGCRP--ECVQNDDCDRSRACI-----NNKCQ---------------DPCPGACGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPC---KPSPC-GPYSQCLDT-NSHAVCSCLEGYIGAPPSCKPECVVSSECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPE-VKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPL 11495          

HSP 9 Score: 162.54 bits (410), Expect = 9.544e-39
Identity = 806/3306 (24.38%), Postives = 1134/3306 (34.30%), Query Frame = 3
Query: 2703 YCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGDGVETCFHCSQCDSNAICDQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNG-NGVEYCFN---CTSCHLNAKCIPRQN--TCECNSGFHGDGIQCKLL-----PLCTPACHPQASCINGN----CKCNNNLIGDGISSCFDCDK------CSMNARCDVS--NQRCICQPGYEGN-----GIKCVKTCFQS--CHKLAVCK--EGT--CKCSNGLTGDGVNF--CFNC-----SLCDKNAKCLINEE--KCECMERFEGDGFT-CQDKVDCSSR--CGENAFCYN----GTCKCKLGF------QGNPLEHCFDCRVCHY-PAYCDI-PNRKC----ICITENDIFSRTPCSFSCHPNAKCI----KGRCRCLSNLIGDGTTYCFNCSS-----CARNSDCKPEQQT--CTCKRGYVKDG-------NNCSIISARCHPECGVNAQCING----KCECLAGLQGNPFQQ-----------CFDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHV---NGFCENQE----CKCLPGLIGDGINF-----CFDCSTCDINAFCEPFNER--CVCSVGFTGNGK----------KCSIL-APITCKRACHKKAKCVKGK----CECLPGLRGDGVQSCFDCSICDNNTVCYPDQEKCVCNPGYYGDGTTCF-----------------LFSQLCTEKCHPNAKC-VNRKCKCNERLVGDGVNFCFNCTSCHPDALCF--PDQQECSCKSEFVGDGKICTLRADI--CRP-TCGENAICVNGQ----CQCQSGLQGNPLKH---------CFDCRPCHSFAVCDVE----NRRCICQSGFEGDGRN--CKKIKECS-----PKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGL----TCNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWN---KKCVCKNGYMGN-GLTCISVNGCNNK----CDSNALCVNR----HCICLPGFTGD--------GTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHEC-RPGCGENAKCVNG---KCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQK----CICLPGFIGDGIKF-CFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKI--GPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIE--AICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGDGIKFCFKCS-------SCDPNADC--VPEQQKCVCKTGFYGNGN-KCDKIESTCEPPCAPGGFCNNS----KCQCNSGLKGDGVTS--------CFNCSKCDVNAKCFPSVKKCICVIGYKGDGFRCYPVILECPKCHYRAQCVIGKCQCKNGLQGDGINFCMNCS---ECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCIN----SNCHCLPMYTGNGVSFCFNCAQ----------------------CDA-------------NAICKPDE---------NLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGDGKNYCF-DCKRCDQNAIC--RPTEQRCVCKPEFRG---DGFQCALNLKTTCQN----------------------------DCHPNAVRVNN----CCRCKNG-FFGDGFSFCFNCSN--CSPNADCFP--------HLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRK--------CHEKATCNI--RSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHP--------KAVCVKGKCICNRNL--VGDGYQ---CRAPEECNNDADC-------VQFQEVCRKDQ------SSLKKIC--------KCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSN-LESRCLCLPGFVGDGMTTCTDCSGCDKNAICTEKQ---GCICKSGFIGDGR----------QCIVLNECADNSDCTTIR-----GRASECIRSSEGIQKC---QCSQGFKLLNGK-------CEPL-SCIYPCAKNAVCIYQKCECLPGLVGNGFIKCTNCSE-----CHKKALCHDQRG---CVCSHGYSGDGIQ---CRIEDQCSLNSDCTDPNKICITS--TDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGD----GIICRLPDECKSSLDCK------YENQECVAR-------------LDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALC--VIG--TCKCPPSFKGNGY-SGCFDCSKCHANADCDESKGCTCKPGFEGNGCY--CRPEDKCKFNSDCN----------------DPLKICVQSPDTSRNCVCKPGTTPSTNGKCIIL-GCPVQCDKNAVCLSNN----CVCKTGYSGTG-------LNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCV----CLPGFQDDNGKCSPKECQPKCHMFAICITQTC----------------YCVPGYFGDGI--KSCTSCSVCHKNAQCL-----PDRGCVCKSDFIGDGFN-CRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKE-CTSKCHKNAKCEGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCK----SGKCVCQGELQGD----GIRTCFKCSS-----CHA-----------RAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQC-QLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIE--ETCPNKCHNFAYCRQKVC 11027
            Y     G+FG        C V +  E  Q  +   LC      DG + CF  +        D+ +K   C +  + +G  C               CL G C CN G  G N V+   N      C + A C       TC C  G+ G+G  C+ +     P     C   A C N      CKC +   GDG   C D D+      C  NA C  +  N  C C  GY GN     G + V  C     C   A+C   EG+  C C  G  GDG +   C +      + C +NA CL  +   +C C + + GD    C+D  +C++   CG  A C N      C+C  GF        + L    + +   Y P   DI P ++     +   + D  ++      C  NAKCI      RC C S   G G  +C N +      C  N+ C     +  CTCK  Y  D        + C+ +       CG +A C N      C+C  G  G P  +           C     C+  A+C     +C C  G+   G +C  I  C T   V   +  C N      C+C  G +G          C D   C  +A+C+P      CVC  G+T N            +C ++  P     +C + A C        C C PG  GD    C D   C           +CV  P   G G TC                  + S    E C  N+ C   ++C C E  +G+         +C   A C     Q +C C   + G+  +     DI  CR   C E AIC N      CQC  G  G+P +          C D  PC +   C  +    N  CIC+ G+E +  N  C+ + ECS     P C  NA+C N                              P +  C C QG  GN       CN  E +C+       K V   C          L  C + + C   A+C         C C  GY      +C+ V+ C  +    C   A CVN+     C C  G+ GD          R C     C  N  C+ +  +C+C   Y ++          C R  CG NAKC      +C C  G +G+P+  C D  +C                                +L C   A CVN+K    C+C   + GD  K  C   S  P  S C+       CA +    E  C      +LC S  +   +   G C C  G+V +G            + +C    +  +C     G+G  C+    GP   CP                 QG  G+     F   SCS +  +   P  E+ IC  G      +C E  EG      +   R N +CIC P F+G+            P+  C+P  ++  C                +P C    H      Q +C C PG  G+  + C   S       SC PNA+C  V     C+C  GF GN    C  ++     PC     C N     +C C SG  G+  +S        C + +KC  N       ++  C  GY     +C  +  +   C  RA C  G C C  G  GD  +    CS   +C  +A C  +    +  +G R     C KI     +C  NA+C++    S+C C   + GN  +    C                        C A             N +C P+E          +C CA+ +  N +      PS   +C  DA C  D+  C+  + G  K     D   C  N++C  R  + RC C   F G   D   C    K  C+N                             C P AV V N     C+C  G F GD +     C +  C  N DC P        H     C EE  G+  IC  ++ +  C             C PG  GD    + C K        CH  A C +      C+C P ++G+           +S  C RP+  C    + C         P + +C    CQ PC          K +  K  C C      + D  +    R   +C  D DC        Q +  CR  Q      S LK +C        +C  GL       C +  C   C S   C +  + +E++CL            C   + C  NA+C+  Q    C C  GF G+             C+  N+C     C   +      + + C       Q+     C      L G+       C+P       C    +C+  KC+C  G +G  F  C++  E     CH  A C +  G   CVC  G  GDG     C    QC    DC + N  CI    TD     VC    I++N       C S+ H+       +C C  G++GD    G+ C    EC   +DC        E   C+                D    C C  G+Q  ++    +N  +                    CH +A C  + G  +C+CP    G+   +GC D ++C ++ADC  S  C      + + C   C  ++ C  N++C                 DP   CV   + + N  C  G     + KCI     P  C   A C   N    C C+ G +G           C+ + QC+Q S C   +  C  +   NR C+    CL G     G C        C  F  C    C                 C+   +G       C   + C +NA+C+     PD  C+CK  F GD  + CR + EC  ++DC + +K C       N  C    +  LI   C     CT++ H+       +C C  GF GD         C + + C+D                                     C P A+C+    S KC C   L GD    G R+  +C +      HA           R VC+   C      V  G V Q   +  YD    DR A C P       CQ   G    N+ CS   C+P C  +++C    VC     ++P +   +C               N +CV       K+C C +GF   S  +C+     C  +C     CR  +C
Sbjct:   46 YLNLENGYFG--------CQVNESTEYLQLFNLSKLC------DGTQDCFLGA--------DELSKELKCTNDCDKDGTKCTHGA-----------CLNGVCHCNDGYGGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDK----PCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAEC--IENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVR-CGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFG---SCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAECVNVP---GGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNL-----------------------------PGSYECRCPQGHNGNPFIMCEICNTPECQCQ----SPYKLVGNSCV---------LSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCI-QPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLLGCTDEDECS-------------------------------HLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTP-KSKCLSND---DCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNG------------DGDCVSQCQDVIC-----GDGALCIPTSEGPTCKCP-----------------QGQLGNP----FPGGSCSTDQCSAARPCGERQICING------RCKERCEGVVCGIGATCDRNNGKCICEPNFVGN------------PDLICMPPIEQAKC----------------SPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCN-------ERVECPEGYSCQKGQCKNLCSQA-SCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCVDACSKI-----QCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNPVVSSCEKPSL-PDCTSDANC-PDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEESCGDNAICLAEDHRAVCQ------------CPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKCPPLFVGDA----------KSGGC-RPDGQCPNGDADC---------PANTICAGGVCQNPCDNACGSNAECKVINRKPVCSCPLRFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNSQDCSDGESCLKNVCVVACLDHSQCASGLA------CVEGHCTIGCRSNKECKQDQSCIENKCL----------NPCQSANSCGPNALCSIDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAVGERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIGTPF-GCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCAN-NLACIHGKCTDPCLHTVCG---INAN-------CQSEGHE------ALCSCPAGFLGDPNDTGVGC-FKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQ-----------------PCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASC------QNSRCRSPCERQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHI-ECADNDDCS-GEKACLDSKCIDPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSIC--SHGICSPLCSTNRDCISEQLCLQGVC--QGTCKSNS---SCPQFQFCSNNICTKELECRSDSECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVARSHAPD--CLCKEGFFGDAKSGCRKI-ECTSDDDCSN-DKSC------DNHMCK---IACLIGQPCGENALCTTEHHQQ------VCHCQPGFSGDPR-----VRCDVIDFCRD-----------------------------------APCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVCAQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKP---LPSPCQVT-GDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACG-------------QNAECVMQNHL--KQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMC 2963          

HSP 10 Score: 159.458 bits (402), Expect = 8.323e-38
Identity = 927/3968 (23.36%), Postives = 1304/3968 (32.86%), Query Frame = 3
Query: 2568 CANHAICTVEN---TCQCRKNYYGNPLEKCNIDCS--KCHTDSDCDKTNG-----------------------------YCKCRYGFFGDGFT----------------------------CNKTCCVEKCHEQAQCVD----GKCLCKPGFSGDGVETCFHCSQCDSNAICDQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCF------NCTSCHLNAKCIPRQN--TCECNSGFHGDGIQCKLLP---LCTP-ACHPQASC--INGNCKCNNNLIGDGISSCFDCD---------KCSMNARCDVSN---QRCICQPGY--EGNGIK-CVKTC----FQSCHKLAVC---KEGTCKCSNGLTGDGVNFCFNCSL---------CDKNAKCLI--NEEKCECMERFEGDGFT-CQDKVDC---SSRCGENAFCY-----NGTCKCKLGFQGNPLE----HCFDCRVCHYPAYCDIPNRK-CICITENDIFSRTPCSFSCHPNAKCIKGR----CRCLSNLIGDGTTYCFNC----------SSCARNSDCK--PEQQTCTCKRGYVKDGNNCSIISARCHPECGVNA------QCINGKCE------------------------CLAGLQGNPFQQCFDC-------------------KRCSQFAD----CDP-----WNERCVCQSGYIGN----------GFTCTKIINCVTKCHVNGFC----ENQECKCLPGLIGDGINFCFDCST-------------CDINAFCEPFNE--RCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSICDNNTVCYPDQEK--CVCNPGYYGDGT-TCFLFSQLCTEKCHPNAKCVNRKCKCNER--LVGDGVNFCFNCTSCHPDALCFPD--QQECSCKSEFVGDGKICTLR-ADICRPTCGENAICV----NGQCQCQSGLQGNPLKHCFDCR----------------PCHSFAVCDVENRR--CICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNC------VC--------------------------------IPEYIGDGINFCFNCSSCDRNADCEPHNN--RCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFN--CKRCDKFADCDVWN--KKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICLPGFTGDGTRFCFDCSSCPKNSNCLPEE--QKCICQEGYIMNGAKCQPI------------------VHECRPGCGENAKCV----NGKCECLPGLQGNPMQHCFDCKKCHKFADCD---------------VWNK-KCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQ-----------------------KCICLPGFIGDGIKFC-------FD-------CSACPANSNCVPE--KKECKCAKDYF-----------------MNEKICSPIKQPVLCTSKCHKNAKCLKGN----CECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCI---------CKKDYFMNDTQCI--HTGRTPQCVPKCH------HYASCVQDKCE-----------------------CLPGFIGDGIKFCFKC-------------SSCDPNADCVPEQQKCVCK--TGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGFRCYPVILECPKCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCL-PMYTGNGVSFCFNCAQCDANAICKPDEN--LCVCAQGFTGN------------GITCKAIDP------SCNTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAV-RVNN---CCRCKNGFFGDGFSFCF-------------NCSNCSPNADCFPH--LSKCQCKEEFTGNGFICQRKECKPACS-----EATSLCIKNQCFCR-PGLIGDGYNCLDCRKCHEKATCNI--RSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQP-PCHPKAVC--VKGKCICN--RNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAICTEKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQK----CECLPGLVGNGFIKC------------TNC--SECHKKALCHDQRG---CVCSHGYSGDGI-----QCRIEDQCS-----LNSDCTDP-------NKICITSTDTVKRCVCKSSFI-SSNSGCVPLTCL-------------SKCHKYANCE----NGVCKCILGYVGDGIICRLPDECKSSLDCKY----ENQECV----------AR---LDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSG--CVPIDCNPKCHRSALCVIGT--CKCPPSFKG---NGYSGCFDCSKCHANADCDESK----------------------GCTCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNN----CVCKTGYSGTGLN-CKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICIT----QTCYCVPGYFGDGIKSCTSCSV------------CHKNAQCLPDRG---CVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCE----GGMCQCLSGFIGDGINCQRPFE--CGIDNPCKDQF----SVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPIN--CHPLAQCKSGKCV--CQGELQGDGIRTCFKCSSCHARAVCS---------MDGCKCMPGYVGNGIVCQTEDQCQY--DSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNFAYC----RQKVCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEP--NDCDVNNPASCK--SPLEVCLGFPNAKAICVCRKGFI---NKFGYCIPINCY-QPCHKNAYCNI----GVCTCNPDYIGDGITSCKKKNLCLEDSDC-------------PIIGS-----KCMTKSNPYSCKCPSGYEIDN-NKCIAKK------------CLLPCDPNAVCVLGECICKVGFTGNGLQ-----------------CMPTSKCNPLSGCSDTNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVCEPSCHPKAACIIGSCICMKPLIGNGITECKLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVDCPTRKICVNSKCICP 12290
            CA  A CT ++    C C + + GNP+ KC    +  +C  DSDC  T                                C C  GF G+GF                             C   C  + C E A+C+      +C C PGF G+    C     C S++ CD +++ACI  +G   +   C     C    H+      G C C  G NGN    C       +   C LNA C        C C  G  G+  +   +P    CTP  C P + C  + GN  C      +G      C+          C  N +C V +    +C C P Y    N I+ CV+         C   A+C   +   C C +   G+    C   ++         C +NA+C +  N E+C C   + GD +  C++        + CG NA C         C C  G  G+P      H ++C+V       D PN K C+     D     PC  +C   A C        C C S L G+    C+            S C RNS+CK    +  C+C  GY+ D        + C PEC +N+       CIN KC                         CL G  G+ F QC                        CS + D    CDP       +   C+   +GN          G  C  +  C   C  N  C     N  C C  GL G+    C   S              C  NA C+  +    CVC  G+ G+         I C+  C   + C   K      L    V++C    +C  N VC        C+C  GY GD +  C  F     E+ HP   C    C  N R     DG   C    SC P+    P   Q EC   SE   +      R  D C   CG  A C     N  C C++  +G+P   C   +                PC   ++C ++  R  C C + + G    C+     S +C  +  CIN+ C      VC                                I E  GD I+ C+  + C  NA C P+NN  RCTC + + G+  +       C P C  +++C +    C+        QHC +     C   A+C V N    C C  G+ GN       +GC        + V    +C P             + C  NS C   E    C CQ GY     +C+P                   +  C   CG NAKC     N  C C    +GNP + C   K      + D               V N+ +C C  G FG    C P    N  C  N  C+ Q                       KC C+  F GD    C        D        S C AN+ C        C C ++YF                  N + C  +K    C + C  NA C   +    C C P   G+ ++ C      ++ +N +    +  C+P   G    C  +G   +C                   G   +    C   + C  +  C+  + K  C  G  G   +C         +C +++      C C  G+ GD  + C      PP +D +     C+         C+         C+  + GR P C P+C          +C+  +C                        C PG+ GD    C+K              S C  NA C    Q   CK    ++G+      +E  C P C     C  S+   N          C + + C V    F     C C+ GY G+      ++ E P+  Y    V      +N  Q        NC   + +A        C C   Y G   NC      S +C Q+  C+N  C    P   GN             NA+C+   +  +C C+ GF+G+             IT   IDP        N+ C   A   +  C C     G   N             CRP    C    E  G+     L  +  C   C       VNN    CRC +G+ GD FS C              N S C  NA C     +  C C  E+ G+ +     EC+P C           C+ N+C    PG+            C   A C++   +  C C  G+ GN                  P++ C         E      P+        C+P PC P + C  V G  +C+   N +G    CR   EC+  ++C Q       D++ + +  +C D              C G C ++A+C K +N    C C  G+ GD    C       +     E     C     G   QC V+ E    S      GRA  C    E     +C      +N +C+   C   C  NA C        C C  G  G+ F  C            T C  S C   A C ++ G   C C   Y GD       +C +   CS     +N  C DP       N  C  S + +  C C + +  + +S C  +  L             S C  Y+ C     + VC C+ G++G    CR   EC  S DC      +NQ+CV          AR   ++    C+C  GF            +++++      SG  C+P  C P  +   L V G+  C C P + G   N    C   + C AN  C   +                       C C PG+ G+     P   C             +  PD +RN  C P                  C  NA+C   N    C C   Y G   + C+P  +C QN DC           D +R C+        N KC    C   C + A C        C C  GY GD  +SC+   V            C   +QCL       C C   +IG   +C+P  EC ++ +C   N+ C                   IN  C    C   C  NAKC+      +C C  G  GD I+   P      ++NPC        SVC+   +  +  C C  G+      C+PE C  N  C     C+  +CV  C G    + I     C      AVCS         + GC+ +P            +       ++CR+RN A          C C  GF   N   +   CR +C  N                          D C +   C  S  KCV                          + C N C ++A C        C C  G+ GD  F+C    V               P P L      C P   C  +S+CR  N       +   C C+ G+I        P  C  +C  + EC   +       +H   K CV+P  + C +    + K  SP+  C           C +  I   N      P +C   PC  NA C I      C+C P++IG     C+ +  C+ +S+C             P  GS     KC   ++   C C  GYE D   +C  K+               PC  NA C  GEC C+  + GN  +                 CM     +P  G    N+VC  +   +   C C  GY +      C+                     +KP++ + I E   P  C ++  C++ N        G   C C  G+     +C  + EC V+ +C   + CVN KC+ P
Sbjct: 8512 CAATAKCTAKSHRPVCTCPQGHEGNPMVKCVTTQTSIECTDDSDCGVTEACINQLCQHPCDVHDPCATNAVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPTKLCDRLNRRCINPCQEDSCGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECD-SSQACI--NGKCSSPCQCGAYALCDVVNHR------GVCKCPPGYNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNPICYCPKGLTGNPFK-NCIPEGDECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCDPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICDSSRHPVCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGYECQV-----DADCPNSKACMGYRCYD-----PCPGACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALDHPKKNPCVPSPCGRNSECKLLNNRAVCSCIPGYLGDPQ------SGCQPECDINSDCGDTLSCINHKCVDPCAGAICGINAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGPHDVCSVYGDGVALCDPCFGPNAQQNPRCRPECVGNSDCPFDRACLGQRC--LDPCPGSCGRNAICNVYEHNPVCACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAECKRQHSGLACVCRKGYFGDPH-------IGCRPECVLNSDCPAEKA----CLNSKCVEACT--GVCGVNAVCRVVNHAPVCICAEGYSGDASIACNPFYLPPPERPHP---CEPSPCGPNSRCKATPDGYAAC----SCLPNFKGAPPVCQPECVVSSECAPNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFEGDPFVACSPIQDPGRDIPVPKNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSDKACINEKCQNPCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYP-NPCAENAVCTPYNNAARCTCIEPYNGDPYS-----TGCRPECIYSSECPS-SLACI-------KQHCRDPCTAACGANAECTVVNHLPSCSCTRGFEGNPF-----DGCK-----RVVVVRPETVCEP-------------NPCGPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFNAKCQVNNHNPICSCPANYEGNPFEQCMP-KPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVINQDCPSNRACIRQRCEDPCIGICGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIVVLDPPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCRPECVQNSDCPNNRACINMKCRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACV-----ERPSNMYLPLPKDPCRPSPCGLFSTCHVVGERPVC------------ACLPDYMGAPPNCKPECMTSAECPSDRACINQRCKDPCP-GTCGYNARC---------RCTNHS----PICSCYDGYTGDPFHQCVPERKPPPIADPIVPPNPCVPSPCGPNSQCQVSSSGAVCSCVTNYIGRPPGCRPECSINSECPARMACINARCADPCIGSCGNNALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALCEERNQAAACKCLPEYFGD----PYVE--CRPECVINSDCPRSRACVNQKCVDPCPGMCGHNALCAV----FNHAPNCECLPGYTGNPIVGCHIVPESPR--YPDPIVP-----ENPCQPSPCGLYSNCRPVNGHA-------VCSCVPSYIGSPPNCRPECMSSSECAQDKSCLNERCKDPCPGTCGN-------------NALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPN-------------CRP---ECTSDSECPGNLACINLRCRDPCVGTCGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPYT----ECRPECVLNSDCSKNRACLNNKCRDPCPGV------------CGVSAECHVINHAPSCSCPSGFTGN------------------PSQFCR--------EIPRLPAPVEP------CRPSPCGPYSQCREVNGHAVCSCVTNYIGTPPACRP--ECSVSSECAQ-------DRACVNQ--RCAD-------------PCPGTCGNEAIC-KVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENP---CVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPNC--RPECTINTECPANLACINERCQ-DPCPGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGCNPQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCRPECVVNSDCSRDKSCVNQKCVDPCPGVCGLNAQCRVS-NHLPSCSCLAGYTGNPSSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCR--PECIISSDCAQNLNCQNQKCVDPCPGTCGIEARCQVINHYPACSCAPGFTGDPFNRC---TKILLEPPPTEKSGNPCIPSPCGP--NSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCIGACGLHSVCTVIKHRPACECVPGYTGD-----PFSGCAIVQQ--------IAPPDETRN-PCNPS----------------PCGANAICRERNGAGSCACLPEYFGDPYSGCRP--ECVQNDDC-----------DRSRACI--------NNKCQ-DPCPGACGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKP--ECVVSSECPQ-NRAC-------------------INQKCE-DPCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGN--QAACSCNAGYIGRPPTCRPE-CTNNDECQNHLSCQQERCVDPCPGSCGSNAI-----CQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECRERNGA--------GACYCHDGFE-GNPYDAQRGCRRECENN--------------------------DDCTAVQAC--SRFKCV--------------------------DPCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPV--------------TPRPPL----NPCNPS-PCGPNSNCRAMN-------NQAVCSCQAGFIN------QPPNCKPECVVSAECAPEK-----ACVH---KKCVDPCQHTCGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSPACSCLPNFIG-APPRCRPE--CVLNSECGPTEACINQKCADPCSGSCGFEAKCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCRPECTLSADCPRDKACMRNRCVDPCPGICGNNAVCEVM--NHIPVCSCVKGY-EGDPFVNCR---------------------VKPVVEDPIIEACSPSPCGSNSQCRDVN--------GHAVCSCLEGYIGAPPQC--RPECVVSSECSALQACVNKKCVDP 11999          

HSP 11 Score: 153.295 bits (386), Expect = 5.677e-36
Identity = 412/1555 (26.50%), Postives = 575/1555 (36.98%), Query Frame = 3
Query: 2091 CKCKPGFVGSGYECREEVNCD-----IKCHENASCVN----GYCKCNRNLIGDGINSCFDCLKCNTEADC--------SPYENRCYCRPGYTGN-----GFTCIKSCD--KICHKDALCQN----SRCICKPNFEGDGVNY--CFDCSKCHKL-----AQCHPKTGN--CTCRPPYVGDGVSECETFLPKGNCFP--PCANHAICT-VENTCQCR------------KNYYGNPLEKCNIDCSKCHTD-SDCDKTNGYCKCRYGFF-GDGFTCNKTCCVEKCHEQAQCVD----GKCLCKPGFSGDGVETCFHCSQCD-----SNAICDQN--NKACICKSGFEGNGIN-CLRAINCK---QKCHKQARC---LLG-KCICNKGLNG--------NGVEYCFNCTS---CHLNAKCIPRQNTCECNSGFHGDGIQCKLLPLC---TPACHPQASCING----NCKCNNNLIGDGI-----SSCFDCDKCSMNARC--DVSNQRCICQPGYEGNGIKCVKTC------------FQSCHKLAVCKEG----TCKCSNGLTGDGVNFCFNCSLCDKNA-KCLINEEKCECMERFEGDGFTCQ----------------DKVDCSSR--CGENAFC-YNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGR---------------CRCLSNLIGDG---------TTYCFNCSSCARNSDCKPEQQT----CTCKRGYVKDGNN--------CSIISARCHPECGVNAQCIN----GKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCVCQSGY--IGN---------GFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCSTCD--------INAFC--EPFNERCVCSVGFTGNG---------KKCSILAPITCKRACHKKAKCVK-GKCECLPGLRGDGVQS--------CFDCSICDNNTVCYP-DQEKCVCNPGYYGDGTTCFLFSQLCTE-KCHPNAKCVNRK----CKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFV-GDGKICTLRADICRPTCGENAICVN----GQCQCQSGL----QGNPLKHCFDCRPCHSFAVC--DVENRRCICQSGFEGD---GRNCKKIK-ECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGN-GLTCNAI--ELKCEPSCGENAKCVNG----KCECLPGLQGNPLQHCFNCKR-------CDKFADCDVWNK--KCVCKNGYMGNG-LTCISVNGCNNK-CDSNALCVNR----HCICLPGFTGDG--------TRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCK---KCHKFADCDVWNKKCVCKNGYFGNGYM-CTPINGCN-LKCNENALCVNQ----KCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKD 5936
            C C PG+ G+G+ C +   C       +C ENA C N      CKC     GDG   C D  +C    +C        +P    C C  GY GN     G   +  C    +C   A+C N     RC C P ++GDG +   C D  +C +      A C    G+  C C   Y GD ++ CE       C    PC   A C  +  + QCR             +    PL    +      TD +   +T+G      G    D   CN+   V KC   A+C++     +CLC  GF G G   C + ++C       NAIC     +  C CK  + G+    C+    C    + C + A C   + G  C C +G +G          V+    C+S   C  NA+CI  +N C C  GF   G  C  +  C      C P A C+N      C+C    +G          C D  +C  +A C  D +   C+C+ G+  N       C            F SC + A C       TC C  G +GD  + C +   C   A KC       EC+    G G+TC+                  V CS+   C  N+ C     C C     GN   H  +   C   A C + N +  C+        +  +  C+   +C                   C+C     GD          T  C + + CA    C  +  T    C C++GY ++  N        CS+   R  P CG+NA C N     +C C  G  GNPF  C  C               C CQS Y  +GN         G  C     C++      +     C C  G        C D   C+          A C  +P +  C C  G+ G+          +KC+        R C    KC++ G+C C P    D   +         F C I   N  C P D  +C+C  G+ GD          C+   C   A CVN+K    C C +   GD         S  P + C  +     C S     +G   +  + +    CG NA C      G C+C+ G      G+ +  C D   C   A+C    E   C C  G  G+   G +C   +   +  C    +CIN  C    E +  GI      ++CDRN      N +C C   F GN  L C     + KC P CGENA C  G    +C C PG  GNP + C    +       C   A+C        C+C  G+ GN  + C  V+ C NK C  NA C+NR     C+CL G  G+         ++FC D + C  N       ++  C EGY     +C+ +  +    CG  A C  G C C  G  G+P      C    +C   ADC + ++ C       G G   C  ++ C+ ++C  NALCV++     CIC  GF G+       C         VPE+++ KC  D
Sbjct:  153 CTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDV---DECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSG-----AGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECI--ENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDV-RCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGA---ECV-NVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSV--QRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICN-----------TPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSY-----CACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAA------DRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGI---NAKCTPSDPPQCMCEAGFKGDPLLGCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDD---CASNLACLEGSCVSPCSSL---LCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVI-CGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVCGIG-----ATCDRN------NGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCN-------ERVECPEGYSCQKGQCKNLCSQA--SCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADC-LHSEICF----QLGKGLRKC--VDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQP----ERTVPEEED-KCKSD 1626          

HSP 12 Score: 142.895 bits (359), Expect = 7.598e-33
Identity = 564/2449 (23.03%), Postives = 792/2449 (32.34%), Query Frame = 3
Query: 2283 ENRCYCRPGYTGNGFTCIKSC--DKICHKDALCQNSRCICKPNFEGDGVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSEC---------ETFLPKGNCFP-PCANHAICTVEN---TCQCRKNYYGNPLEKCNIDCSKCHTDSDCDKTNGYC---KCR---YGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGDGVETCF--------------HCSQCDSNAICDQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCF--QSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLI--NEEKCECMERFEGDGFT--------CQDKVDCSS-----RCGENAFCYNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCI---CITENDIFSRTPCSFSCHPNAKCIKGR----CRCLSNLIGDGTTYCF--------------NCSSCARNSDCKP--EQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQC--------------------INGKCE---------CLAGLQGNPFQQCFDC---------------KRCSQFADCDPW--NERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCL-PGLIGDGINFCFDCSTCDINAFCEPFNER--CVCSVGFTGNG-KKCSILAPIT------CKRACHKKAKCVKG----KCECLPGLRGDGVQSCF-DC---SICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEKCH------PNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFP--DQQECSCKSEFVGDGKICTLR------------------ADICRPTCGENAICV----NGQCQCQSGLQGNPLKHCFDC-------------------RPCHSFAVCDVENRRCICQ--SGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEP--HNNRCTCYQGFTGNGLT---------CNAIELKCEPS-CGENAKCV-NGKCECLPGLQGNPLQHC-------FNCKR----------------CDKFADCDVWN--KKCVCKNGYMGNGLT---------CISVNGCN-NKCDSNALC--VNRH--CICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQE------GYIMNGAKCQPIVH----ECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCVCK--NGYFGNGYMCTPINGCNLKCNENALCVNQKC-----------------------ICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDK----CECLPGFIGDGIKFCFKCSSCDPNAD--------CVP-------------EQQKCVCKTGFYGNGNKCDK--------------IESTCEPPCAPGGFCNNSKC---------QCNSGLKGDGVTSCFNC------------------SKCDVNAKCFPSVKKCICVIGYKGDGFR-CYPVILECPKCHYRAQCV-----------------------IGKCQCKNGLQGDGINFCMNC-------------SECDKNAQCFPNFSK--CECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCH-----------------------CLPMYTGNGVSFCFNCAQCDANAI------------CKPDEN--------LCVCAQGFTGNGITCKAIDPSC--NTNCHKDALCF-----------------------KDSCICKSGLSGDGKNYCFDCKR-----------------------------CDQNAIC--RPTEQRCVCKPEFRGDGF-----QCALN---------LKTTCQNDCHPNAVRVNN---------CCRCKNGFFGDGFSFCF-------------NCSNCSPNADCFPHLSK--CQCKEEFTGNGFICQRKECKPACSEATS-----LCIKNQCFCR-PGLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDCIRP 8054
            + +C C P Y G    C   C  +  C  D  C N RC             C   + CH ++     T  C C P + GD  + C         E   P   C P PC  +A+C  E    +CQC   YYGNP E C  +C    T++DC  +N  C   KCR    G       C     +  CH           C+ GF GD    C                 S C  N+ C +NN+  IC    E  G       NC+ +C   A C   K    +  N      C +   C +    I     C C +GF GD    + LPL  P+  PQ       C           S C    +C  N         C C P Y G    C   C     C     C++  C+          + C     C  NA C +  +   C+C   F G+ FT         +D    S       CG NA C  G C C   F GNPL  C     C     CD  ++ C+   CI         PC  +C  NA C   R    C C   + G+  + C                 S C  N+ C+    Q  C+C R ++        +   C PEC  NA+C                    +N +C          C+    GNPF  C                    C   A+C     N +C C SG+IG    C       + C +N  C NQ+C+   PG+ G              NA C   N    C C  G TGN    C ++  +           C   A C +G     C+CLP   G+  + C  +C   S C ++  C     +  C PG  G    C +   L    CH      P   C   +    E +           + C P++ C    +Q  C C   F+G    C                      D C   CG +A C     +  C C  G  G+ +  C                       PC +F  C  +  + IC    G+ G   NC+     +P C  +  CI++ C           + C    SC   A C    H   C+C  G+ GN               +   C PS CG NA C   G+C CLP   GNP   C        +C R                C   A C+V N    C C  G  GN             + +N C  + C +NA C  VN    C CLPGF G   +   +C+    NS+C P    C+ Q+      G     A+CQ I H     C  G   NA  +  +    P +Q  P+  C+    C   A+C   N++ +CK    Y G    C P    + +C     C+ QKC                       IC+  +IGD    C+                    A+     E+I    + P    + C +  +    +C+CLP + G+  + C     C  N++C  +          +   ++C    P S  PN   +             G+SGD  + C    +  ++ +         C+    G   QC E+             +    C CLP + G       +C+T   N +C               ND  C+    T  C   C   A C   +    C C PG+ GD    C    S  P  D        CVP             EQ  C C T +YG    C                +   C  PC PG    N++C          C  G  GD    C+                    S C  NA+C   V  C C+  Y+GD +  C P  +   +C +   C+                       +  CQC  G QG+    C                S C  + +C    S+  C CR GY G    C       P+C  +  C+N  C                        C   YTG+  S C +  + D++ I            C P           +C C   + G    C+   P C  N+ C  D  C                        + +C+C  GL G+  N C    R                             C  NA C  R     CVC P++ G+ +     +C LN         ++  C++ C P    +N           CRC +G+ G+  ++C              + S C PNA C P L++  C C  EF G         C+P C+  +       C+ ++C    PG+ G      DCR        +  S  C C+  + G+ F     T C ++   +RP
Sbjct: 14290 QAQCSCLPEYIGTPPNCRPECITNSECSFDKACLNQRC------RDPCSGTCGSNANCHVISH----TAMCYCLPGFTGDPFTSCVQVPVIQQAEIVQP---CSPNPCGANAVCRQEGHVGSCQCLPEYYGNPYETCRPECV---TNNDC-PSNKACQQQKCRDPCPGVCALNALCRVINHLPTCH-----------CQNGFVGDPYRYCQIPEKPVLKEYINPCQPSPCGPNSQCRENNEQAICSCLPEYVGA----PPNCRPECVTSAECPHDKACIRQKCNDPCPGVCGSNADCRV----IQHAPICSCRAGFTGDAFS-RCLPL-PPSRPPQLDVYRNPCV---------PSPCGQYAECRDNQ----GTATCSCLPSYFGTPPNCRPECTINPDCPSHLSCQQQRCR----------DPCPG--ACGFNALCTVINHNPTCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDLITCGPNAVCNQGQCNCLPEFVGNPLVGCRP--ECVLSTECDW-SKACVRNKCID--------PCPGTCGSNAICEVHRHIAMCHCPPEMTGNAFSQCRPLPPAPVRDVIDPCQPSPCGPNAQCRNINGQAVCSCLRDFIG-------VPPSCRPECVSNAECPLHLACLQRHCRDPCPGVCGLNAECRVINHSPNCHCIGSFTGNPFAACHRPPPPPIKHEPIDPCQPSPCGANAECRVQGSNAQCSCLSGFIGTPPNCRPECVSNSDCPMNLACLNQKCRDPCPGVCGS-------------NAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQTPCVPSPCGANALCSEGNGAGACKCLPEFYGNPYEGCRPECVLNSDCPSHLACLNQHCRDPC-PGTCGINAECQVRDHLPQCNCHVGYQGNPYVYCSVLRDPLPEPVPSRPCQP----SPCGPNSQCRESNNQAICKCLPNFIGSPPACRPECTISSECDLTLACVQQHCVDPCPGVCGNSAQCRVINHSPHCSCLPGFTGDAISGCQRIPPAITHDAPNETPRDPCVPSPCGAFGQCRAQGNQAICSCLPGYYGAPPNCRPECAINPDCASHLACISEKCR----------DPCPG--SCGLQAQCSVINHTPICSCPSGYEGNPFVRCQRTPPTPTPPLHDACNPSPCGSNAICSPGGQCSCLPDFDGNPYVGCRPECVLNTDCARDKACQRSKCTDPCPGACGIGAVCEVRNHIPTCNCPPGTSGNAFVQCTLVQSSPVVPLNPCQPSPCGNNAQCREVNDQAVCSCLPGFFGVPPKCRPECT---INSDCAPH-LACLNQQCRDPCPGACGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYP-SPCGPNAECTNQNEQAICKCLKDYIGTPPNCRPECITSSECPIQLACIGQKCKDPCSGLCGIAATCQVVSHVPSCICIADYIGDPYTGCY--------------------ARPPIQREQINPCYQNPCGSNAVCRERGE--AASCQCLPEYYGNPYEGCR--PECVLNSDCSSH---------LACLNQHCRDPCPGSCAPNAQCQVVNHVPSCSC-YPGYSGDPYRHCHVAQAEPVQVV-----HFNPCQPSPCGPNSQCTES-------------QGQAVCRCLPDYYGSPPACRPECTT---NPEC--------------PNDKACVSRRCTDPCAGACGQNAICRAHQHRAYCSCHPGYTGDAFMRCQSLPSPQPIRDSPVIYRDPCVPSPCGQFAQCRVEYEQAVCSCLTSYYGTPPYCRPECTQNSDCPSHRACVNQRCVDPC-PGACGLNARCDVLNHVPSCSCPEGYLGDPFYRCYPAPAPPPTPVTVVADDPCQPSPCGPNAQCSNGV--CSCLPLYQGDPYVGCRPECVLSTECPWDKACIRNRCLDPCPGTCGSGATCQVHNHVAMCQCPVGYQGNPFVLCQQTPLQAPVELHPCQPSPCGHHGECREVGSQAICTCRLGYYGSPPACRPECVSDPECPPSLACVNQKCRDPCPGACGHLAQCHVINHSPQCVCPAGYTGSPYSEC-HLIRADSSPIQRQPIDPCLPSPCGPHAQCSNEGGNAVCRCLTEYLGVPPYCR---PECIANSECPSDRACINRKCQDPCPGLCGYNAICRTYNHQPNCVCAPGLVGNPFNSCLPPTRPEIPATPPTTAIQVLQYEEPFINGCEPNPCGANAQCNQRRGVVSCVCLPDYFGNPYEACRPECILNSDCPLSRACVQQKCRDPC-PGTCGLNAECHVMDHLPQCRCFSGYTGNPLAYCSPVPIIQESPLTPCDPSPCGPNAQCHPSLNEAVCSCLPEFYGTP-----PNCRPECTLNSECAYDKACVHHKCVDPCPGICGIN---ADCR-------VHYHSPICYCISSHTGDPF-----TRCYETPKPVRP 16525          

HSP 13 Score: 137.502 bits (345), Expect = 3.272e-31
Identity = 750/3246 (23.11%), Postives = 1072/3246 (33.03%), Query Frame = 3
Query: 3558 CSSRCGENAFC----YNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFS-CHPNAKCIKGRCRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCIN----GKCECLAGLQGNPFQQCFDC-----------------------------KRCSQFADCDPWNER--CVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCL-PGLIGDGINFCFDCSTCDINAFCEPFNE--RCVCSVGFTGNGK---KCSILAPI-----------TCKRACHKKAKCVKGKCECLPGLRGDGV---QSCFDCSICDNNTVCYPDQEKCVCN-PGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCF--------------NCTSCHPDALCFP--DQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCFDCRP--CHSFAVCDVENRR--CICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNR--CTCYQGFTGNGLTCNA--------------IELKCEP----SCGENAKCV----NGKCECLPGLQGNPLQHCFNC-----------------KRCDKFADCDVWN--KKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICL-PGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNG-AKCQPIVHE---------CRPG-CGENAKCVNGKCECLPGLQGNPMQHC-------FDCKK----------------CHKFADCDVWN--KKCVCKNGYFGNGYM-CTPINGCNL-----------KCNENALCV----NQKCICLPGFIGDGIK---FCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCL----KGNCECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCH-SNALRVNQQCICLPGFIGDGKNFCFDCSTCPP-----NSDCLPQEQRCIC---KKDYFMNDTQCIHTGRTPQCV--PKCHHYASCVQDKCE-----------------------CLPGFIGDGIKFCFK------------CSSCDPNADCVPEQQKCVCK--TGFYGN--GNKCDKIESTCEPPCAPGGFCNNSKC-----------------------QCNSGLKGDGVTSCFNCSKCDVNAKCFPSV--KKCICVIGYKGDGFRCYPVILECPKCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPK--------CHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDEN--------LCVCAQGFTGNGI-TCKAIDPSCNTNCHKDALCFKDSC-------------ICKSGLSGDGKNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLK---TTCQNDCH---PNAVRVNNC---CRCKNGFFGDGFSFCFNCSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYIGNG-----------FECIS---------------ITSCTQSSDCIRPNE-ICNVAISQCICEANSFLDPISKLCINPNC-QPP-----------CHPKAVCVKGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPAC--NGACHSKAVCVKSSNLESRCLCLPGFV--GDGMTTCTDCSGCDKNAICTEKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQK----CECLPGLVGNGFIKC-----TNCSECHKKALCHDQRGCVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKICITSTDTVKR---CVCKSSFISSNS-GCVPLTC---LSKCHKYANCENGVCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNN------------------QMMIKRSMRAYSGCVPIDCN--PKCHRSALCVIGTCKCPPSFKGNGYSGCFDCSK-----CHANADCDESKGCT--------------------------CKPGFEGNGCY------CRPEDKCKFNSDC-----------NDPLKICVQ--SPDTSRNCVCKPGTTPSTNGKCIILGC--PVQCDKNAVCLSNNCVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVC-----LPGFQDDNGKCSPKECQPKCHMFAICITQTCYCVPGYFGDGIKSCTSCSVCHKNAQC-----LPDRGCVCK------SDFIGDGFNCRP--LDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCE----GGMCQCLSGFIGDGINCQRPFECGIDNPCK--------DQFSVCQLTS----------DAKRFVCVCVFGFQ-MINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGDGIRTCFKCSSCHARAVCSMDG----CKCMPGYVGNGIV-CQTEDQ--CQYDSDCRDR----NAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSP------IDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNFAYCRQK----VCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPK---DQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVK--QCDRNEECLFGQCQ--------------CKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCI-PINCYQPCHKNAYCNIG--------VCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEID 11738
            C   C  NA C    +   C C+ G+ GNP   C    +                +    I ++ PC  S C PNA C  G+C C+    GD    C     C  N+DC  ++    C +   K+          C   CG+ A C        C C  G+QG+ F +C                                  C   + C  ++E+  C C   +IG    C       + C ++ +C N  C+   PG              C I A C   N    CVC    TGN     +  ++ P+            C      +A     +C CLP   G        C + + C  +  C     KC+   PG  G       FS LC    H      +  C C E  VG+    C               N + C  +A C P  D   C C   + G+       ++ICRP C  N+ C + +  C S       + C D  P  C   A+C V N    C C +G  G+  +  +I +  P                PEY+    N C   S C  N+ C     +  C+C   F G   +C                I  KC+     +CG NA+C     +  C C PG  G+ L  C                      C  ++ C V N    C C   Y+G    C      N +C SN  C+N  C    PG  G    F   CS        +     C C  GY  +    C+ +            C+P  CG NA C NG+C CLP   G+P   C        DC +                C   A CD  N    C C     GN ++ C PI                 C  NA C+    N  C CL G+ G        C+  S C    +C+              N K   P      C  KC  NA C     + +CEC+P + G+    C             P   R  C+P   G    C  +  ++ C            +  +  QG   +    C +   C+    C+  + +  C  G  G   QC  ++    P C     +  +   ICLP    + K      + C P     N+ C  Q +  +C   + +Y  N     + G  P+CV   +C    +C++ KC+                       C PG+ G+    C +             S C PN+ C  + +K VC+   GF+GN     C + E T    CA    C NSKC                        C + + G+    C    + +    C PS      IC + Y G     YP  +    C     CV  KC+    L   GIN             C P F      Q  R       ++ E  PK        C  +  CIN  C                   C+ + IC P           LCVC +G+TGN +  C  +    +  C  +  C    C             IC++  +   + +C D  R +    C         +PE R D  +CA +L      C++ C+       RV N    CRC  GF G+    C          D  P   +    +    +   C   ECK  C + T  C              G N +    C    T  +R+M C CLPGY+G               C S               +  C  +S C R  + +     + C C   +  DP +      NC +PP           C P   C+  +C            C     C  +A+C        + Q+S + IC C  G   D Q QC KP C  N  C     C+  + ++    C  G V  G+G      C   +  A+C      IC +G  G+     +   C  N DC                       +    LN  C P+     CA NA+C+ ++    CEC PG  GN  ++C     T   +C + A C  +  C          I  R  D C+    CT P + C       KR   C C    ++  S  CVP+T    +S C   + C N    C  G   D   CRL + C         N +C AR D    C C  GFQ                             +  I R+    S C   DC     CH      I  C+CPP + GN    C   S      C ++ DC  ++ C                           CKPGF GN  +      CR +D+C  +  C           +DP  +  +    +   NC C  G       +C+ L C     C  N  C+SN CV   G           + C+QN+ C          +    + VC     LP   +    C P+  +P C     C ++   C+     D    C+  S CH  AQC     +P R  VC+       D  G      P  L  C  ++DC D  + C+               H    N C        C  NA C+      +C C  GF G+     R   C +D  C         D  + C +             + R  C C+ G++     +C+     I C     C + K  CQ E     +  C   + C  RA C        C+C   ++GN  V C+   Q  CQ D+DC  R    N  C       + CQ +P    E +  SP+            +  +C+C DGY     G  C P      +  C S++DCP ++  C+          +CR                P  C   A CR K    VC CR GF+G+  F C              S+   CPG H+  + + C P    +QC        SNA C        C+C  G+       C P+ C    +C  ++ C+ G+C               CK    H+  +    P      N    +  + +C+    + A C  +K  +   G C+ P N  QPC  NA+C++         +C C   Y G+    C K++LC+ +        K   +     C CP G  +D
Sbjct: 17372 CPGSCAYNAVCRVHEHVPNCYCQTGYTGNPFISCQRTPIAP--------------VQREPIEAKDPCYPSICGPNAVCNNGKCSCIPEYRGDPYVGCR--PECVLNTDCARDK---ACIQQKCKNP---------CPGTCGLQALCHVYNHVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINPCQPTPCGPNSQCRAYHEQAICYCLPNFIGTPPGCRPECTSNSDCPLDKYCLNLRCRDPCPGA-------------CGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPPFCRPECVNSADCPADKACR--NYKCIDPCPGSCG-------FSALCRVVAH------SPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNP------SEICRPECTVNSDCPSHR-ACMS-------EKCRDPCPGVCGLNALCQVINHSPVCECHTGHVGNPYHSCRIPQREPP--------------APEYV----NPC-QPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPCPGACG----FAAQCS-------VINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGHCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCI--------------NNKCVDP------CPGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPR-----VPEPVRDPCQPSPCGPNSQCTNVNGQAEC------------RCLQEFQGTPPNCRPECVSHDECANTLACMNQKCRDPCP-GSCGQSAQCTVSLH--IPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNP----YEGCRPECVGNSECPANQACIRSKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGC-RPECTLSSDCAKDRACINSKCVDACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRV-YNGAATCSYPECVINEDCSRDRACVSQKCR-DPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLR-------QLPEPEPKPECISDGDCTNDKACINQVCR----------------NPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCE--------RPECRSDD-ECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAVRC----------DLVPTQPEGCTMDAECPSKLACFGGECKNPC-DVTHPC--------------GANAI----CEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFT------NCYEPPEIKTGCTHDSECQPTTACINKRC---------QDPCAEANPCAGNAEC--------RVQNS-RPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDP---CTHGQVRCGNGA----QCLAQNHQAVC------ICPTGTQGNPFISCITGHCQYNEDCAD--------------------HEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLAC----------INERCADPCATPHVCT-PQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEV-CSNGNCLDA--CRL-ERCGV-------NAQCTAR-DHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADDCGIGAYCHVQQRKAI--CRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNECVSPCGQ---------RNPCAQNAIC----------QALQHRAVCRCPDQLP-LGNPYAYCEPRPVEPVCRDDGDCPSKL-ACIDDKCQD---PCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPD-QEACI---------------HAQCRNPC-------NCGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRV----IGCSSNNDCPTDK-TCQNE---QCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQ-RPAI-CEVTPTSPV------------RTMLCICPDGYVSRGKG-GCKPTPGIKEVGGCISDSDCP-TDKSCLNS--------VCRD---------------PCNCGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIEC---------SINSDCPGTHVCRN-QLCIPACQGEQC-------GSNAQCLAIEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCK--VYHHRPQCACPPGTVPGKNGCESERHIPICI----SDADCPSQKACLR--GECVNPCNATQPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIE--------KGFVRDVDGQCVCPPGTALD 20200          

HSP 14 Score: 134.806 bits (338), Expect = 2.296e-30
Identity = 430/1706 (25.21%), Postives = 617/1706 (36.17%), Query Frame = 3
Query: 1875 YKCICSPGYSMINNICDKTYSNFKCV-PPCHIDATCYENN---MCICNSGHQGDGXXX-------XXXXXXXXXAEC--YPEISKCKCKPGFVGSGYECREEVNCDIKCHE-----NASCVNGYCKCNRNLIG----DGINSCFDCLKCNTEADCS--PYENRCYCRPGYTGNGFTC---IKSC-DKICHKDALCQNS----RCICKPNFEGDGVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANHAICTVENT-----CQCRKNYYGNPLEKC---NIDCS-KCHTDSDCDKTNGYCKCRYGFFGDGFTCNKTCCV---------EKCHEQAQCVDGK----CLCKPGFSGDGVETCFHCSQ------CDSNAIC--DQNNKACICKSGFEGN----GINCLRAINCK------QKCHKQARCLLGK----CICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFH-----GDGIQCK------LLPLCTPACHPQASCINGNCKCNNNLIGDGISSCF--------DCDK------CSMNARCDVSN--QRCICQPGYEGN-----GIKCVKTC-FQSCHKLAVCKEGT----CKCSNGLTGDGVNF---------CFNCSLCDKNAKCLINE----EKCECMERFE--GDGFTCQDKVDCSSR-----CGENAFCYN----GTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCING----KCECLAGLQGNPF--------QQCFDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTK--CHVNGFC---ENQECKCLPGLIGDGINFCFD---CS--TCDINAFC--EPFNERCVCSVGFTGNGKKCS-ILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSICDNNTVCYPDQEK--CVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCK-------SEFVGDGKICTLRADICRPTCGENAICVNGQC--QCQSGLQGNPLKHCFDCRPCHSFAVCDVENRRCICQSGFEGDG----RNCKKIKECSPKCHRNAVCI----NQNCVCIPEYIGDGINFCFNCS-------SCDRNADCEPHNNR--CTCYQGFTGNG-LTCNAIELKCEPSCGENAKCVNG----KCECLPGLQGNPLQHC-------------------------FNCKR-----------CDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCN--NKCDSNALCVNRHCICLPGFTGDGTRFCFDCSS---CPKNSNCLPEEQK--CICQEGYIMNGAK----CQP--IVHECRPGCGENAKC---------VNGKCECL---PGLQGNPMQHCFDCKKCHKFADCD---VWNKKCV----------CKNGYFGNGYMCTPINGCNLK---------CNENALCVNQ----KCICLPGFIGDGIKFCFDCSAC-PANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGN----CECLPG-FVGDGIQVCFNCST--CDKNANCFPYQ 6122
            Y+C C PGY              +C   PC  +A C   +    C+C  G+ GD              N C   AEC       +C+C  GFV       +++   +   +      A+ +  Y + +   +     D  N      KC T A C   P   RC C  G+ G G+     I  C D  C ++A+C ++     C CKP++ GD    C D  +C  L +                                 PC  HA+C  ENT     C+C + Y G P  K     +D +  C ++ DC   N  C     F  DGF    + CV         E C   AQC++      C C+ G+ G        C Q      C ++A C  DQN   C+C+ G+  N       C+    C         C + A C        C C  G +G+    C +   C   A         +C +G       G G  C+        P  +  C P  SC + N  C  N I D    C         DC        C  +A+C ++N   +C+C PGY GN     G   +  C    C + A+C        C+C  G +GD             C + + C     C+ +       C C + +E   +   CQD  +CS +     CG NA C N      C+C  G  GNP      C +C+ P        +C C +   +   +     C     C  G   C+S  I  G +YC    +C +    +P+        G   D + C    A+    C   AQC+N      C C  G QG+ +        ++C   + C+    C    E CVC   Y  +     K  +   +  C +N  C   +  +C C  G  GD +  C D   CS   C   A+C  +    +CVC   +TG+  K   I    T K  C     C       L  L G  V  C    +C +N  C  +Q    C C  GY  +G                +  CV+   +C + + GDG             ALC P  +  +CK       + F G G   T +    RP CGE  IC+NG+C  +C+  +             C   A CD  N +CIC+  F G+         +  +CSP C  NA C        C C P   G+    C   S       SC  NA+C    N   C C QGF+GN  + C  ++      CG NA C+N     +C CL G  GNP   C                         ++C++           C   A CD  N  C+C  GY+G+      V+GC+   +C ++A C++   IC     G G R C D  S   C  N+ C+ E+ +  CIC +G+  N +     CQP   V E    C  +  C         VNG  EC+     +   P + C      H   +C    VWN                +    +   C P     LK         C  N++CV +    +C CL GF+G+      D + C PA  +      EC+ ++    +E   +   +P   T KC   A C+  N    C+C PG F GD       C +  C  N +C P Q
Sbjct:  278 YRCDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDK---------------------------------PCGQHAVC--ENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDC-TNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPR--MACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGAS--------KCGAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSC-SANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPF---IMCEICNTP--------ECQCQSPYKLVGNSCVLSGCSSGQACPSG-AECIS--IAGGVSYC----ACPKGYQTQPD--------GSCVDVDECEERGAQL---CAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGE-CVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLLGCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASN----LACLEGSCVSPCSSL-LCGSNAYCETEQHAGWCRCRVGYVKNG----------------DGDCVS---QCQDVICGDG-------------ALCIPTSEGPTCKCPQGQLGNPFPG-GSCSTDQCSAARP-CGERQICINGRCKERCEGVV-------------CGIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCSQASCGPRAICDAGN--CICPMGYIGDPHD--QVHGCSIRGQCGNDADCLHSE-ICF--QLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNP----NDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQ 1843          

HSP 15 Score: 126.331 bits (316), Expect = 7.602e-28
Identity = 525/2222 (23.63%), Postives = 729/2222 (32.81%), Query Frame = 3
Query: 6954 KCICVIGYKGDGFRCYPVILECPKCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGDG-KNCVKI---------DECSP-KCHQNAVCINS----NCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALC----FKDSCICKSGLSGDGKNYCFDCKR--------------CDQNAICRPTEQRCVCK--PEFRGDGFQCALNLKTTCQ------------NDCHPNAVRVNNCCR---------CKNGFFGDGFSFCFNCSNCSPNA------DCFPH-------------LSKCQCKEEFTG----------------NGFICQRKECKPACSEA---TSLCI----KNQCFCRPGLIGDGYNCL-----------------DCRKCHEKATCNIRSMKCECLPGYIGNGF-----ECISITSCTQSSDCIR------------PNEICNVA--ISQCICE----ANSF-----LDPISKLCINPNCQP-PCHPKAVC--VKGKCICN--RNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDC---------------SGCDKNAICTEKQG----CICKSGFIGDGRQCIVLNECADNSDCTT---------------IRGRASECI-------------RSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCI----YQKCECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSH------GYSGDGIQCRIEDQ-----------------CSLNSDCTD--------------PNKICITSTDTVKRCVCKSSFISSNSGCVP-----------LTCLSK---------CHKYANCE----NGVCKCILGYVGDGIIC--RLPDECKSSLDCKYENQECVAR----------LDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRS----ALCVI----GTCKCPPSFKGNGYSGCF--------------DCSKCHANADCDESKGCTCKPGFEGNGCY-CRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNN----CVCKTGYSGTGLNCKPNDQCS--QNSDC-------PEP---NSRCEMMKDYNRKCVCLPGFQDDNGKCSPK-ECQPKCHMFAICITQTCYCV-PGYFGDGIKSCTSCSVCHKNAQCLPDRG---CVCKSDFIGDGF-NCRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDGINCQRP-----FECGIDNPCKDQ------------FSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGDGIRTCFKCSSCHARAVCSMDG----CKCMPGYVGNGIV-CQTEDQCQYDSDCRDRNA------------ACFPG-----VDKGKKCQCKPGFSLEN------SLCSPI------ACRPK-CGKNSQCQ----LGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNFAYCR----QKVCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPINCY--------------------QPCHKNAYCNIGVCTCNPDYIGDGITSCKKKNLCLEDSDCPI------------------IGSKCMTKSNPYSCKCPSGYEID------NNKCIAKKCLLPCDPNAVCVLGEC---------ICKVGFTGNGLQCMPT----SKCNPLSGCSDTNSVCIQVPP------------TNYYDCMCKPGYIKSSNLSICKPIVCEPSCHPKAACIIGSCICMKPLIGNGITECKLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVDCPTRKICVNSKC 12281
            +C C+  Y G    C P  +   +C +   C+  +C+          + C      + N     + + C C  G+ GD   +CV++           CSP  C  NAVC       +C CLP Y GN    C    +C  N  C  ++    C Q         K  DP C   C  +ALC       +C C++G  GD   YC   ++              C  N+ CR   ++ +C   PE+ G    C     T+ +            ND  P     N  CR         C+ GF GD FS C       P         C P               + C C   + G                +   CQ++ C+  C  A    +LC        C C PG IG+ +                    D   C   A CN    +C CLP ++GN       EC+  T C  S  C+R             N IC V   I+ C C      N+F     L P     +   CQP PC P A C  + G+ +C+  R+ +G    CR   EC ++A+C             L   C         LQ  C+ P C G C   A C +  N    C C+  F G+    C                  S C  NA C   QG    C C SGFIG    C    EC  NSDC                 + G  +EC              ++      CQ  +        C P     PC  NA+C        C+CLP   GN +  C    EC   + C     C+  H      G  G   +C++ D                  CS+  D                 PN  C  S +    C C  +FI S   C P           L C+ +         C   A C     +  C C+ G+ GD I    R+P         +     CV              +  +C+C  G+            +  I     ++  C+   C   C  S    A C +      C CP  ++GN +  C               + S C +NA C     C+C P F+GN    CRPE  C  N+DC             +R+  C+         KC    CP  C   AVC   N    C C  G SG         QC+  Q+S         P P   N++C  + D    C CLPGF     KC P+      C     C+ Q C    PG              C + AQC   R    C C + F G+ F  C+ L      +  R+P   C  +P   N +CT                     ++N   E  +C+CL  +IG   NC RP      EC I   C  Q             + CQ+ S     +C+  +                    +    +G C  +  +Q + I  C++ + C + AVC   G    C+C+P Y GN    C+ E  C  +SDC    A            +C P      V+    C C PG+S +       +   P+       C+P  CG NSQC       VC C   Y  S    +C P   C +  +CP+             K C+ R+   P          C   C   A CR    +  C C  G+ GD    C                  + P P  I D      +D C + S C    A C + Y+   C C   Y         P  C  +C +N +C        P      N+ CV+P       P +C   L       N    C C +G++    Y     CY                     PC  NA C+ GVC+C P Y GD    C+ +  C+  ++CP                    G+ C   ++   C+CP GY+ +           A   L PC P+     GEC          C++G+ G+   C P      +C P   C   N  C    P             +   C+C  GY  S   S C  I  + S                P+    I  C LP  C     C N+         G   C C   +      C  + EC  N +CP+ + C+N KC
Sbjct: 14292 QCSCLPEYIGTPPNCRPECITNSECSFDKACLNQRCR----------DPCSGTCGSNANCHVISHTAMCYCLPGFTGDPFTSCVQVPVIQQAEIVQPCSPNPCGANAVCRQEGHVGSCQCLPEYYGNPYETCR--PECVTNNDCPSNK---ACQQQ--------KCRDP-CPGVCALNALCRVINHLPTCHCQNGFVGDPYRYCQIPEKPVLKEYINPCQPSPCGPNSQCRENNEQAICSCLPEYVGAPPNCRPECVTSAECPHDKACIRQKCNDPCPGVCGSNADCRVIQHAPICSCRAGFTGDAFSRCLPLPPSRPPQLDVYRNPCVPSPCGQYAECRDNQGTATCSCLPSYFGTPPNCRPECTINPDCPSHLSCQQQRCRDPCPGACGFNALCTVINHNPTCQCAPGFIGNAFTSCHVPPPIVRDPPQISDPCDLITCGPNAVCN--QGQCNCLPEFVGNPLVGCRPECVLSTECDWSKACVRNKCIDPCPGTCGSNAICEVHRHIAMCHCPPEMTGNAFSQCRPLPPAPVRDVIDPCQPSPCGPNAQCRNINGQAVCSCLRDFIGVPPSCRP--ECVSNAEC------------PLHLAC---------LQRHCRDP-CPGVCGLNAEC-RVINHSPNCHCIGSFTGNPFAACHRPPPPPIKHEPIDPCQPSPCGANAEC-RVQGSNAQCSCLSGFIGTPPNC--RPECVSNSDCPMNLACLNQKCRDPCPGVCGSNAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQTPCVP----SPCGANALCSEGNGAGACKCLPEFYGNPYEGCR--PECVLNSDCPSHLACLNQHCRDPCPGTCGINAECQVRDHLPQCNCHVGYQGNPYVYCSVLRDPLPEPVPSRPCQPSPCGPNSQCRESNNQAI-CKCLPNFIGSPPACRPECTISSECDLTLACVQQHCVDPCPGVCGNSAQCRVINHSPHCSCLPGFTGDAISGCQRIPPAITHDAPNETPRDPCVPSPCGAFGQCRAQGNQAICSCLPGYYGAPPN---CRPECAINPDCASHLACISEKCRDPCPGSCGLQAQCSVINHTPICSCPSGYEGNPFVRCQRTPPTPTPPLHDACNPSPCGSNAICSPGGQCSCLPDFDGNPYVGCRPE--CVLNTDC-------------ARDKACQ-------RSKCTDP-CPGACGIGAVCEVRNHIPTCNCPPGTSGNAFV-----QCTLVQSSPVVPLNPCQPSPCGNNAQCREVND-QAVCSCLPGFFGVPPKCRPECTINSDCAPHLACLNQQCRDPCPG-------------ACGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQ--REPINPCYPSPCGPNAECT---------------------NQN---EQAICKCLKDYIGTPPNC-RPECITSSECPIQLACIGQKCKDPCSGLCGIAATCQVVSHVPSCICIADY--------------------IGDPYTG-CYARPPIQREQINPCYQ-NPCGSNAVCRERGEAASCQCLPEYYGNPYEGCRPE--CVLNSDCSSHLACLNQHCRDPCPGSCAPNAQCQVVNHVPSCSCYPGYSGDPYRHCHVAQAEPVQVVHFNPCQPSPCGPNSQCTESQGQAVCRCLPDYYGSP--PACRP--ECTTNPECPND------------KACVSRRCTDP----------CAGACGQNAICRAHQHRAYCSCHPGYTGDAFMRCQ-----------------SLPSPQPIRDSPVIY-RDPC-VPSPC-GQFAQCRVEYEQAVCSCLTSYYG------TPPYCRPECTQNSDC--------PSHRACVNQRCVDPC------PGACG--LNARCDVLNHVPSCSCPEGYLGDPFY----RCYPAPAPPPTPVTVVADDPCQPSPCGPNAQCSNGVCSCLPLYQGDPYVGCRPE--CVLSTECPWDKACIRNRCLDPCPGTCGSGATCQVHNHVAMCQCPVGYQGNPFVLCQQTPLQAPVELHPCQPSPCGHHGECREVGSQAICTCRLGYYGSPPACRPECVSDPECPPSLAC--VNQKCRDPCPGACGHLAQCHVINHSPQCVCPAGYTGSP-YSECHLIRADSS----------------PIQRQPIDPC-LPSPCGPHAQCSNEG--------GNAVCRCLTEYLGVPPYC--RPECIANSECPSDRACINRKC 16252          

HSP 16 Score: 114.005 bits (284), Expect = 4.619e-24
Identity = 518/2113 (24.51%), Postives = 729/2113 (34.50%), Query Frame = 3
Query: 7788 FTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGY---NCLD-------CRKCHEKATCN--IRSMKCECLPGYIGNGFECISITSCTQ---SSDCIRPNEICNV-AISQCICEANSFLDPISKLCINPN-CQPP--CHPKAVCVKGK----CICNRNLVG---------DGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQC----QKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAICTEKQGCI---------CKSGFI-----------------------------------GDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNG-KCEPLS--CIYPCAKNAVCIYQK----CECLPGLVGNGFIKCTNCSECH-------KKALCHDQ---RGCVCSHGYSGDG------IQCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPL----TCLSKCHKYANCENGV----CKCILGYVGDG--IICRLPDE---CKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPID-CNP------KCHRSALCVIG----TCKCPPSFKGNGYSGCFDCSKCHANAD-CDESKGCTCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPV--QCDKNAVC-LSNNCVCKTGYSGT-------GLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDN---GKCSP-KECQP-KCHMFAICITQT----CYCVPGYFGDGIKS---------CTSCSVCHKNAQCLPDR-----GCVCKSDFIGDGFN--CRPLDECRINEDCRDPNKMCLLNPSMKNL----QCTCKPLH----ILINNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGDGIRTCFKCSSCHARAVCSMDGCKCMPGYVG---NGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLE---NSLCSPIACRPKCGKNSQCQLG---VCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGL----FQGKRCMCRKGFI--------------PKSV----------FQCIEETCPNKCHNF-----AYCRQK----VCQCRLGF----QGDGVFNCHDCSVCHPNAICSP-SLGCTCPGPH-LIGD---GRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQ---CKLGYIKFNNSLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPINCYQPCHKNAYCNIGV----CTCNPDYIGDGITSC--KKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYE-------IDNNKCIAKKCLLPCDPNAVCVLG----ECICKVGFTGNGLQCMPTSKCNPLSG--CSDTNS-VCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVCEPSCHPKAACIIGSCICMKPLIGNG---ITECKLPDECSASVHCKNK------------------------NAFCKNSTEGQMKCICKHGF-----------------QLENSKCISKQECR-------------------VNVDCPTRKICV-----NSKCICPEQYTSSPDGKLCELPMIMVVPSKLDVPETK---------------------DVEVLCFFENGIGNVNYLSWRRISPLMTMNFIRQPASVKLIIQKATVGDSGIYQCCIDSNSSPLNCKFASVNIFTKKCSP---CSLNQHCDPVTSNCICD----AGFQFDSNGICQRRNCLY-----FPEICDQVTMICDKGNCVCKSELYMDNKVCVPKDQCKTNEDCDPNAICKTDKRCHCGVLFNG-PGKFCAPIKLGCEVTKDCDPNGECFAIGISPTRLCQCKPGYVGDGKT--CKPAG 13067
            F G   + +  +C   C +  + C    C        DGY   NC+D        R C   A C   + S  C C PGY GNGF C  I  C     ++ C+   E CN+ A   C C+ + +      LC + + C+ P  C P A+C        C C    VG         D  +C  P  C   A C   +   R         C C  G   D + +     Q       C   A C+ +     RCLC  G+ GD M  C D   C  N  C     C+         C SGF+                                   G G  C+ ++EC +  D     G  ++CI +  G  +C C  GF+      CE ++     PC +NA+C        C C P   G+ F  C +  EC        + A+C +      C C  GY G         Q  +   CS N DCT+ N  CI +     +C C   F    S CV +    T    C  +A C N      C+C  GYVG    + C+ P E   C +   CK +  E          C C+ G  W    S +              +GCV ID C+        C ++A C       TC CPP F G+ +S C D  +C   A  C     C   PG    G  CR    C  N+         +  PD S  CV              I+ C     C  N++C  +  C+C     G         LNC  + QC              M+ +   +C+C PG+  ++   G C+   EC+   C   AIC        C C  G  GD  +          C+  + C     C+ D       C+C+  +  +  N  C+ +DEC +          C LN   KNL    +C C   H     ++   C   EC  +C    K  G  C  LSG    G  C    EC              ++       C C  G+Q      QP+              G CV   E +  G + C   + C  +       C C  GY G   NG+    + +C  D +C        PG     +C C P + L+   N+ C     R  CG N++C       C+C+ G+          P+  C  E++C  S+  C Y         G +C+C K +               PKS             C+E +C + C +      AYC  +     C+CR+G+     GD V  C D  +C   A+C P S G TC  P   +G+   G SC   DQC     C +   +C       +C+   C +G                 CDRN     G+C C+P F+ N +  C+ P +                     AK                    C   C +NA+C  G+    C CNP   G+    C  + KN+C  +S  P   ++C    N  SC CP G+         D ++C  K C L    NA C+      EC+C  G  GN     P S C P+    C D N   C +          C  GY  S     CK +  + SC P+A C  G+CIC    IG+    +  C +  +C     C +                         NA C  S + +  CIC  GF                   E  KC S Q+C                     NV C   ++C      ++ C C E Y  +P    CE P +    S  + P+                           +C      G  + L+    +P        QPA        A   +S    C  D ++  L C+ A     T KC P   C  N H     + C C     AG  +D    CQ   C+Y       ++C+++T  C     VC  E   DN +C+ +D           A+C+      C   F G P    A  K G      C P+  C      P  +C+C P +VGD K+  C+P G
Sbjct:   81 FLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGYGGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCK-DGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYR---------CDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDG-SFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDEC-NQPDGVAKCGTNAKCI-NFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTN-NAECIEN-----QCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNE--------AYCVCEDG--WTYNPSDVA-------------AGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAECVNVPG---GGYTCR----CPGNT---------IADPDPSVRCV-------------PIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQC--------------MLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRG----KPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPEC--QCQSPYKLVGNSC-VLSG-CSSGQACPSGAEC--------------ISIAGGVSYCACPKGYQT-----QPD--------------GSCVDVDECEERGAQLCAFGAQCVNKP--GSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPG-----ECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFK-------GDPLLGCTDEDEC--SHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDV-ICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCS-TDQCSAARPCGERQ-ICINGRCKERCEGVVCGIGAT---------------CDRNN----GKCICEPNFVGNPDLICMPPIE--------------------QAK--------------------CSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGP--NAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANKPCGL----NAACLNRAGGFECLCLSGHAGN-----PYSSCQPIESKFCQDANKCQCNE-------RVECPEGY--SCQKGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCVDACSKIQCGPNALCV-SEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGC--QPAQKHHCRNHAECQES--EACIKDESTQTLGCRPA---CDTVKCGPRAVCVTNNH----QAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFD---VCDEESCGDNAICLAEDH---------RAVCQ------CPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGP--VCKCPPLFVGDAKSGGCRPDG 1937          

HSP 17 Score: 113.235 bits (282), Expect = 7.255e-24
Identity = 702/3012 (23.31%), Postives = 974/3012 (32.34%), Query Frame = 3
Query: 4908 CICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPHNN--RCTCYQGFTGNGLTC-----------NAIELK--CEPS-CGENAKCVNGKCECLPGLQGNPLQHC-------FNCKR----------------CDKFADCDVWN--KKCVCKNGYMGNGLT-------------------------CISVNGCN-NKCDSNALCVNRH----CICLPGFTG--DGTRF-CFDCSSCPKNSNCL---------------------PEEQKCICQEGYIMNG-AKCQPI---------VHECRPG-CGENAKCV----NGKCECLPGLQGNPMQHCFDCKKCHKFADCDV----WNKKCV-----------------------CKNGYFGNGYMC------TPINGCNLKCNE-----NALCVNQK----CICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGN----CECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCV------CKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIK---TCFNCSSCSIEAICVPD--QEKCICKAGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDC-----------------STCPPNSDC--LPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYA------SCVQDKC-ECLPGFIGDGIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKI----------ESTCEP-PCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGFRCYPVILECP-KCHYRAQC----VIGKCQCKNGLQGDGINFCM---------------NCSECDKNAQCFPN--FSKCECRQGYRGDGKNCVK-------------------IDECSPKCHQNAVCI----NSNCHCLPMYTGNGVSFCF---------------NCAQCDANAICK--PDENLCVCAQGFTGNGITCKA-------------------IDPSCNTNCHKDALCFKD----SCICKSGLSGDGKNYCFDCKR-----------------CDQNAICRPTEQRCVC---KPEFRGDGF-----------QCALN---LKTTCQNDCHP----NAV-RVNN---CCRCKNGFFGDGFSFCFN------------CSNCSPNADCFPHLSK--CQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDC--RKCHEKATCNI--RSMKCECLPGYIGNGF-------ECISITSCTQSSDCIRPNEICNV-------AISQCICEANSFLDPISKLCINPNCQPPCHP--------KAVCVKGKCICNRNLVGDGY-----QCRAPE---ECNNDADCVQ----FQEVCRK--DQSSL------------KKICKCKDGLVRD----------------------LQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTC--TDCSGCD--------KNAICTEKQGCICKSGFIGDGRQCIVLNECAD-----------NSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCE-PLSCIYPCAKNAVCIY--------QKCECLPGLVGNGFI-------------------------------KCTNCSECHKKALCHDQRG---CVCSHGYSGDGIQ-----CRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCE----NGVCKCILGYVGDGIICRLPDECKSSLDCKYE----NQECV----------------ARLDSSLMCTCKSGFQWKSEKSSLVN----NQMMIKRSM--RAYSGCVPIDCNPKCHRSALCV----IGTCKCPPSFKGNGYSGC-----FDCSKCHANADCDESKGCTCKPGFE--GNGCYCRPEDKCKFNSDCNDPLKICVQSPDT----SRNCVCKPGTTPS-----------------TNGKCIILGCPVQCDKNAVCLSNN----CVCKTGYSG--------TGLNCK--PNDQCSQNSDCPEPNSRCEMMKDYNRKCVCL-PGFQDDNGKCSPKECQPKCHMFAICITQ----TCYCVPGYFGDGIKSCTSCSV-----CHKNAQCLPDRGCVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCLLNPSMK-NLQCTCKPLHILINN------YCLPKEC------TSKCHKNAKCEG----GMCQCLSGFIGDG------INCQRPFE---------------CGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMIN--SKCQPEPCPINCHPLAQCKSGKCVCQGELQGDGIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSD--CRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPK--CGKNSQCQL----GVCVCKDGYS----PSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLF------------QGKRCMCR--KGFIPKSVFQC------------IEETCPNK-----------CHNFAYCRQK----VCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDS----LKCQCKLGYIKFNNSLCYPIPCVKQ---------CDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGF--------------IN---------KFGYCIPINCYQPCHKNAYC----NIGVCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCDPNAVCVLGECICKV 11822
            C+C   + G   NC+     +  C  +  CIN+ C           + C    SC  NA C  H +   C C  G+TGN                 IE K  C PS CG NA C NGKC C+P  +G+P   C        +C R                C   A C V+N    C C  G  G+                               +N C    C  N+ C   H    C CLP F G   G R  C   S CP +  CL                          C+C      N    CQPI         V+ C+P  CG N++C       +C CLP   G P    F   +C   ADC       N KC+                       C  GY GN Y        +P     L CN      NA C        C CLPG+ G+  + C     C  NS+C P  + C       M+EK   P      C   C  NA C   N    CEC  G VG+    C             P +E         C+P   G    C +   ++IC                CL  F G        C   + C  +  C+    Q+ C    G  G   QC  ++   SP C            C PGF GD    C                    S C P S C  +     C C  +Y          G  P C P+C   A      +C+ +KC +  PG  G    F  +CS  +           C C  G+ G+     ++             C+P PC     CNN +C C     GD  T C    +C +N+ C P  + C+          +C   +  CP  C   A C     I  C C   + G+    C                  S C  NAQC      + C C  GY G   NC                     +D C  KC  NAVC      ++C C+P YTGN    C                  + C  N+ C     +  C C Q F G    C+                     DP C  +C + A C       +C C  G++GD    C    R                 C  NA+CR   +  VC   + E+ G+ +           +C  N   +++ CQ+ C       A+  +NN    C C  G+ G+ F+ C               S C PN+ C     K  C+C   F GN      + C+P C+ ++       C            C+D    +C   A C     S  C C    +GN F       +   I  C Q S C R N IC V       +  +C+   +   D   + C++  C+ PC          +A+  K  C C     G  Y     Q   PE   EC +D DC        +VCR   +QS++            + +C C +G   +                      +  QC  P     C + A+C    N  +RC CL G+ G+ +  C   +C   D        +N  C +   C       G G QC V N  A               C  +  +   C   +E      C        G+C+ P    +PC  NA+C            C CLPG VG   I                                C + S C + A C  Q+    C C     GD          I+  C+ +S+C  P   CI      KRC              P    + C   A C       +C C  G+ GD  +     ECK + DC Y+    N+ CV                   +   +C C +G Q     S +      N+         R    C P+     C  +A+CV       C+C P ++GN +  C         +C  +ADC     C  +   +       C P+  C            C    DT    SRNCV  P T P                  +NG C+      +C  NA C + +    C C  G+ G        T ++    PN  CS+N DCP             R  +C+ P   DD            C + A C  Q     C C PGY G+  + C   S      C  +  C  +  C+  +       NC P  EC +    ++ + +C   P    N Q  C P+    ++       C+ +EC      +  C  NA+C G      C+C  G  GD       + C   ++               CG  NPC  Q ++CQ      R VC C     + N  + C+P P    C     C S K  C  +   D    C   S CH  A CS+     +       +VC+  +    D+   CR       PG +  + C        +   C    CR    CG N+ CQ+     VC C+DG+      S   + C     C S   C   N  C+   L             Q  R  CR   G+      +C             ++TC N+           C   A CR +    VC+C + F G+   +C       P  IC   L   CPG     + +   P   C +   C+   A+C +T  S    + C C  GY+      C P P +K+         C  ++ CL              N  C +P +C +N  A C+          + K +C CR+GF              IN         +   CIP    + C  NA C    +  VC C P + G+   +C     C  D +CP                        +  C+  KC  PC   A+C   E +CKV
Sbjct: 17334 CVCLPNYRGTPPNCRPECVINSDCPSSLACINEKCR----------DPCPG--SCAYNAVCRVHEHVPNCYCQTGYTGNPFISCQRTPIAPVQREPIEAKDPCYPSICGPNAVCNNGKCSCIPEYRGDPYVGCRPECVLNTDCARDKACIQQKCKNPCPGTCGLQALCHVYNHVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINPCQPTPCGPNSQCRAYHEQAICYCLPNFIGTPPGCRPECTSNSDCPLDKYCLNLRCRDPCPGACGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPP---FCRPECVNSADCPADKACRNYKCIDPCPGSCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICR--PECTVNSDC-PSHRAC-------MSEKCRDP------CPGVCGLNALCQVINHSPVCECHTGHVGNPYHSCR-----------IPQREPPAPEYVNPCQPSPCGANSQCRESQGQAIC---------------SCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPC---PGACGLNAQC--HVRNHSPLCS-----------CQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYV---------GAAPNCRPECTINAECPSNLACINEKCRDPCPGACG----FAAQCSVIN-------HTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCR--PECVLNSDC-PRNRACV--------NQKC---VDPCPGHCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDECANTLACMNQKCRDP-CPGSCGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLA---QGCRPECTLSSDCAKDRACI--------NSKCVDACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPC-QPSPC-RSNGICRVYNGAATCSYPECVINEDCSRD---RACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCNC-------GIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAE------CPSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSEC-QPTTACIN-----KRCQ------------DPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCV--PITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPR--------DQICRNEICISPCAADD------------CGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACI--NTQCASPCNCGPNAECTV----KNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNECVSPCGQRNPCA-QNAICQALQ--HRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPS-KLACIDDKCQD---PCSVLSPCHPTAQCSV-----LNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCP-------DQEACIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKAC--INGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRP----PPQPIC--QLDTDCPGRQACINEQCVDP---CVVLEPCQRP-AICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCL--------------NSVCRDPCNCGLN--AECR--------IKDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCLAIEHRAVCECIPGHGGNARIACTPLG-CRSDDECPT-----------------------DKACVNGKCNDPCTTTALCAQDE-LCKV 20082          

HSP 18 Score: 105.531 bits (262), Expect = 1.581e-21
Identity = 400/1702 (23.50%), Postives = 549/1702 (32.26%), Query Frame = 3
Query: 2085 SKCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGDGINSCFDCLKCNTEADCSP--YENRCYCRPGYTGNGFTCIKSC--------------DKICHKDALCQNSRCICKPNFEGDGVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANH----AICTVEN---TCQCRKNYYGNPLEKCNI--------------DCSKCHTDSDCDKTNG--YCKCRYGFFGDGFTCNKTC-CVEKCHEQAQCVDGKCL-----------------------CKPGFSGDGVETCF---------------HCSQCDSNAICDQNN--KACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNT--CECNSGFHGDGIQCKLLPLCTP--------------ACHPQASCINGNCKCNN----------NLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEG----TCKCSNGLTGDGVNFCFN------------CSLCDKNAKCLINEEK--CECMERFEGDGFT--CQDKVDCSSRCGENAFCYNG-----------------------TCKCKLGFQGNPLEHCFD--------------------CRVCHYPAYCDIP--------NRKCICITENDIFSRTPCSFSCHPNAKCI----KGRCRCLSNLIGDGTTYCF----------------NCSS------------CARNSDCKPEQQ--------TCTCKRGYVKDG-NNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVT--KCHVNGFCENQECKCLPGLIGDGINFCFDCSTCDINAFCEPFNER--CVCSVGFTGNGKKCSILAPI-----TCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRK-CKCNERLVGDGVNFCFNCTSCHPDALCFPDQQE--CSCKSEFVGDGKI-----------CTLRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCFDCRPCHSFAVCDVENRR--CICQSGFEGDGRNCKKIKECSPKCHRNA------VCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGL------------------TCNAIELKCEP-----SCGENAKCVNGK----CECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVC-KNGYMGNGLTCISVNGCNNKCDSNALCVNRH-CICL------------PGFT-GDGTRFCFD------CSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVN----GKCECLPGLQGNPMQHCF------------------DCKK-----------------CHKFADCDVWNKKCVCK--NGYFGNGY-MCTP-----INGC--NLKCNENALCVNQKCI---------------------CLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCL----KGNCECLPGFVGDGIQVCF 6077
            + C C P +VG+   CR E   + +C  N +C+N  C+          + C     C   A CS   +   C C  GYTG+ FT  +                   C  +ALC N +C C P + GD                  P TG   CRP  V +             C  PC  H    A+C   N    C C +   GN    C                  S C  ++ C + NG   C C  G+FG    C   C     C +   C++ KC+                       C P ++G+    C                  S C  N+ C   N    C C   F+G   NC        +C     C+  KC           + C    SC  +A+C    +   C+C  G  GD  +     +C P               C+P     N  C+               IG+    C    +C  N+ C  +NQ CI          KC   C   C   A+C        C C  G TG+    C               S C  N+ C I  EK  CEC+  F G+     C+ +   SS C ++  C N                         C C     GNP   C +                    CRV +  A C  P        +R   C+++     R PC  +C  NA C     K  C C     G     C                 +C++            C +++ C P+ +         C C  GY  +   NC ++  R   EC  N  C+N +C    G     F QC     C   AD +    RC C  GY GN     +   C +  +C  +  C N+ C+              D   C I A C   N R  C C  GF+GN      L P      T    C  K  C  G+C+       D    C   +IC+           C C PGY G+            + C  + +C + + C+      G+ VN C + + C   A C   Q    CSC     GD              CT  ++ C+PT      C+N +CQ            C +  PC   A C V+N R  C C +G+ GD     +++   P+C  NA       C+N+NCV   +    G   C N + C        H   C C  G  GN                     C+ +   C P     +C  NA CV  +    CEC PG QGNP   C          D  V   K  C ++    + L CI+   C + C +  +C  +  C  L            PG T  D +R C         S C  NS C   E   +C  G  ++  + +         CG NA+C       +C C  G QGNP   C+                  DC +                 C   A C V  +K +C+   GY GN    C P     + GC  +  C  N  C+N +C                      C PGF G+     F C+     S+      EC   K     E I      P L +  C  NA+C     + NC C  G  GD    C 
Sbjct: 17990 ASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCR----------DPCPG--ACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGD------------------PYTG---CRPECVLNSDCPRNRACVNQKCVDPCPGHCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDECANTLACMNQKC----------RDPCPG--SCGQSAQCTVSLHIPNCQCPVGMTGDPFR-----ICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCR--PECVGNSECP-ANQACI--------RSKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQK---CRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCG-----FTQCGTGAICR--ADFN-HRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCE--------------DPCNCGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECK----NPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACR-----GGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSE-CQPT----TACINKRCQ----------DPCAEANPCAGNAECRVQNSRPICFCPAGWGGD----PQVQCYKPECKINADCPYDKTCLNENCV---DPCTHGQVRCGNGAQCLAQN----HQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQC----------DIPVKTPKPQCIQDADCPSKLACIN-ERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTE---VCSNGNCLDACRLE--------RCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADDCGIGAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQ---FGCAPIGCRSD-----DECSGDKQCVNRECI-----NPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCL 19535          

HSP 19 Score: 103.219 bits (256), Expect = 9.001e-21
Identity = 434/1732 (25.06%), Postives = 614/1732 (35.45%), Query Frame = 3
Query: 1860 MSSAPYKCICSPGYSMINNICDKTYSNFKC-VPPCHIDATCYENN---MCICNSGHQGD--------------GXXXXXXXXXXXXAECYPEISKCKCKPGFVGSGY--ECREEVNCDIKCHENASCVNGYCKCNRNLIGD---------GINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIK---SCDKICHKDALCQN-----SRCICKPNFEGDGVNYCFDCSKCHKL--------AQCHPKTGNCTCRPP--YVGDGVSE-CETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNPLE--KCNIDCSK--CHTDSDCDKTN-GYCKCRYGFFGD---GFTCNKTCCVEKCHEQAQCVDGK----CLCKPGFSGDG------VETCFHCSQCDSNAICDQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNG----VEYCFNCTSCHLNAKCIPRQN--TCECNSGFHGD---GIQCKLLPLCTPA--CHPQASCINGNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNG----------IKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCS-------LCDKNAKC--LINEEKCECMERFEGDGFT-CQDKVDCSSR-CGENAFCYNGT----CKCKLGFQGNPLEHC--FDCRVCHYPAYCDIPNRKCICITENDIFSRTPC-----SFSCHPNAKCIKGRCRCLSNLIGDGTTYCFNCS---SCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCIN----GKCECLAGLQGNPFQQCFDCK----------RCSQFADCD----------------------------------PWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIG--DGINFCFDCSTCDINAFC--EPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGK-CECLPGLRGDGVQSCFDCSICDNNTVCYPD--QEKCVCNPG-YYGDGTTCF--------------LFSQLCT------------EKCHPNAKCVNRK----CKCNERLVGDGVNFCFNCT--------SCHPDALC--FPDQQECSCKSEFVGDGKICTLRADICRPT----CGENAICVNGQCQCQSGLQGNPLKHCFDCRPCHSFAVCDVENRRCICQ--------SGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFT-GNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLT---CISVNG---CNNKCDSNALCVNRHCICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCI--------CQEGYIMNGAKCQPIVHECRPGCGENAK------CVNGKCECLPGLQGNP-----MQHCFDCKKCHKFADCD--VWNKKCVCKNGYFGNGYM---CTPINGCNLK--CNENALCVNQKCI------------------------CLPGFIGD----GIKFCF--------DCS---ACPANSN-CVP----------------EKKECKCAKDYFMNEKICSPIKQPVLCTSK-CHKNAKC--LKG--NCECLPGFVGDGIQV-CFNCSTCDKNANC 6110
            +++   +C+C+PGY+  + +        +C   PC   A C       +C C  G  GD                            + Y   S C C+ G+  +    +C++   C ++  + A  +N  CK   NL G            N    C  CNT          C C+  Y   G +C+    S  + C   A C +     S C C   ++      C D  +C +         AQC  K G+ +C  P  Y GD  +  C     K      CA +  C     C C   Y+ +P +  KC   C +  C  ++ C  ++   C C  GF GD   G T    C    C   A CV+ K    C+C   ++GD        E+    S+C SN  C  +N AC+     EG+ ++   ++ C    + +     G C C  G   NG    V  C +   C   A CIP     TC+C  G  G+   G  C     C+ A  C  +  CING CK       +G+        C + A CD +N +CIC+P + GN            KC   C ++ H      +  C C+ G  G+    C   S        C  NA+C  + N   C C + F G+ +  CQD  +C+++ CG NA C N      C C  G  GNP   C   + + C     C   N +  C  E     +  C       SC P A C  G C C    IGD       CS    C  ++DC   +      +G  K  + CS I      +CG NA C++      C C  G  GNP      C+          +C    DC                                     +  C C   Y+ N    +     +  C  +  C +    C P ++G    +  C D  TC  N+ C       RC C  GF GN    +   P   K  C   A+C + + C      +  G +   D   C    VC  +  Q +C C PG + GD    F                SQ+C             E C  NA C+       C+C     GD +     CT        +CHP A+C   P+   C C   FVGD K    R D   P     C  N IC  G CQ       NP  +      C S A C V NR+ +C         S    DG  C +      KC  +  C    C     Y G     C N   C     C  +     C       +GL C  +E  C   C  N +C   +  C+     NP Q   +C   +     D  + +C C  G+ GN      C+ V      +N+C S  +C+   C  LP         C   +SC     C   +Q C         C  G I N  +       C+PGC  +A       C+ GKC+C  G  G P     +  C + + CH  A C+      +CVC  G  G+GY    C+    C+    C  N  C++ KC                         C  GF+GD    G+  CF        DC+   AC A +N C+                  K  C C + Y +   +C  I +   C S+ CH  A C  L G  +C+C  G +GD +Q  C + + C  +A+C
Sbjct:  804 LANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCK---NLPGSYECRCPQGHNGNPFIMCEICNTP--------ECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLLGCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDC-ASNLACL-----EGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVI-CGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTD-QCSAARPCGERQICINGRCK----ERCEGV-------VCGIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQC-NERVEC-PEGYSCQKGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCVDACSKI------QCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDAS-ACRPDVLGVLKCVAIC-DAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQ-KHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEESCGDNAICLAEDHRAVCQCPPGFKGDPLPE-VACTKQGGCAAGTCHPSAICEVTPEGPVCKCPPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQ-------NPCDNA-----CGSNAECKVINRKPVCSCPLRFQPISDTAKDG--CARTIS---KCLTDVDCGGALC-----YNGQCRIACRNSQDCSDGESCLKNVCVVACLDHSQCASGLAC--VEGHCTIGCRSNKECKQDQ-SCIENKCLNPCQSANSCGP-NALCSIDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCN-LP---------CTKTASCAVGERCY--QQVCRKVCYTSNNCLAGEICNSDR------TCQPGCDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECTE-QPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVG-CFKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINE---CLSQPCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADC 2444          

HSP 20 Score: 99.7525 bits (247), Expect = 9.671e-20
Identity = 489/2047 (23.89%), Postives = 688/2047 (33.61%), Query Frame = 3
Query: 7113 SECDKNAQCFPNF--SKCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENL--CVCAQGFTGNG-ITCK--AIDPSCNTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDGF-----QCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGDGFSFCFNCSNCSPNADC--FPHLSKCQCKEEFTGNGFI----CQRKECKPACSEATSLCIKNQCF----CRPGLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDC--------------------IRPNEICNVAISQCIC------EANSFL-------DPISKLCINPNCQP-PCHPKAVCVK----GKCICNRNLVGDGYQCRAPEECNNDADCVQ------------------FQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKP----------ACNGA-CHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAICTEKQGCICK------SGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQK----CECLPGLVGNG---FIKCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCL-SKCHKYANCE----NGVCKCILGYVGDGIICR----LPDECKSSLDCKYEN------------QECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGNGYSGCFDCSKCHANADCDESKGCTCK------PGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNN----CVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICIT----QTCYCVPGYFGDGIKSCTSCSV---------------CHKNAQCLPDRG---CVCKSDFIGDGFNCRP----LDECR-----INEDCRDP-------NKMCLLNPSMKNLQC----TCKPLHILINNYCLPKE--------------CTSKCHKNAKC----EGGMCQCLS-GFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGK----CVCQGELQGDGIRTCFK------------CSSCHARAVCSMDG----CKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQL----GVCVCKDGY--SPSVN---GLSCSPIDHCQSENDCPDSNHKC-VYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNF----AYCR----QKVCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDS---------NAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVK--QCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPINCYQPCHKNAYCNIGVCTCNPDYIGDGITSCKKKNLCLEDSDCPI----------------IGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKC-LLPCDPNAVCVLGECICKVGFTGNGLQCMPTSKCNPLSGCSDTNSVC--IQVPPTNYYDCMCKPGYIKSSNLSICKPIVCEP----------SCHPKAACIIGSCI-------------------------CMKPLIGNGITECKLP----------DECSASVHCKNK--------------NAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVDCPTRKICVNSKCICP 12290
            S C   + C   F  + C C   YRG   NC      +  C  +  CIN  C             C     C  NA+C+  E++  C C  G+TGN  I+C+   I P       ++ +  KD C                   C  NA+C     +C C PE+RGD +     +C LN       DC  +   +    +CKN   G           C   A C  + H++ C C E   G+ F+      + +        T   I  Q      C+P   G    C   R  HE+A C        CLP +IG    C     CT +SDC                    IR   IC+V     +C        N  L        P+ +  +NP CQP PC P + C       +C C     G    CR   EC N ADC                    F  +CR    S   +C C +G V +    C +P           CN + C   A C   ++L S C CLPG+ G+    C     C  N+ C   + C+ +       G  G    C V+N    +  C    G       S    Q+   +  +      C+P     PC  N+ C   +    C CLP  VG       +C   +EC     C +Q+      G  G   QC + +   L S    P      + D + RC+         S  +   C+ S C  Y+ C        C C+  YVG    CR    +  EC S+L C  E              +C + ++ +  C+C +G+      S  V               C P  C      +ALC  G C C P + G+ Y+GC    +C  N+DC  ++ C  +      PG  G    C   D     + C+ P ++   +        C+P               P  C  NA CL  N    C C  GY G   NC+   +C  +SDC       ++    N KCV                C  KC + A+C        C C+P Y G+    C    V               C  N+QC    G   C C  +F G   NCRP     DEC      +N+ CRDP       +  C ++  + N QC    T  P  I     CLPK                 S C  NA C    E  +C+C    +IG+     RP EC  ++ C    +                     I SKCQ +PCP  C   A C        C C     G+    C +             S C   ++C +      C+C+PG+ GN +      +C   SDC  ++ AC                   NS C   AC  +CG  + CQ      VC C      +P V         PID CQ  + C  SN  C VY+G        C           C+ + C + C N     A CR    + VC C   F G             P A C   L    P P  I DG  C   D+  I+  CR+           A C +      C C  GY       CY + C    +C  NE C+              N+ CV+P                   GF       +CR  F ++                       C C   Y G+ +  C++   C  D +C                  IG++C  +++   C+CP+G+  +     A +C L+P  P    +  EC  K+   G   +    + C+    C   N++C  +   P     C C PGY+  +++   K    EP           C    AC  G+C+                         C +   G+  T C  P           EC  +  C NK              NA C+      + C C  G+  +      K EC++N DCP  K C+N  C+ P
Sbjct: 17317 SPCGPYSHCHNRFGVAACVCLPNYRGTPPNCRPECVINSDCPSSLACINEKCR----------DPCP--GSCAYNAVCRVHEHVPNCYCQTGYTGNPFISCQRTPIAP-----VQREPIEAKDPCYPSI---------------CGPNAVCN--NGKCSCIPEYRGDPYVGCRPECVLN------TDCARDKACIQQ--KCKNPCPG----------TCGLQALCHVYNHVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINPCQPTPCGPNSQC---RAYHEQAIC-------YCLPNFIGTPPGCRP--ECTSNSDCPLDKYCLNLRCRDPCPGACGIR--AICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDEVNP-CQPSPCGPNSECQATSGGARCSCLPQYHGTPPFCRP--ECVNSADCPADKACRNYKCIDPCPGSCGFSALCRVVAHS--PVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDL-SVCQCLPGYYGNPSEICR--PECTVNSDCPSHRACMSEKCRDPCPGVCGLNALCQVINH---SPVCECHTGHVGNPYHSCRIPQREPPAPEYV---NPCQP----SPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPCPGACGLNAQCHVRNHSPLCS--CQPG----FTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPCPGACGFAAQC-SVINHTPSCSCPAGYTGDPFTSCRV--LPPPPPPKTPSDPCQPSPCG----ANALCNNGQCSCLPEYHGDPYTGCR--PECVLNSDCPRNRACVNQKCVDPCPGHCGLNALC---DAVNHIAMCHCPERMTGNA-----FVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCR--LECYSSSDC------SQVHSCINNKCV--------------DPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDECANTLACMNQKCRDPCPGSCGQSAQCTVSLHIPNCQCPVGMTGDPFRI-----CLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRP-ECVGNSECPANQAC--------------------IRSKCQ-DPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCA-KDRACI------------------NSKCV-DACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQP-SPC-RSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGS------------PYAQCLRQLPEPEPKPECISDG-DCT-NDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACV--------------NQQCVDP------------------CGFTQCGTGAICRADFNHR---------------------ARCHCLDGYRGNPLVRCERPE-CRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGN----PAVRCDLVPTQPEGCTMDAECPSKLACFGGECK----NPCDVTHPCG-ANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHK----EPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPI-CFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDP 19103          

HSP 21 Score: 97.0561 bits (240), Expect = 5.985e-19
Identity = 341/1401 (24.34%), Postives = 482/1401 (34.40%), Query Frame = 3
Query: 2085 SKCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGDGINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKSCDKICHKDALCQNSRC----ICKPNFEGDGVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLP------KGNCFPPCANHAICTVEN---TCQCRKNYYGNPLEKCNI--------------DCSKCHTDSDCDKTN--GYCKCRYGFFGDGFTCNKTCCVE-KCHEQAQCVDGKCLCK-PGFSGDGVETCFHCSQCDSNAICDQNNKACICKSGFEGNGIN-CLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPR--QNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQR--CICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEEKCECMERFEGDGFT-CQDKVDCSSRCGENAFCYNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGDGTTYCFNC---SSCARNSDCKP--EQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFDC--KRCSQFADCDPWNE--RCVCQSGYIGNGF-TCTKIINCV------------TKCHVNGFCENQE----CKCLPGLIGDGIN---FCFDCSTCDINAFCEPFNERC--VCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSICDNNTVCYPDQE--KCVCNPGYYGDG-----TTCFLFSQ--------------LCTEKCHPNAKC--VNR--KCKCNERLVGDGVNFC------------FNC---TSCHPDALCFPDQQE--CSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCFD--CRPCHSFAVCDVENRR--CICQSGFEGDG-RNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADC--EPHNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKC-ECLPGLQGNPLQHCFNCKRCDKFADCDVWN--KKCVCKNGYMGNGL--------------TCISVNGCN-NKCDSNALCVNRHCICLPGFTGD---GTRF-CFDCSSCPKNSNCLPEEQKCICQ-EGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDC-------------KKCHKFADCDVWNKK--CVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKC 5822
            ++C C  GF+G+   CR E   +  C  N +C+N  C+          + C      N E     +   C C  G TGN F   +    +      C  S C    +C    EG+G   C    KC      +P  G   CRP  V +  S+C + L       +  C   C  +A C V +    C C   Y GNP   C++                S C  +S C ++N    CKC   F G    C   C +  +C     CV   C+   PG  G+        +QC        ++  C C  GF G+ I+ C R               +   I +   N    + C   + C    +C  +  Q  C C  G++G    C+      P C    +CI+   KC +   G           C + A+C V N    C C  GYEGN        F  C +                   ++   N S C  NA C    + C C+  F+G+ +  C+ +   ++ C  +  C     KC     G           C   A C++ N    C              +C P      G       L+        N    S C  N+ C+   +Q  C+C  G+         +  +C PEC +N+ C       LA L     QQC D     C QFA C        C C +G+ GN F  C ++                + C  N  C NQ     CKCL   IG   N    C   S C I   C    ++C   CS G  G    C +++ +                C   P ++ + +  C+  + C +N VC    E   C C P YYG+        C L S                C   C PNA+C  VN    C C     GD    C            FN    + C P++ C   Q +  C C  ++ G           CRP C  N  C N +  C S       + C D     C   A+C     R  C C  G+ GD    C+ +   SP+  R++  I ++  C+P             S C + A C  E     C+C   + G    C   E      C  +  CVN +C +  PG              C   A CDV N    C C  GY+G+                T ++ + C  + C  NA C N  C CLP + GD   G R  C   + CP +  C+    +C+    G   +GA CQ   H                C+C  G QGNP   C                  C    +C     +  C C+ GY+G+   C P    + +C  +  CVNQKC
Sbjct: 14931 AQCSCLSGFIGTPPNCRPECVSNSDCPMNLACLNQKCR----------DPCPGVCGSNAECYVINHTPMCTCLAGQTGNPFVSCQVVRDVPEPQTPCVPSPCGANALCS---EGNGAGAC----KCLPEFYGNPYEG---CRPECVLN--SDCPSHLACLNQHCRDPCPGTCGINAECQVRDHLPQCNCHVGYQGNPYVYCSVLRDPLPEPVPSRPCQPSPCGPNSQCRESNNQAICKCLPNFIGSPPACRPECTISSECDLTLACVQQHCVDPCPGVCGNS-------AQCR----VINHSPHCSCLPGFTGDAISGCQR---------------IPPAITHDAPNETPRDPCVP-SPCGAFGQCRAQGNQAICSCLPGYYGAPPNCRPECAINPDCASHLACISE--KCRDPCPG----------SCGLQAQCSVINHTPICSCPSGYEGNP-------FVRCQRTPP-----------TPTPPLHDACNPSPCGSNAICSPGGQ-CSCLPDFDGNPYVGCRPECVLNTDCARDKACQRS--KCTDPCPG----------ACGIGAVCEVRNHIPTC--------------NCPPG---TSGNAFVQCTLVQSSPVVPLNPCQPSPCGNNAQCREVNDQAVCSCLPGFFG-------VPPKCRPECTINSDCAPH----LACLN----QQCRDPCPGACGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYPSPCGPNAECTNQNEQAICKCLKDYIGTPPNCRPECITSSECPIQLAC--IGQKCKDPCS-GLCGIAATCQVVSHVPSCICIADYIGDPYTGCYARPPIQREQINPCYQ-NPCGSNAVCRERGEAASCQCLPEYYGNPYEGCRPECVLNSDCSSHLACLNQHCRDPCPGSCAPNAQCQVVNHVPSCSCYPGYSGDPYRHCHVAQAEPVQVVHFNPCQPSPCGPNSQCTESQGQAVCRCLPDYYGS-------PPACRPECTTNPECPNDK-ACVS-------RRCTDPCAGACGQNAICRAHQHRAYCSCHPGYTGDAFMRCQSLP--SPQPIRDSPVIYRD-PCVP-------------SPCGQFAQCRVEYEQAVCSCLTSYYGTPPYCRP-ECTQNSDCPSHRACVNQRCVDPCPGA-------------CGLNARCDVLNHVPSCSCPEGYLGDPFYRCYPAPAPPPTPVTVVADDPCQPSPCGPNAQCSNGVCSCLPLYQGDPYVGCRPECVLSTECPWDKACI--RNRCLDPCPGTCGSGATCQVHNHV-------------AMCQCPVGYQGNPFVLCQQTPLQAPVELHPCQPSPCGHHGECREVGSQAICTCRLGYYGSPPACRPECVSDPECPPSLACVNQKC 16143          

HSP 22 Score: 96.6709 bits (239), Expect = 6.728e-19
Identity = 391/1669 (23.43%), Postives = 557/1669 (33.37%), Query Frame = 3
Query: 2079 EISKCKCKPGFVGSGYE----CREEVNCDIKCHENASCVNGYCKCNRNLIGDGINSCFDCLKCNTEADCSPYENRCYCRPGYTGN-GFTCIKS-----CDKICHKDALCQ----NSRCICKPNFEGDGVNYCFDCSK-------CHKLAQCHPKTGNCTCR-------PPYVG-DGVSECETFLPKGNCFPPCANHAICTVEN---TCQCRKNYYGNPLEKCNIDCSKCHTDSDCDKTNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGDGVETCFHCS----------------------------------QCDSNAIC--DQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGL----NGNGVEYCFNCTSCHLNAKCIPRQ---------NTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGNCKCNNNLIGDGISSCF---DCDKCSMNARCDVSNQ--RCICQPGYEGNGIK---CVKTCFQSCHKLAVCKEG-TCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEEKCECM---ERFEGDGF----------------------------TCQDKVDCSSRCGENAFC----YNGTCKCKLGFQGNPLEHCF-------DCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGDGTTYCFNC-SSCARNSDCKP--EQQTCTCKRGY------VKDGNNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCVC---QSGYIGNGFTCTKIINCVTKCHVNGFC-ENQEC---KCLPGLIGDGINFCFDCSTCDINAFC--EPFNERCVCSVGFTGNGKK----CSILAPITCKRACHKKAKCVKGKCECLPGLRGDG------------------VQSCFDCSICDNNTVCYP--DQE------------KCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVN----RKCKCNERLVGDGVNF--CFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPT-CGENAICVN----GQCQCQSGLQGNPLK--------HCFDCRPCHSFAVCDVENRRCI-----------------------CQSGFEGDGRNCKKIKEC-SPKCHRNAVCIN----QNCVCIPEYIGDGI-------NFCFNCSSCDRNADC-----------------------EPHNNRCTCYQGFTGN-GLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNK--KCVCKNGYMGNG-LTCISVNGC--NNKCDSNALCVNRHCICLPGFTGD----GTRFCFDC---SSCPKNSNCLPEEQKC---ICQEGYIMNGAKCQPIVHECRPG--CGENAKCVN-----GKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKK--CVCKNGYFGNG------YMCTPINGCN-----------------LKCNENALCVN----QKCICLPGFIGDG------IKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGDGI-QVCFNCSTCDKNANCFPY 6119
            E   CKC  G +G+ +       ++ +    C E   C+NG CK            C + + C   A C     +C C P + GN    C+       C   C ++A C+     SRC C P   G+    C   SK       C   A+C     + +C         PY+G   V EC           PC  +A C        C C   + GNP   C    SK   D++  + N   +C  G+      C   C    C  +A C  G C+C  G+ GD  +    CS                                  QC  NA+C  + +  +CIC  GF GN  N       ++   ++         C++G     + NG++ C N  S   N  C P +           C C   +  + +         P C   A+C + +  C  +++  G+  C    D   C  N+ C       RC C  G+ GN      C       C   A C+E   C         G     +   C   A C+ N  + +C      F GD +                            TC D  D  S CG+NA C    +   C+C  GF+G+PL               CH  A C++     +C     +F     S  C P+ +C  G   C +N I  G      C ++C  N++CK    +  C+C   +       KDG   +I       +CG  A C NG+C             C + + CS    C      CV          +G  C +  +C   C  N  C ++Q C   KCL        N C   ++C  NA C  +  + +C C  GF GN         + AP      C     C+  +C  LP  +                       +C    IC+++  C P  D +            KC C  G+ G    C    +   + CH +A+C N     +C C E  VGDG +   C     CH      PD     C +        CT   D C  T CG NA C +      C C +G  G+P           C D   C     CD E  RCI                       C  G++     C+ I EC S  CH  A C N     +C C    IGD +       N C + + C  +A C                       + H   CTC     G+  + C  IE      C     C++ KC          +  C     C   A C V N    C C+ G  G+  L C+ +  C  + +C   ++C   H IC P  + +      + C       +C  NS+C P+ Q C   IC +              ECR    CGE+  C++      KCE +          C     C + A+C   +    C+CK G+FG+         CT  + C+                   C ENALC      Q C C PGF GD       I FC D    P           C+ A+  +                             C C PG VGD   + C +   C+ N +C P+
Sbjct: 1269 EGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCK----------ERC-EGVVCGIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANK--------PCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCS---NVVCGPNELCKINPAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDAS-ACRPDVL--GVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEES-CGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKCP-PLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNACGSNAECKVINRKPVCSCPLRFQPISDTAKDGCARTISKCLTDVDCG-GALCYNGQCRIA----------CRNSQDCSDGESC--LKNVCVVACLDHSQCASGLACVE-GHCTIGCRSNKECKQDQSCIENKCL--------NPCQSANSCGPNALCSIDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCN-LPCTKTASCAVGERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCH-----KPDD----CANNLACIHGKCT---DPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQPCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKC----------IDPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSIC--SHGICSPLCSTNRDCISEQLCLQGVCQGTCKSNSSC-PQFQFCSNNICTKEL------------ECRSDSECGEDETCLSDAYGRAKCESV----------CLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSNDKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCGPG--------ARCRNARGSY----------------------------KCTCPPGLVGDPYNEGCRSSVECETNEDCPPH 2804          

HSP 23 Score: 96.2857 bits (238), Expect = 9.883e-19
Identity = 681/2825 (24.11%), Postives = 980/2825 (34.69%), Query Frame = 3
Query: 6027 NCECLPGFVGDGI--------QVCFNCSTCDKNANC--FPYQERCVCKPRYSGNGE----------NCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGI--KTCFNCSSCSIEAICVPD--------QEKCICKAGFSGNGEQ---CVENIEGSSPKCHSNALRVNQ----QCICLPGFIGDGKNFCFDCSTCPPNSDC--------LPQEQRCICKKDYFMNDTQCIHTGRTPQCV--------PKCHHYASCVQDKCECLPGFIGDGIKFCFKCSSCDPNADCV--PEQQKCVCKTGFYGNGN-KCDKIESTCEPPCAPGGFCNNSK----CQCNSGLKGDGVTSCFNCSKCDV-------NAKCFPSVK--KCICVIGYKGDG---FRCYPVILECP-----KCHYRAQCVIGKCQCKNGLQGDG-----INFCMNCSE-CDKNAQCF--PNFSKCECRQGYRG----------------------------------DG---------KNCVKIDECSP------KCHQNAVCINS----NCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCK-----AIDP------------SCNTNCHKDALC-FKDSCICKSGLSGDGKNYCFDCKRCDQNAICRPT--EQRCVCKPEFRGD-GFQCALNLKTTCQ-NDCHPNAVRVNNC----CRCKNGFFGDGF------SFCFNCSNCSPNA-------DCFPHLSKCQCKEEFTGNGF--------ICQRKECKPACSEATSLCIKN-----QCFCRPGLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVA--ISQCICEANSFLDPISKLCINPNCQPP----CHPKAVCVKG----KCICNRNLVGDGY---------QCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQ--GQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTD---CS--GCDKNAICTEKQG---CICKSGFIGDGRQCIVLNECADNSDCTTIRGRA-SECIRSSEGIQKCQCSQGFKLLNGKC-EPLSCIYPCAKNAVCIYQK----CECLPGLVGNGFIKC-TNCSE--CHKKALC---HDQRGCVCSHGYSGD---GIQCRIEDQCSLNSDCTDPNKICI-----------------TSTDTVKRCVCKSSFI-SSNSGCVP----LTCLSKCHKYANCENGV----CKCILGYVGDGI---------ICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPID--CNPKCHRSALCVIGT----CKCPPSFKGNGYSGCF--------DCSKCHAN--ADCDE-------------------------SKGCTCKPGFEGN------GCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNN----CVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVC---LPGFQD-----DNGKCSPKEC---QPKCHMFAICITQTCYCVPGYFGDGIKS---------CTSCSVCHKNAQCLPDRGCVCKSDFIGDGFNCRPLDECRINE-----DCRD-----PNKMCLLNPSMKNL---QCTCKPLHILINNY------CLPKECTSKCHKNAKC----EGGMCQCLSG-FIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGDGIR--TCFK-----CSSCHARAVCSMDG----CKCMPGYVGNGIV--CQTEDQCQY-DSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQL----GVCVCKDGYSPSVNGLS---CSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNFAYCRQKVC----QCRLG-------------FQGDGVFNCHDCSVCHPNAICSPSLG---CTCPGPHLIGDGRSCKPKDQC-RIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNN----SLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPIN--CYQPCHKNAYCN----IGVCTCNPDYIGDGITS--CKKKNLCLEDSDCPI-------------------IGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCDPNAVCVLGECICKVGFTGNGLQCMPTSKC-NP--LSGCSDTNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPI---VCEPSCHPKAAC--IIGS--CICMKPLIGNGITE-CKLPDECSASVHCKN----KNAFCKNSTEGQMKCICKHGFQLENSKCI---------------SKQECRVNVDCPTRKICVNSKCICPEQYTSSPDGKLCELPMIMVVPSKLDVP-----------ETKDVEVLCFF-----ENGIGNVNYLSWRRI-SPLMTMNFIRQPASVKLIIQKATVGDSGIYQCCIDSNSSPLNCKFASVNIFTKKCSPCSLNQHCDPVTSNCICDAGFQFDSNGICQRRNCLYFPEICDQVTMICDKGNCVCKSELYMDNKVCVPKDQCKTNEDCDPNAICKTDKRCHCGVLFNGPGKFCAPIKLGCEVTKDCDPNGECFAIGISPTRLCQCKPGYVGDGK 13049
             C C PG+ G+G         Q     + C +NA C   P    C CK  Y G+GE          N    GP ++C N                 G+ G+    + C +   CS   +C P           +C C  G+ G+G     CV+  E +   C  NA  +N     +C+C  G+ GD  N C D   C  N+ C        L    +C C   + +      H  + PQ +        P     A   +     L     D        + C  NA C+  P   +C+C +GF G G   C+ I    + PC     C ++     C C     GD    C +  +C         +A C  +V    C C  GY G       C  V +         C   A+C+  +C C +G +  G     I+ C   +E C  +AQC   P    CEC  GY G                                  DG           CV IDEC         C QNA C NS     C C P ++G+  S C +  +C   A        CV      G G TC+       DP            S N +C  +++C     C+C     G+   +  +   C  +A C     + +C+C P + G+       N    C+ N C   A+  N      C+C  G  GD +      S    CS+ +P A       D +   S C C++ +  N           C  +  KPAC    +LC KN     +C C  G  G+ +  + C  C+        + +C+C   Y   G  C+ ++ C+    C    E  ++A  +S C C       P         C+      C   A CV       C C     GD Y         +C A  EC  +  C+Q  E            C C      D Q   +C+ P     C   A C  S     +C+C  GF GD +  CTD   CS   C   A C  K+G   C+C   + GD  +          S C    G   S+C+ + +      C+     L G C  P S +  C  NA C  ++    C C  G V NG   C + C +  C   ALC    +   C C  G  G+   G  C   DQCS    C +  +ICI                 T      +C+C+ +F+ + +  C+P      C   C + A+CE G+    C C  G  G+           +C+ P+ C  + +C+         + + + C C  GF                  S   Y GC  +D   N  C  +A C+       C C     GN YS C         D +KC  N   +C E                         +  C C  G+ G+      GC  R   +C  ++DC    +IC Q     R              KC+     +QC  NA+C+S +    C+C  G+ G   N +    C      PE   +C+  +D +R   C   + G ++      N  C P E     P  H         C C   Y  + + S         CTS + C   + C PD   V K   I D F C     C   +     DC +     PN      P+ K+       C+     I +       C P   T KC   A C        CQC  G F GD  +   PF      PC      C  +    R    C   F +    C  E C  N   LA+     C C    +GD +    C K       +CH  A+C +      CKC P +VG+     C+ + QC   D+DC   N  C  GV     CQ                C   CG N++C++     VC C   + P  +         I  C ++ DC        Y+G     R  CR          C++  C   C + + C   +      C +G              +   +  C   + C PNA+CS       C+CP     G   +  P+  C R+ + C  SN  C   +  +  QC L   K  +      CY   C K C  +  CL G+       I NS++TC    D D + P     P E+CL        C C  GFI     C  I+    QPCH +A C        C C    +GDG +   C +   C +  DC                     I + C ++ +   C CP+G+  D N           D    C   ECI  V   G+      T++C  P  L+ C   N         +   C C  GY   ++  +C+ I   + +P CH  A C  + GS  C C + LIG+ +   C+ P+EC +   C      +N+ C++  E Q  C      Q +  + I                  EC  N DC   K C++SKCI P           C LP      ++  V             T D ++ C       ++G      +    I SPL + N  R   S +L +Q       G+ Q    SNSS    +F S NI TK+   C  +  C      C+ DA  +     +C  R        C   +   D   C+CK   + D K    K +C +++D      C  DK C            C   K+ C + + C  N  C        ++C C+PG+ GD +
Sbjct:  152 TCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCP------DGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDP--HADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAECV---NVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACG-LNALC-KNLPGSYECRCPQGHNGNPF--IMCEICN--------TPECQCQSPYKLVGNSCV-LSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGE------------CVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSD--PPQCMCEAGFKGDPLLGCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYK----------SGCIFESGTPKSKCLSNDD------CASNLACLEGSCVSPCSSLL-CGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCST-DQCSAARPCGE-RQICINGRCKERCEGVVCGIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQ-PNSCGPNAECRA--------VGNHISCLCPQGF------------------SGNPYIGCQDVDECANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCNERVECPEGYSCQKGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIR--GQCGNDADCLH-SEICFQLGKGLR--------------KCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQ--VGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAI-------CNCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYD---PFNGCQSVPCVYNHD-CPPSQMCNRMTHTC---FDV----CDEESCGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKCPPLFVGDAKSGGCRPDGQCPNGDADC-PANTICAGGV-----CQ--------------NPCDNACGSNAECKVINRKPVCSCPLRFQPISDTAKDGCARTISKCLTDVDC---GGALCYNGQC---RIACRNSQDCSDGESCLKNVCVVACLDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCSIDQHHSQCSCPE----GFEGNPTPEQGCVRVPAPCLASNQ-CPSGHMCIGNQCNLPCTKTASCAVGERCYQQVCRKVCYTSNNCLAGE-------ICNSDRTCQPGCDSDADCP-----PTELCL-----TGKCKCATGFIGTPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPN-----------DTGVGCFKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKGNCQVRD----HKATCACYEGYQLVND--VCEDINECLSQP-CHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDP-----------CSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSPLCSTN--RDCISEQLCLQ-------GVCQGTCKSNSSCPQFQFCSNNICTKELE-CRSDSECG-EDETCLSDAYGRAKCESVCLGRAACGRNAECVARSHAPD---CLCKEGFFGDAKSGCRKIECTSDDD------CSNDKSCD--------NHMC---KIACLIGQPCGENALCTTEHHQ--QVCHCQPGFSGDPR 2745          

HSP 24 Score: 90.1225 bits (222), Expect = 7.387e-17
Identity = 345/1476 (23.37%), Postives = 486/1476 (32.93%), Query Frame = 3
Query: 2091 CKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGDGINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKSCDKICHKDALCQNSRCICKPNFEGDGVNYCFDCSKCHKLAQCHPKTGN---CTCRPPYVGDGVS---------ECETFLP------KGNCFPPCANHAICTVEN---TCQCRKNYYGNPLEKCNI-------------DCSKCHTDSDCDKTNGYCKCRYGFFGDGFT-------CNKTCCVEKCHEQAQCVDG------------------KCLCKPGFSGDGVETCF-------------HCSQCDSNAICDQNN--KACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGDG------------IQCKLLPLCTPA-CHPQASCINGN----CKCNNNLIGDGIS---SCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKE----GTCKCSNGLTGDG--------------VNFCFNCSLCDKNAKCLINEE--KCECMERFEGDGFT-CQDKVDCSSRCGENAFCYNGTCK------CKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITEN--DIFSRTPCSFS-CHPNAKCIKGR----CRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCI----NGKCECLAGLQGNPFQQCFDCKR-------------------CSQFADCDPWNERCVCQ--SGYIGNGFTCTKIINCVTKCHVNGFCENQEC-KCLPGLIG-----DGINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSICDNNTVCYPDQEKCVCN------PGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSC----HPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVN-----------------------GQCQCQSGLQGNPLKHCFDCR-----------------PCHSFAVCDVE--NRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQ-----------------------NCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGLTCNAIELKCEPS-CGENAKCVNGK----CECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALC-VNRH---CICLPGFTGDGTRFCF-------------DCSSCPKNSNCLPE--EQKCICQEGYIMNGAKCQP--------------IVHECR---PG-CGENAKCV----NGKCECLPGLQGNPMQHCFDCKK 5678
            CKC P F+GS   CR E     +C    +CV  +C      +      C +  +C    + SP+   C C PG+TG+  +  +        DA  +  R  C P             S C    QC  + GN   C+C P Y G   +         +C + L       +  C   C   A C+V N    C C   Y GNP  +C               + S C +++ C    G C C   F G+ +         N  C  +K  ++++C D                    C C PG SG+    C                S C +NA C + N    C C  GF G    C         C     CL  +C           + C          + I     C C +GF G+             +Q + +  C P+ C P A C N N    CKC  + IG   +    C    +C +   C                G KC   C   C   A C+      +C C     GD               +N C+  + C  NA C    E   C+C+  + G+ +  C+ +   +S C  +  C N  C+      C    Q   + H   C    YP Y   P R C         +    PC  S C PN++C + +    CRCL +  G        C++   N +C P  + C  +R            +  C   CG NA C        C C  G  G+ F +C                        C QFA C    E+ VC   + Y G    C       + C  +  C NQ C    PG  G     D +N    CS C      +PF  RC  +              P      C   A+C  G C CLP  +GD    C     C  +T C P  + C+ N      PG  G G TC + + +   +C P     N    C +  +   V     C       H +      Q  C+C+  + G    C     +  P C  +  CVN                        QC C +G  G+P   C   R                 PC   A C  E  N  C C + + G    C+     + +C  +  CIN+                       NCVC P  +G+  N C   +  +  A       +   Y+    NG         CEP+ CG NA+C   +    C CLP   GNP + C     C   +DC + ++ CV +             + C   C  NA C V  H   C C  G+TG+   +C              D S C  N+ C P   E  C C   +      C+P              + H+C    PG CG NA C     +  C C+    G+P   C++  K
Sbjct: 15145 CKCLPNFIGSPPACRPECTISSECDLTLACVQQHC------VDPCPGVCGNSAQCRV-INHSPH---CSCLPGFTGDAISGCQRIPPAITHDAPNETPRDPCVP-------------SPCGAFGQCRAQ-GNQAICSCLPGYYGAPPNCRPECAINPDCASHLACISEKCRDPCPGSCGLQAQCSVINHTPICSCPSGYEGNPFVRCQRTPPTPTPPLHDACNPSPCGSNAICSP-GGQCSCLPDFDGNPYVGCRPECVLNTDCARDKACQRSKCTDPCPGACGIGAVCEVRNHIPTCNCPPGTSGNAFVQCTLVQSSPVVPLNPCQPSPCGNNAQCREVNDQAVCSCLPGFFGVPPKCRPECTINSDCAPHLACLNQQC----------RDPCPGACGQFAQCQVIRHVPHCSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYPSPCGPNAECTNQNEQAICKCLKDYIGTPPNCRPECITSSECPIQLACI---------------GQKCKDPCSGLCGIAATCQVVSHVPSCICIADYIGDPYTGCYARPPIQREQINPCYQ-NPCGSNAVCRERGEAASCQCLPEYYGNPYEGCRPECVLNSDCSSHLACLNQHCRDPCPGSCAPNAQCQVVNHVPSCSC--YPGYSGDPYRHCHVAQAEPVQVVHFNPCQPSPCGPNSQCTESQGQAVCRCLPDYYGSPPACRPECTT---NPEC-PNDKACVSRR-----------CTDPCAGACGQNAICRAHQHRAYCSCHPGYTGDAFMRCQSLPSPQPIRDSPVIYRDPCVPSPCGQFAQCRVEYEQAVCSCLTSYYGTPPYCRPECTQNSDCPSHRACVNQRCVDPCPGACGLNARCDVLNHVPSCS-CPEGYLGDPF-YRCYPAPAPPPTPVTVVADDPCQ-PSPCGPNAQCSNGVCSCLPLYQGDPYVGCR--PECVLSTEC-PWDKACIRNRCLDPCPGTCGSGATCQVHNHVAMCQC-PVGYQGNPFVLCQQTPLQAPVEL-HPCQPSPCGHHGECREVGSQAICTCRLGYYGSPPACRPEC-VSDPECPPSLACVNQKCRDPCPGACGHLAQCHVINHSPQCVCPAGYTGSPYSECHLIRADSSPIQRQPIDPCLPSPCGPHAQCSNEGGNAVCRCLTEYLGVPPYCRPECIANSECPSDRACINRKCQDPCPGLCGYNAICRTYNHQPNCVCAPGLVGNPFNSCLPPTRPEIPATPPTTAIQVLQYEEPFING---------CEPNPCGANAQCNQRRGVVSCVCLPDYFGNPYEACR--PECILNSDCPL-SRACVQQKCR----------DPCPGTCGLNAECHVMDHLPQCRCFSGYTGNPLAYCSPVPIIQESPLTPCDPSPCGPNAQCHPSLNEAVCSCLPEFYGTPPNCRPECTLNSECAYDKACVHHKCVDPCPGICGINADCRVHYHSPICYCISSHTGDPFTRCYETPK 16521          

HSP 25 Score: 87.4261 bits (215), Expect = 4.204e-16
Identity = 377/1653 (22.81%), Postives = 527/1653 (31.88%), Query Frame = 3
Query: 2073 YPEISKCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCK-----------------------CNRNLIGDGINSCFDCLKCNTEAD---------CSPYEN--------RCYCRPGYTGNGFTCIKSC--DKICHKDALCQNSRCICKPNFEGDGVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSEC---ETFLPKGNCFP----PCANHAICTVEN---TCQCRKNYYGNPLEKCNIDCSKCHTDSDCDKTNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDG------------KCLCKPGFSGDGVETCF---------------HCSQCDSNAIC--DQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNT--CECNSGFHGDGI-------------QCKLLPLCTPA-CHPQASC--ING--NCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCK----EGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINEEKCECMERFEGDGFTCQDKVDCSSRCGENAFCYNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIP-NRKCI---CITENDIFSRTPCSFSCHPNAKCIK----GRCRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPE-CGVNAQCI----NGKCECLAGLQGNPFQ---QCFDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCE----NQECKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCV----KGKCECLPGLRGDGVQ---SCFDCSICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCF------------NCTSCHP-----DALCFPDQQ----ECS-----------CKSEFVGDGKICTLRA-------DICRPTCGENAICVNGQ----CQCQSGLQGNPLKHCF------------DCRPCHSFAVCDVENRRCICQ--SGFEGD--GRNCKKIKECSPKCHRNAVCINQNCV-----------------------CIPEYIGDGINFCFNCSSCDRNADCEP----HNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCVNGKCE-----------------------CLPGLQGNPLQHCFN-------------------------------CKR---CDKFADCDVWNKK--CVCKNGYMGNGLTCISVNGC--NNKCDSNALCVNRHCICLPGFTGDGT----RFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCV-NGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKK--CVCKNGYFGN-GYMCTPINGCNLKCNENALCVNQKCICLPGFIGDGIKFCFDCSACPANSNC-----VPEKK-ECKCAKDYFMNEKIC----SPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCK 6140
            Y E + C C P F+G+   CR E   +  C  +  C+N  C+                       C  +L G+ + +C   +    E D         C P           RC C P Y G    C   C     C  D  C+N +CI          + C        L +    +  C C   YVG+  + C   E   P     P    PC  +A C   N    CQC   YYGNP E C  +C+    +SDC                    ++ C  EKC +    V G             C C  G  G+   +C                  S C +N+ C   Q    C C   F G   +C        +C     C+  KC           + C    +C LNA+C  R ++  C C  GF GD +                +   C P+ C P + C  +NG  +C C  N +G    +C    +C++NA C  SN  CI +        KC   C  +C   A C       +C C  G TGD      +C +           + C+                   S CG NA C NG C C   + G+P   C    V +     D P NR C+   C+         PC   C  NA C        C C   + G+                C+P           ++D          C P  CG NAQC+    N  C CLAG  G P     +C+    CSQ   C   N +CV                 C  KC +N  C+       C+C+P   G+       C+   +    EP  + C  S                     C   ++C     + +C CL   +G        C     C N   C   + +  C PG  G    C +   +      PN       C+C   + GD    C                 C+P     +A+C    +    ECS           C+ E VG+ +    +A       D C   CG  AIC        C C  G  GN    C                PC   ++C ++N + +C+   GF G+   + C+     S  C ++  CIN  CV                       C    +G+    C      +    C+P     N  C  Y G      TC+  E      C  +  CV+ KC                        C P   G+P   C                                 C++   C   A C V   +  CVC  GY GN L    + GC  + +C +N  CVN+ C+   GFT  GT    R  F+               +C C +GY  N     P+V   RP C  + +C  +  C           + C D   C   A C V N +  C C  G+ GN    C  +      C  +A C ++    L  F G+    C     C AN+ C     +P +   C C   Y     I      P  Q      +C     C  GNC          +  C + S C ++A C   Q R +C 
Sbjct: 17556 YHEQAICYCLPNFIGTPPGCRPECTSNSDCPLDKYCLNLRCRDPCPGACGIRAICHVQNHGPLCVCPPHLTGNPLLACQPIVIPPVERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPPFCRPECVNSADCPADKACRNYKCI----------DPCPGSCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRPECT---VNSDCPS------------------HRACMSEKCRDPCPGVCGLNALCQVINHSPVCECHTGHVGNPYHSCRIPQREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKC----------QDPCPG--ACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVG-AAPNCR--PECTINAECP-SNLACINE--------KCRDPCPGACGFAAQCSVINHTPSCSCPAGYTGDPFT---SCRVLPPPPPPKTPSDPCQ------------------PSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNS----DCPRNRACVNQKCV--------DPCPGHCGLNALCDAVNHIAMCHCPERMTGNAFV------------SCQP-----------IRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSC--INNKCV---------------DPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAF---VQCNPIPVPRVPEPVRDPCQPS--------------------PCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDECANTLACMNQKCRDPC-PGSCGQSAQCTVSLHI------PN-------CQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNG----AATCSYPECVINEDCSRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFN------------HRARCHCLDGYRGN-----PLVRCERPECRSDDECAFHLACR---------NERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSK----LACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNC----------VNPCLDASPCARSAQCLAQQHRAICS 18999          

HSP 26 Score: 79.337 bits (194), Expect = 1.129e-13
Identity = 555/2426 (22.88%), Postives = 816/2426 (33.64%), Query Frame = 3
Query: 6441 QCICLPGFIGDGKNFCFDCSTCPPNSDCLPQE--QRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDK-----------------------------CECLPGFIGDGIKFCFKC--------------SSCDPNADCVPEQQKCVCK--TGFYGNGNKCDKIESTCEPPCAPGGFCNNSKC-----------------------QCNSGLKGDGVTSCF---------------NCSKCDVNAKCFPSVKKCIC--VIGYKGDGFRCYPVILECPKCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQC-FPNFSK-CECRQGYRGDG------------------KNCVKIDECSPKCHQNAVCINSNCHCLPMYTG---NGVSFCFNCAQCDANAICKPDE--NLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGDGKNYCF---------------DCKRCDQNAICRPTEQRCVCKPEFRGDGF-----QCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGDGFSFCFNCSNCSPNA--DCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYIGNG----FECISITSCTQSSDCIRP------------NEICNVAISQCICE------ANSFLD----PISKLC--INPNCQP-PCHPKAVCV----KGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTD-----------------CSGCDKNAICT---EKQGCICKS-GFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQK----CECLPGLVGNGFIKCTN------------CSECHKKALCHDQRG---CVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCE----NGVCKCILGYVGDGII-CRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRS----ALCVI----GTCKCPPSFKGNGYSGCF-------DCSKCHANADCDESKGC---TCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPV--QCDKNAVCLSNNCV-------------------------CKTGYSGTGL------NCKPNDQCSQNSDCPEPNSRCE-----------MMKDYNRKCVCLPGFQDDNG-KCSPKECQPK-CHMFAICITQTCYCVPGYFGDGIKSCTSCSVCHKNAQC-----LPDRG--CVCKSDFIGDG-----------FNCRPLDECRINEDCRDPN--KMCL-LNPSMKNLQCTCKPLHIL-----------INNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQM-INSKCQPEPCPIN--CHPLAQCKSGKCV---CQGELQ-GDGIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNA------ACFP--------------GVDKGKKCQCKPGFSLENSLCSPIACR---PKCGKNSQCQLGV-CVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHG-LFQGKRCMCRKGFIPKSVFQCIE-------ETCPN----------KCHNFAYCRQK----VCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCT----CPGPHLIGDGRSCKP--KDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCV--------KQCDRNEECLFGQCQ---------------------CKPGFIHNS----------------------NKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFI-NKFGYCIPINCYQP--CHKNAYCNIGVCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTK-------SNPYS----------CK----CPSGYEIDNNKCIAK-KCLLPCDPNAVC-VLGECICKVGF-----------TGNGLQCMPT--SKCNPLSGCSD----------------TNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVC--EPSCHPKAACIIGSCICMKPLIGNGITECKLPDECSASVHCKNKNAFCKNSTEGQMKCICKH-GFQLENSKCISKQECRVNVDCPTRKICVNSKCICP 12290
            Q I +P    D  N C   S C PNS+C       RC C   Y          G  P C P+C + A C  DK                             C C  G++G+    C +               S C  NA C P     VC+   G+YGN ++  + E T    C     C + KC                       +C++G  G+   SC                  S C  N++C  S  + IC  +  + G    C P  +   +C     C+  KCQ          + C     C  NAQC   N S  C C+ G+ GD                   ++      C P      V   ++C CLP Y G   N    C   A+C +N  C  ++  + C  A GF      C  I+                SC C +G +GD    C                    C  NA+C     +C C PE+ GD +     +C LN      +DC  N   VN   +C +   G          +C  NA  D   H++ C C E  TGN F+     C+P   +           C+P   G    CL+             +  C CL GY G       EC S + C+Q   CI              N +C     +  CE       N+F+     P+ ++   +   CQP PC P + C     + +C C +   G    CR         +CV   E C    + + +  KC+D              C G+C   A C  S ++ + C C  G  GD    C                    S C  NA+C    E   C C    +IG+  +     EC  NS+C   +     CIRS     KCQ                C   C   A+C        C C PG  GN F +CT              S C   ++C  Q     C C  G+ G+ +      +C+L+SDC   ++ CI                  NS CV   C+ +C   A C+    + VC C    VG+  + C  P + +    C+       +   S+ +C   +G    S    ++N      R+      CV   C   C  +    A+C        C CPP F G+ Y+ C           +C ++ DC   K C    C+   E +   C P+ +C      + PL            CVC  G T +    C +LGC    +C  N  C++  CV                         C  GY G  L       C+ +D+C+ +  C   N RCE            ++++  +C C  GF  +   +C     QP+ C M A C ++    +  + G+    C     C  NA C     LP R   C C   ++G+              C   D+C+  E CR  N    CL  +P  ++ QC  +    +             N   P E  + C  +++C+     C++        CQ P  C   NPC    + C++ +   R +C C  G+      +C    C IN  C     C +  CV     G+++ G+G     +C + + +AVC      C  G  GN  +      CQY+ DC D  A       C P              G     +C+C+PG+     +   I  +   P+C +++ C   + C+ +    P      C+P   C   +  P     C   G         C    +PK +  C         E C N          +C   A C  +     C C  GFQG+    C+   V  P     P+ GC+    CP   +  +     P   D C I        A C +      C+C  GY       C P   V          C  NE C+  QC                      CKPGF  N+                      N+ C+ P  C  ++P +  +    C G  N +A C C  G   + F  C+ + C+    C  N  C    C          ++ C ++N C +++ C  +  + + +        NPY+          C+    CPS     ++KC      L PC P A C VL     +              +G   + MP     C     C D                TN+VC      +   C C+ G+ + +  + C+ I C  +  C    ACI G CI            C + D C  +  C  +      S   Q +C+  + G   E  + I    C  N DCPT K C N +C+ P
Sbjct: 17634 QPIVIPPVERDEVNPCQP-SPCGPNSECQATSGGARCSCLPQYH---------GTPPFCRPECVNSADCPADKACRNYKCIDPCPGSCGFSALCRVVAHSPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRPECTVNSDCPSHRACMSEKCRDPCPGVCGLNALCQVINHSPVCECHTGHVGNPYHSCRIPQREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQ----------DPCPG--ACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPCPGACGFAAQ---CSVIN-------------HTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCN--NGQCSCLPEYHGDPYTGCRPECVLN------SDCPRNRACVNQ--KCVDPCPG----------HCGLNALCDAVNHIAMCHCPERMTGNAFV----SCQPIRDDPPPP--TTPNPCQPSPCGANAQCLE----------RNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRP--------ECVSHDE-CANTLACMNQ--KCRD-------------PCPGSCGQSAQCTVSLHIPN-CQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYE-GCRPECVGNSECPANQA----CIRS-----KCQ--------------DPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAK-DRACI------------------NSKCV-DACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQ------PSPCRSNGICRVYNGAATCSYPECVINEDCSRDRA------CVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSN-ICAPQARCHVQ--LHRPL------------CVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACR--NERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSK----LACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTT-ACINK------RCQDP--CAEANPCAGN-AECRVQN--SRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGA----QCLAQNHQAVC-----ICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRI---PNPGCSRNDDCPRDQICRNEICISPCAADDCGI-------GAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINP--CLASDPCALNA---ECYGR-NHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNEC----------VSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGTNAVCQVT--QHRAVCSCQDGF-EGNPYASCRSIGCRVDGECDSGKACINGDCI----------NPCLINDPCGPNAECYVQ------SNRAQCRCLSGYRGNPYERCRVIG---CSSNNDCPTDKTCQNEQCVNP 19814          

HSP 27 Score: 77.0258 bits (188), Expect = 6.266e-13
Identity = 365/1578 (23.13%), Postives = 518/1578 (32.83%), Query Frame = 3
Query: 2082 ISKCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGDGINSCFDCLKCNTEADCSPYEN--RCYCRPGYTGNGF-----TCIKSCDK------------ICHKDALCQNSRCICKPNFEGDGVNYC-------FDCSK----------------CHKLAQCHP--KTGNCTCRPPYVGDGVSECETF---------------------LPKGNCFP-PCANHAICTV---ENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDKTNGYC---KCRYGFFGDGFTCNKTCCVEK-CHEQAQCVDGKCLCKPGFSGDGVETCFHCSQCDSNAICDQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGV---EYCFNCTSCHL-----NAKCIPRQNTCECNSGFHGDGIQCKLLPLCTPACH-PQASCINGNCKCNNNLIGDGISSCFDCD--KCSMNARCDVSNQRCICQ--PGYEGN----------------------GIKCVKTCFQSCHKLAVCK----EGTCKCSNGLTGDGVNFCF---------------NCSLCDKNAKCLINEEK--CECMERFEGDGFTCQD-------------------KVDCSSRCGENAFC----YNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFS-CHPNAKC--IKG--RCRCLSNLIGDGT---TYCFNCSSCARNSDCKPEQ---------------------QTCTCKRGYVKDG-NNCSII---------SARCHPE-CGVNAQCINGKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCVCQ------SGYIGNGFTCTKIINCVTKCH-VNGFCENQECKCLPGLIGDGINFCFDC-----STCDINAFCEPFNERCVCS--VGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSICDNNTVCYPDQEK--CVCNPGYYGDG------TTCFLFSQLCTEKCH-----PNAKCVN----RKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNG----QCQCQSGLQGNPLKHCFD-----------------CRPCHSFAVCDVENRRCICQ--------SGFEGDGRNCKKIKECSPK---------------CHRNAVCINQN----CVCIPEYIGDGINFCFN------------CSSCDRNADCEPHNNR--CTCYQGFTGNGLTCN-AIELKCEPSCGENAKCVNGK-----------------------CECLPGLQGNPLQHCFNCKRCDKFADCDVW--NKKCVCKNGYMGNGLTCISVNGC--NNKCDSNALCVNRHC--ICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQ---EGYIMNGAKC--QPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKK--CVCKNGYFGNGYMCTPINGC--NLKCNENALCVNQKCICLPGFI 5843
            ++ C C P + G+   CR E   +  C  + +C+N  C+          + C     C   A C  +E+   CYC+ GYTGN F     T I    +            IC  +A+C N +C C P + GD    C        DC++                C   A CH       C+C     GD    C+                        P   C P PC  ++ C     +  C C  N+ G P   C  +C+   ++SDC   + YC   +CR         C   C +   CH Q       C+C P  +G+ +  C                   I     E + +N  +   C      QA     +C C    +G        C N   C       N KCI   + C  + GF      C+++   +P C+ P+    N    C+             C+   C +NA C   N   +CQ  PGY GN                        KC   C   C   A+C+       C+C  G  G+  + C                  S C  N++C  ++ +  C C+  F G   +C+                    +  C   CG NA C    ++  C C+ GF G+ L  C                        NDI  R PC  S C P ++C  + G   C CL N +G        C   + C  N  C  E+                      +C+C  GY  D   +C ++         S  C P  CG NA C NG+C CL    G+P+  C     C   +DC P N  CV Q       G+ G    C   +N +  CH       N    C P  I D             S C  NA C   N   +CS   G+ G    C +         C +   C+  KC          V  C     C  N VC   Q +  C C P Y G+              +   + C      PN++C N     +C+C +   G   N       C P+ +   +     C +      + C    D C  +CG++A C        CQC  G+ G+P + C                     PC + AVC V+    +C+        + +EG    C    EC                  C   A+C   N    C C P Y G+    C               S C  N+ C   N +  C C  GF GN L      E      C ++  C+N K                       C C   + GNP   C   ++ +    C         +C+   + NG    S   C  N  C  +  CV++ C   CL              ++C  N+ C     K +C    E Y    A+C  Q    E +P C  +  C N K  C+  +  NP   C     C   A C V   +  CVC  GY GN      + GC  + +C  N  CVNQ+C+   GF 
Sbjct: 17331 VAACVCLPNYRGTPPNCRPECVINSDCPSSLACINEKCR----------DPCPG--SCAYNAVCRVHEHVPNCYCQTGYTGNPFISCQRTPIAPVQREPIEAKDPCYPSICGPNAVCNNGKCSCIPEYRGDPYVGCRPECVLNTDCARDKACIQQKCKNPCPGTCGLQALCHVYNHVATCSCPEGMQGDAFVRCDPKPKPQPPAPAPPTTLPAIVPQRAPINPCQPTPCGPNSQCRAYHEQAICYCLPNFIGTP-PGCRPECT---SNSDC-PLDKYCLNLRCR-------DPCPGACGIRAICHVQNH--GPLCVCPPHLTGNPLLACQP-----------------IVIPPVERDEVNPCQPSPCGPNSECQATSGGARCSCLPQYHGTPPFCRPECVNSADCPADKACRNYKCI---DPCPGSCGFSA---LCRVV-AHSPVCYCPEGYVGNAYTLCSRPEPSPPAVVILPCNPSPCGVNAFCQPHNDLSVCQCLPGYYGNPSEICRPECTVNSDCPSHRACMSEKCRDPCPGVCGLNALCQVINHSPVCECHTGHVGNPYHSCRIPQREPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLP-------------VPPPQPPKSNDI--RDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPCPGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCR--PECVLNSDC-PRNRACVNQKCVDPCPGHCGLNALC-DAVNHIAMCHCPERMTGNAFVSCQP--IRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLEC--YSSSDCSQVHSCINNKC----------VDPCP--GKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPN-------CRPECVSHDE-----CANTLACMNQKC---RDPCPGSCGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICR---VYNGAATCSYPECVINEDCSRDRACVSQKCRDPCL--------------NACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDK-ACINQVCRNP---CEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFT 18787          

HSP 28 Score: 62.3882 bits (150), Expect = 1.499e-8
Identity = 416/1743 (23.87%), Postives = 604/1743 (34.65%), Query Frame = 3
Query: 7725 SNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRKCHEKATCNIRSMK--CECLPGYIGNGF-ECISITS---CTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINP-NCQPPCHPKAVCV----KGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAICTEKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRAS-ECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQK----CECLPGLVGNGFIKCT------NCSECHKKALCHDQRG---CVCSHGYSGD--GIQCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNS---GCV-PLTC--LSKCHKYANCENG---VCKCILGYVGDGIICRLPDECKSSLD-CKY----ENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIG-----TCKCPPSFKGNGYS--GCFDCSKCHANADCDESKGCTCK------PGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILG-------CPVQCDKNAVC-LSNN---CVCKTGYSGTGLN-CKPNDQCSQNSDCPEP----NSRCE--------------MMKDYNRKCVCLPGFQDD---------------NGKCSPKECQPKCHMFAICITQTCYCVPGYFGDGIKSCTSC--SVCHKNAQCLPDRGCVCKSDFIGDGFNCRPLDECRINEDCRDP-----NKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSK---------------CHKNAKCE----GGMCQCLSGFIGDGINCQRPFECGIDNPCKDQF------------------SVCQLTSDAKRFVCVCVFGFQ----------MINSKCQPEPC-PINCHPLAQCKS-----GKCVCQGELQGDGI---RTCFKCSSCHARAVCSMDGCKCM-PGYVGNGIVCQTEDQ-----CQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQL----GVCVCKDGY--SPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNFAYC----RQKVCQCRLGFQGDGVFNCH---------DCSVCHP-----NAICSP---SLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEECL----FGQCQCKPGFIHNS-----------NKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPINCYQPCHKNAYCNIGVCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLL-PCDPNAVCV----LGECICKVGFTGNGLQCMPTSKCNPLSGCSDTNSVCIQVPPTNYYDCMCKPGYIKSSNL-SICKPIVCEPSCH--------PKAACIIGSCICMKPLIGNGITECKLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVDCPTRKICVNSKC 12281
            +NC+PN  C   L  C+ K+E  G+          P   ++ + CI+++  C  GL  D   C   + C   A C  +S +  C C  G+ GN   +C++  +   CT  SDC    E C                 I++LC +P +   PC   AVC+       C C     G+G+    P      +   Q+ E C        K+C   D L R     CQ+     +C   A C+   N  + C CLPGF+G+    C    GC  ++ C   Q CI          +C    +C   + C  +  R   +C     G  K  CS         C+P     PC  NA+C        C C  GL GN F  C         + C   + C    G   C C   Y G    I C +       S C  PN  C   ++   +C C  +++ S +   GCV P+     + C   A C++    VC C    +G+    RL D+   +++ C+      N EC    +    C C+SG+   + +     ++ +          C P  C P    +A CV+       C CP    G+  S  GC    +C  +ADC  SK C         PG  G G +C+ E+                        C C  G T +   +C  L         P  C +N+ C L NN   C C  GY G   + C+P  +C  NSDC +     N +C                ++ +   C+CL GF  D                  C+P  C P      +C           +GDG+  C  C      +N +C P+  CV  SD         P D   + + C DP      +  + N    N  C C P  +  N Y   ++CT+K               C  NA+C+    G  C C  G+ GD     RP EC +++ C  +                   +VC++ + A   VC+C  G+            +    +P PC P  C P ++CK+       C C    +G        C   S C     C    C    PG  G G  C+  +      C+ + +  D   AC P  D G+         +  + C P      CG NS CQ+     VC C   Y  SP      C+    C S+  C   N KC                          +  C N C + A C        C C   ++GD    C              C+P     NA+C+P   +  CTC  P+  GD  S   + +C   S+C  S A        +K  C+              PC   C  N EC        C C  GF  N             +T  EPN C  N+         +C         C C+ G+   FG   P  C   C  ++ C   +   N   +   + +C     C  ++  PI       + NP+    P   E   N      CL  PC  N++C       EC C  G  G    C P    N    C  +N  CI+          C+   I      ++C     +P C         P  AC +   + + P      T+   P  C A+  C+ +N        G   C C   +   +     + EC  N DCP  + C+N KC
Sbjct: 8457 TNCAPNEHC--KLGHCR-KKEPPGSPKT-------PEPCQSNNDCIESE-ACYMGLCQDP--CEFAKICAATAKCTAKSHRPVCTCPQGHEGNPMVKCVTTQTSIECTDDSDCGV-TEAC-----------------INQLCQHPCDVHDPCATNAVCINSNHAADCSCADGFQGNGFVGCQPAR----SHVCQYNEDCPP-----TKLC---DRLNRRCINPCQE----DSCGENAECIPV-NHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACI--------NGKCSSPCQCGAYALCDVVNHRGVCKCPPGYNGNPKVGCSP----PQDPCDP----NPCGLNALCELDNGNPICYCPKGLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCDPSPC-GPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICDSSRHPVCYCPDNKIGNPF--RLCDKPAVTIELCQPGPCGRNAECYVAGNRE-ECYCRSGYVGDAYQGCREPSRTV----------CDPNPCGP----NANCVVAGDGQTACVCPDGLSGDPTSVIGCHG-YECQVDADCPNSKACMGYRCYDPCPGACGQGAHCQVEEHHPV--------------------CSCNSGLTGNPGIRCYALDHPKKNPCVPSPCGRNSECKLLNNRAVCSCIPGYLGDPQSGCQP--ECDINSDCGDTLSCINHKCVDPCAGAICGINAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGP----HDVC---------SVYGDGVALCDPCFGPNAQQNPRCRPE--CVGNSDC--------PFDRACLGQRCLDPCPGSCGRNAICNVYEHNPVCAC-PTGLFGNPY---EQCTTKSVVETPPQPSCAKLHCGANAECKRQHSGLACVCRKGYFGDPHIGCRP-ECVLNSDCPAEKACLNSKCVEACTGVCGVNAVCRVVNHAP--VCICAEGYSGDASIACNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQPECVVSSECAPNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFE-GDPFVACSPIQDPGRD------IPVPKNPCVPS----PCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSDKAC--INEKC--------------------------QNPCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYPNPCAENAVCTPYNNAARCTCIEPYN-GDPYSTGCRPECIYSSECPSSLAC-------IKQHCR-------------DPCTAACGANAECTVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNS---------ICRSV-EGHPTCSCQVGY---FG--APPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFNAKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRN---VDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVIN--QDCP-SNRACIRQ--------RCEDPCIGICGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIVVLDPP-----TDPCYPSPCGANAICRVRN--------GAGSCSCIQNY-FGDPYINCRPECVQNSDCPNNRACINMKC 9961          

HSP 29 Score: 57.3806 bits (137), Expect = 5.785e-7
Identity = 293/1249 (23.46%), Postives = 432/1249 (34.59%), Query Frame = 3
Query: 6645 QDKCECLPGFIGDGIKFCFKC---SSCDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCA-PGGFCNNS-----KCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCIC--VIGYKGDGFRCYPVILECPKCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGD------GKNCVKIDECSP----KCHQNAVCIN----SNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDP-SCNTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKR---------------CDQNAICRPTEQRCVCK--PEFRGDGFQCALNLKTT--CQNDCHPNAVRVNNCCRCKNGFFGDGFSFCFNCSNCSPNADCFPHLSK--CQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRP-GLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDC-----------IRP-------NEICNVA--ISQCICEANSFLDPISK-------------LCINPNCQP-PCHPKAVCVKGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAICTEKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYP-CAKNAVCIYQKC-ECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSGDGI-QCRI--EDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCEN----GVCKCILGYVGDGIICRLPDECKSSLDCKYENQECVAR------------------LDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYS------------GCVPIDC--NPKCHRSALCVIGTCKCPPSFKGNGYSGCFDCSKCHANADCDESKGCTCK------PGFEGNGCYCRPED---KCK-FNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSN----NCVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCV---CL---PGFQDDNGKCSPKECQPKCHMFAICITQTCYCVPGYFGDGIKSC 9962
            Q  C CLPGF G   K   +C   S C P+  C+ +Q +  C  G  G   +C  I     P C+ P GF  N+     +      ++ + +  C+  S C  NA+C    ++ IC  +  Y G    C P  +   +C  +  C+  KC  K+   G     C   + C    Q   +   C C   Y GD       +  ++ ++ +P     C  NAVC      ++C CLP Y GN    C    +C  N+ C    +L    Q        C+   P SC  N     +    SC C  G SGD   +C   +                C  N+ C  ++ + VC+  P++ G    C     T   C ND      +     RC +   G           C  NA C  H  +  C C   +TG+ F+  +    P     + +  ++ C   P G          CR  +E+A C+       CL  Y G    C     CTQ+SDC           + P       N  C+V   +  C C      DP  +             +  +  CQP PC P A C  G C C     GD Y    PE       CV   E C  D++ ++   +C D              C G C S A C +  N  + C C  G+ G+    C       +  +    +   C+    G   +C               R   S+ I        C C  G+      C P     P C  +  C+ QKC +  PG        C + ++CH   + +    CVC  GY+G    +C +   D   +     DP                          C+P    S C  +A C N     VC+C+  Y+G    CR   EC ++ +C   ++ C+ R                   +    C C  G       S L   +  I  +    +            GC P  C  N +C++    V  +C C P + GN Y  C    +C  N+DC  S+ C  +      PG  G    C   D   +C+ F+    +PL  C   P    + +     TP           P  C  NA C  +     C C   + GT  NC+P  +C+ NS+C            Y++ CV   C+   PG    N  C       + H  +      CYC+  + GD    C
Sbjct: 15462 QAVCSCLPGFFGVPPKCRPECTINSDCAPHLACLNQQCRDPCP-GACGQFAQCQVIRHV--PHCSCPAGFSGNAFFLCQRLPPPPPVQREPINPCYP-SPCGPNAECTNQNEQAICKCLKDYIGTPPNCRPECITSSECPIQLACIGQKC--KDPCSG----LCGIAATC----QVVSHVPSCICIADYIGDPYTGCYARPPIQREQINPCYQNPCGSNAVCRERGEAASCQCLPEYYGNPYEGCR--PECVLNSDCS--SHLACLNQH-------CRDPCPGSCAPNAQCQVVNHVPSCSCYPGYSGDPYRHCHVAQAEPVQVVHFNPCQPSPCGPNSQCTESQGQAVCRCLPDYYGSPPACRPECTTNPECPND------KACVSRRCTDPCAG----------ACGQNAICRAHQHRAYCSCHPGYTGDAFMRCQSLPSPQPIRDSPVIYRDPCVPSPCGQFAQ------CRVEYEQAVCS-------CLTSYYGTPPYCRP--ECTQNSDCPSHRACVNQRCVDPCPGACGLNARCDVLNHVPSCSCPEGYLGDPFYRCYPAPAPPPTPVTVVADDPCQPSPCGPNAQCSNGVCSCLPLYQGDPYVGCRPE-------CVLSTE-CPWDKACIRN--RCLD-------------PCPGTCGSGATC-QVHNHVAMCQCPVGYQGNPFVLC------QQTPLQAPVELHPCQPSPCGHHGEC---------------REVGSQAI--------CTCRLGYYGSPPACRPECVSDPECPPSLACVNQKCRDPCPGA-------CGHLAQCH---VINHSPQCVCPAGYTGSPYSECHLIRADSSPIQRQPIDP--------------------------CLP----SPCGPHAQCSNEGGNAVCRCLTEYLGVPPYCR--PECIANSECP-SDRACINRKCQDPCPGLCGYNAICRTYNHQPNCVCAPGLVGNPFNSCLPPTRPEIPATPPTTAIQVLQYEEPFINGCEPNPCGANAQCNQRRGVV--SCVCLPDYFGNPYEACR--PECILNSDCPLSRACVQQKCRDPCPGTCGLNAECHVMDHLPQCRCFSGYTGNPLAYCSPVPIIQESPL-----TPCD---------PSPCGPNAQCHPSLNEAVCSCLPEFYGTPPNCRP--ECTLNSEC-----------AYDKACVHHKCVDPCPGICGINADC-------RVHYHS----PICYCISSHTGDPFTRC 16516          
BLAST of Neurogenic locus notch-like protein protein 1 vs. Ensembl Fly
Match: dpy (gene:FBgn0053196 transcript:FBtr0332351)

HSP 1 Score: 223.402 bits (568), Expect = 4.862e-57
Identity = 1030/4224 (24.38%), Postives = 1418/4224 (33.57%), Query Frame = 3
Query: 2091 CKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGDGINSCFDCLKCNTEADCSPYENR--CYCRPGYTGNGFT-CIKSCDK-------------ICHKDALCQNSRCICKPNFEGDGVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPC----ANHAICTVEN---TCQCRKNYYGNPLEKCNI------------DCSKCHTDSDCDKTNGY--CKCRYGFFGDGFTCNKTCCVE-KCHEQAQCVDGKCL-----------------------CKPGFSGDGVETCFHC------------------SQCDSNAIC--DQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKC--IPRQNTCECNSGFHGDG-IQC-----KLLPLCTPA-CHPQASCINGN----CKCNNNLIGDGISSC-------FDC--DK--------------CSMNARCDVSNQ--RCICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLINE--EKCECMERFEGDGFTCQDKVD-------------------CSSRCGENAFC----YNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGDGTTYCFNC-SSCARNSDCKPEQQ---------------------------TCTCKRGYVKD------------GNNCSIISARCHPE-CGVNAQCINGKCECLAGLQGNPFQQCFDCKRCSQFADCDP----WNERCV-----------------------CQSGYIGNGFTCTKIINCVTK-------------CHVNGFCENQECKCLPGLIGDGIN---FCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCV----KGKCECLPGLRGDGVQSCFD-----CSICDN---NTVCYPDQE--------KCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALC--FPDQQECSCKSEFVGDG---------KICTLRADICRP-TCGENAICVN----GQCQCQSGLQGNPLKHCF------------------DCR-----PCHSFAVCDVENR--RCICQSGFEGD-------------GRNCKKIKECSPK-CHRNAVCINQN----CVCIPEYIGDGINFCFNC----------------------SSCDRNADCEPHNNR--CTCYQGFTGNGLT--------CNAIEL----KCEPS-CGENAKCVNGK----CECLPGLQGNPLQHCFNCK-RCDKFADCDVWNKKCVCKNGYMGNGLTCIS---VNGCNNKCDSNALC-VNRH---CICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPG-CGENAKCVNGKCECLPGLQGNPMQHC-------FDC---KKCH-------------KFADCDVWN--KKCVCKNGYFGNGYM-CTPI-----NGCNLK-CNENALC--VNQK--CICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGN----CECLPGFVGDGIQVCF----------------NCSTCDKNANCFPYQE--RCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNG-EQCVENI----EGSSP----KCHSNALRVNQ----QCICLPGFIGDG----KNFCFDCSTCPPNSDCLPQEQRC--ICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGDGIKFCFKC--------------SSCDPNADC--VPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGF-RCY---PVILECPKCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDEN--LCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGDGFSFCFNCSNCSPNADCFP--HLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYIGNG----FECISITSCTQSSDCIRP------------NEICNVAISQCIC------EANSFLDPISKLCI------NPNCQP-PCHPKAVC-VKG---KCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCT-------------DCSGCDKNAICTEKQG---CICKSGFIG---DG--RQCIVLNECADNSDCTTIR---------GRASECIRSSEGIQKCQCSQGFK---------LLNGKCEPLSCIY-------PCAKNAVCIYQK----CECLPGLVGNGFI---KCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKICIT--STDTVKRCVCKSSFISSNSG-----CVPLTCL--SKCHKYANCENGVCKCILGYVGDGIICRLPDECKSSLDCKYE----NQECV-------------ARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPK-CHRSALCVIGTCKCPPSFKGNGYSGCFDCSKCHANADCDESKGCTCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGT--------TPSTNGKCIILGC-PVQCDKNAVCLSNN----CVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICITQT----CYCVPGYFGDGIKSCTSC---SVCHKNAQCLP--------------DRGCVCKSDFIGDGFNCRP----LDECRIN-----EDCRDP-NKMCLLNPSMKNLQCTCK---PLHILINNYCLPKE------------CTSKCHKNAKC----EGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKS----GKCVCQGELQGDGIRTCF--------------------KCSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQL----GVCVCKDGYS------------------------PSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEE----TCPNKCHNFAYC----RQKVCQCRLGFQGDGVFNCH----------------DCSVCHPNAICSPSLGCTCPGPHLIGDGRS-CKPKDQCRIDSDCRDS------------------NAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIP--------------IN------CYQPCHKNAYCNI----GVCTCNPDYIGDGITSCK----------------KKNLCLEDSDCPIIGSKC-------MTKSNPY-------SCKCPSGYEIDNNKCIAKKCLLPCD----PNAVCVL----GECICKVGFTGNGL-QCMPTSK-------CNPLSGCSDTNSVCIQVPPTNYYDCM----------CKPGYIKSSNLSICKP-------IVCEPSCHPKAACIIGS----CICMKPLIGNGITECKLPDECSASVHCK-------NKNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVDCPTRKICVNSKC 12281
            C C P F+G+   CR E   + +C    +C+N  C           + C     C  EA C    +   C C  GY G+ F  C K  +               C ++A C    C C+ N++G+    C    +C   A C P+   C                   +  C  PC     N+A+C V N    C C K Y G+P   C +              S C ++S C   NG+  C C  G+ G    C   C V  +C     CV+ KC+                       C PG +GD  + C                     S C  N+IC  D+N   C C+  F G+  NC         C     C+  KC             C    SC  NA+C  I    +C C +G+ G+  +QC     +    C P+ C P A CI  N    CKC +   G+    C        DC  DK              C +NA+C   N    C+C  GY G+        F SC ++ V            T   V+     S C  N+KC +      C CME F G    C+ +                     C+  CG NA C    +N  C C L   G+P   C+       P   D P R+            +PC  +     +  +  C CL N IG       NC   C  N+DC P+Q                             CTC+ G+  D              +  +    C  + CG NA+C NG C CLA  QG+P+  C     C+   DC P     N++CV                       C  GY G+ F   +    V K             CH++G  +   C C PG++G        C   S C ++  C   N +CV                   C  AC + A+C        C C  G  GD    C+       +  DN    + C P+ E         C C   + G   +C     +  E C P   C+ +KC           + C N  +C  +A C     Q  C+C   + GD          +I   +   C P  CG NA+C      G CQC     G+P + C                    CR      C S A C V N    C C+ G+ GD              R  +  + C P  C  N+ C   N    C C+  YIG   N    C                       +C  NA+C   N+   C C QGFTG+  T           IE      C PS CG N++C N +    C CLP   G P     NC+  C   A+C               + L CI    ++ C   C   A C V  H   C+C  GFTGD              S+C P       Q  Y          V  C P  CG NA+C  G C CL    G+P   C        DC   K CH             + A CDV N    C C     G+ ++ C+P+     N C    C  N+ C  VNQ+  C CLP FIG       +C+   +NS C P +          +N++   P      C   C   A C   +    C C   F G+    C                   S C   + C P  E   C C   Y G   NC    PE +                  L   +   +  C      + E   V    +CIC+ GF+G+   QC   I    E  +P     C  NA+  ++     C CLP + GD     +  C   S CP N  C  Q+ RC   C     +N   C      P C                CL G++GD  + C +               + C PN+ C    EQ  C C   F G    C + E T    C+    C N KC     +      +C N + C V          C C+ GY GD F RC+   P I+E      R  C+   C         G N     SEC +N    P    C C   + G   NC      + +C     CIN  C             C     C  NA+C    +  LC C  G+ GN  T      +CN    +          C                 C  NA CR    +C C PE++GD +             C P  V   +C R +          C     C  NA C    H+  C+C E+ +GN F     EC+P          K Q  C+P   G       CR   + A C+       CL  Y+G+      EC++ + C    DC               N +CNV   +  C        N F+    +L I      NP CQP PC P + C V G    C C    VG    CR   EC ++++C   Q    +         KC D              C G C   A+C   S+  + CLC  GF GD  + C+             + S C  NA C E+ G   C C   + G   DG   +C++ ++C  N  C   +         G+ +EC +    +  C C  G+           +N   EP   +Y       PC  N+ C        C CLP  +G+      +CT+ SEC     C +++         G   +CR+ +    N  CT     C++  + D   RC  +              CVP  C   S+C +     +  C C+  Y+G    CR   EC  + +C       NQ+C              + ++ + +C+C +G  +  +  S+ N + + ++         P  CNP  C  +  C  G C C P + G+ Y+GC    +C  + DCD S+ C        + C     D C      N   ++    P    NC C  G         +P      +   C P  C  N+ C   N    C C T + G+   C+P  +C+ NS+CP            N  C         N KCS   C   C   A C        C C+  Y G+   SC       V      CLP                 C C  ++IG   NCRP      EC  N     + CRDP   +C  +   + L  T     P  +  + + L KE              S C  NA+C    + G CQCL  + G+     RP EC +++ C      CQ                     KCQ +PCP  C   A C        C C     GD  R+C                     +C   + +A+CS     C+P YVG   VC+ E  C   S+C   + AC       +KC                 C   CG  + C++     +C C+ GY+                        P V    C P   C+S+ D P  +    Y G     R  CR      S   CI E     CP  C   A C        C C  G+ GD    C                 + S C PNA C+  + CTC  P   GD  S C+P  +C   +DC                     NA+CT+      C C  GY       C P P           L   CQ               P+ C  N  + C+   EV     N +A+C C  G+I     C P              +N      C   C +NA C++      CTC P + G+    C+                + + C  +S+C   G             S PY       + +CPS     N  CI +KC  PC      +A C +      CIC  G TG+   QC P  +       C P S C   N+ CIQ        C+          C+P  + +S+    +          C  SC   A C + +    C C    IG+    C  P E  A  +           N+ C+ S +GQ  C C   F      C  + EC ++ +CP  + C+N KC
Sbjct: 11473 CSCLPNFIGAPPRCRPECVLNSECGPTEACINQKCA----------DPCSG--SCGFEAKCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCR--PECTLSADC-PRDKACM------------------RNRCVDPCPGICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSSECSALQACVNKKCVDPCAAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKC----------SNPCPE--SCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAVNHVPNCVCNDGYTGDP-------FASCRRVEV-----------TTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPPNCKPECTVNAECPSNRACHKFRCANPCAKTCGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPPPPGPKDEPVRR--------PCQPSPCGLNSECRVRDEQASCSCLPNFIGAPP----NCRPECVVNTDCSPDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQDPCDLQPCGSNAECRNGICSCLADYQGDPYTGCR--PECTLSTDCAPTKACLNKKCVDPCPGVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISG--QGPVCACQPGMLGSPPACKPECIVSSECSLHTAC--VNRKCV-----------------DPCPGACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIGTPPSCRPECSINPE-CPPTKACIRQKCS----------DPCVN--ACGFNARCNVANHQPICTCDVGYTGDPFTGCQKEQERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDHFGDPYQSCRPECVRHSDCASNKACQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEPPQLPARVTEPSQPCRPSPCGPNSQCRELNGQAVCSCLELYIGLPPNCRPECVLSTECPTDKACISQRCQDPCPGTCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPPPVIERVERDPCLPSPCGLNSQCRNVQGVPSCTCLPDFLGAPP----NCRPECTISAECP--------------SNLACIRERCIDPCPGSCGYAAECSVVNHTPICVCPAGFTGD------------PFSSCRPAPPPEPTQSEY----------VDPCNPSPCGPNAQCNAGICTCLAEFHGDPYSGCRPECVLNSDCPRDKACHSSKCVNPCPGTCGENAICDVINHIPMCRCPERTAGSAFIRCSPVQITVSNPCRPSPCGPNSQCREVNQQAVCSCLPSFIGAPPSCRPECT---SNSECAPTQA--------CLNQRCGDP------CPGTCGVGANCAVVSHSPFCTCPERFTGNPFIRCQPQIEPPVRDVAPVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCR---PECV----------TSSDCSSQLACVNQKCVDPCPGRCGLNAECFVVSHAVQCICQQGFNGDPFVQCKPEIAYENEIRTPCSPSPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCRPECMLDSDCPSNRAC--QQLRCQDPCPGTCGLN-ANCQVVNHLPTCT---------------CLTGYVGDPYRQCNRLPEPPQNEYVNPCQPTPCGPNSQCRVSNEQAVCSCLPLFVGTPPSC-RPECTISSECSADRACVNQKC-----VDPCAADTCGNNAICRVRNH----SPICSCISGYTGDAFTRCFLIPPPIIETKDEPLRDPCIPTPC---------GPN-----SEC-RNINGVP---ACSCLVNFIGQAPNCRPECTINSECPSQLACINQKCR----------DPCP--GACGQNAVCSVINHTPLCACIDGYIGNPFT------NCNPKPPEPPAPPVADDPCNPSP-------------CGANAQCR--NGQCSCIPEYKGDPYV-----------SCRPECVLNTDCPRDRACVRNKCIDPCSG--TCGVNALCEVNNHIPICRCPEQMSGNAFF----ECRPVPP------AKIQNPCQPSPCGPNSQ---CRVVQQTAVCS-------CLANYVGSPPQCRPECVTNSDCPADQDCQNMKCRDPCPGTCGFNALCNVVNHRPFCSCPTGMSGNPFVS-CQQLIIRDERPQNP-CQPSPCGPNSECRVSGDSPSCSCLPEFVGAPPNCRP--ECISNSECPTNQACINQ---------KCVD-------------PCPGLCGQNAICRVFSH-SAMCLCDGGFTGDPFSQCSPIRDSPPEVLQPCNPSPCGVNAKCEERGGAGSCQCLPDYFGNPYDGCRPECVLNSDCPSNQACVNQKCRDPCPGTCGQNAEC-QVVNHLATCNCLVGYTGDPYSICRITVN---EPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIGSPPACRPECTSSSECAADKACVNRKCVDPCPNVCGQQAECRVRNH---NPICT-----CLSGFTGDPFTRCYRQPPPPPVVEREPLDPCVPSPCGANSQCREIHGTPS--CSCLPQYLGTPPNCR--PECSINAECPSHQACINQKCRDPCPGSCGLNTQCSVINHTPICSCLAG--YIGDPFSVCNPEPIPEKIRDPLPPEDP--CNPSPCGSNTQCNNGVCSCLPEYHGDPYTGCR--PECVLHTDCDRSRACV------RHKCV----DPCPGTCGTNAICEVLNHIP----NCRCLEGMQGNAFIQCSPVPKLDVVQNPCQPSPCGPNSQCRVVNQQAICSCITSFIGSPPFCRP--ECTTNSECP-----------LNLAC--------RNQKCS-DPCPGVCGRGAQCHVTNHSPFCRCLERYTGNPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYIGAPPNCRPECVTSSECPTNQACIQQKCRDPCPGLCGQSAECRVLSHTPSCVCPEGMEGDPFTLCKEKRIQELDQLDPCSPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGCRP-ECVLNSDCPSN-KACQ-------------------QQKCQ-DPCPGTCGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVKEYVNPCQPSPCGPNSQCREVNEQAICS-----CLPEYVGAPPVCRPE--CTISSEC-PADKACV-----NQKCV--------------DPCPNTCGDQAICRVVNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPCV-PTPCGPYSQCRSQGDAPACSCLVGYIGAPPNCRPECRINAECPSSQACINEKCRDPCPGSCGYGAICNVINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCNNGV-CTC-IPEYHGDPYSGCRP--ECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTP--------PPALVQPCQ---------------PSPCGPN--SQCR---EV-----NQQAVCSCVPGYIGTPPLCRPECTSNSECLSHLACVNQKCNDPCPGSCGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECPS-----NLACINQKCRDPCPGLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQP-SPCG-ANAECIQRNGAGACQCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDPCPGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPPAPEYVNPCQPSPCGANSQCRES-QGQAICSCLPEFVGTPPSC--RPECVISAECPADRACINQKC 15221          

HSP 2 Score: 214.157 bits (544), Expect = 2.430e-54
Identity = 981/4233 (23.18%), Postives = 1375/4233 (32.48%), Query Frame = 3
Query: 2085 SKCKCKPGFVGSGYECREEVNCDIKCHENASCV-----------------------NGYCKCNRNLIGDGINSCFDCL----------------KCNTEADCSPYENR-------------CYCRPGYTGNG----------FTCIKSCDKICHKDALC----QNSRCICKPNFEGDG---------------VNYCFDCSKCHKLAQCHP--KTGNCTCRPPYVGDGV-----------SECETFLP------KGNCFPPCANHAICTVEN---TCQCRKNYYGNPLEKCNI----------DCSKCHTDSDCDKTNGY--CKCRYGFFGDGFTCNKTCCV-EKCHEQAQCVDGKCL-----------------------CKPGFSGDGVETCFH-------------CSQCDSNAIC-DQNNKA-CICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPR--QNTCECNSGFHGDG-IQCKLLPLC-----TPACHPQASCIN---------GNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCK----EGTCKCSNGLTGDGVNFCFN---------------CSLCDKNAKCLINEEK--CECMERFEGDGFTCQD-------------------KVDCSSRCGENAFC----YNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFS-CHPNAKC----IKGRCRCLSNLIG---------------DGTTYCFNC-------SSCARNSDCKP--EQQTCTCKRGYVKDG---------NNCSIISARCHPE-CGVNAQCIN----GKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFC----ENQECKCLPGLIGDGINFCF------------------DCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECL--------PGLRGDGVQSCFDCSICDNNTVCYPDQEKCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALC----FPDQQECSCKSEFVGDGKICTLRADICRPTCGE------NAICVNGQCQCQSGLQGNPLKHCFDCRPCHSFAVCDVENRRCICQ--SGFEGDGRNCKKIKECSPK---------------CHRNAVCINQN----CVCIPEYIGDGINFCFNCSSCDRNADCEPH----NNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKC--VN--GKCECLPGLQGNPLQHCFNCKR------------CDKFADCDVWNKKCVCK--NGYMGNGLTCISVNGCNNKCDSNALCVNRHCI-----------------------CLPGFTGDGTRFCFDC----------------SSCPKNSNC--LPEEQKCICQEGYIMNGAKCQPIVHEC--RPGCGENAKCVNGKCECL-PGLQGNPMQHCFDCKKCHKFADCDVWNKK--CVCKNGYFGNGYMCTPINGCNLK----------------CNENALCVNQ----KCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGN----CECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGS-SPKCHSNALRVNQQCICLPGFIGDGKNFCFDC----------------STCPPNSDCLPQE--QRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCV-----------------------------QDKCECLPGFIGDGIKFCF---------------KCSSCDPNADCVPEQ--QKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKC----QCNSGLKGDGVTSCFNCSKCDVNAKC--FPSVKKCICVIGYKGDGFRCYPVILECPKCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSK--CECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGIT-CKAI-------DPSCNTNCHKDALCF----KDSCICKSGLSGDG---KNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNA----VRVNNCCRCKNGFFGDGFSFCFNCSNCSPNADCF---------PHLS--------KCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDC--RKCHEKATCNI--RSMKCECLPGYIGNGF---ECISITSCTQSSDCIR----PNEICNVAISQCICEANSFLDPISKLCINPNCQP------PCHPKAVCVKGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAICT---EKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCECLPGLVGNGFIKCTNCSE---------------CHKKALCHDQRGCVCSHGYSGDGIQ-CRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCEN----GVCKCILGYVGDGII-CRL-------------PDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVP---ID-CNPKCHRSALCVI----GTCKCPPSFKGNGYSGCFDC------------------SKCHANADCDESKG---CTCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCL----SNNCVCKTGYSGTG-LNCKPNDQ----------CSQNSDCPEPN--SRCEMMKDYN-------RKCVCLPGFQDDNGKCSPKECQPKC--------HMFAICITQTCYCVPGYFGDGIKSCTSCSV--------------CHKNAQCLPDRG---CVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCL----LNPSMK-------------NLQCTCKPLHIL----------------------INNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDGINCQRPFECGIDNPCK-DQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGDGIRTCFK-CSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPK---------CGKNSQC----QLGVCVCKDGYS--PSVNGLSCSPI--DHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFI---PKSVFQCIEET----------------CPNKCHNFAYCR----QKVCQCRLGFQGDGVFNCH--------------DCSVCHPNAIC---SPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDS------------------NAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPINCYQPCHKNAYCNIGVCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCD----PNAVCV----LGECICKVGFTGNGLQ-------------------CMPTSKCNPLSGCSDTN--SVC------IQVPPTNYYDCMCKPGYIKSSNLSICKPIV-------CEPSCHPKAACIIGS----CICMKPLIGNGITECK-----------------LPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVDCPTRKICVNSKCICP 12290
            + C C P F G+   C+ E     +C  N +C+                       N  C C  N  GD   +C                     C   + C   +NR              YCRP  T +             C   C  +C  +A C     ++ C C  ++EGD                ++ C+  + C + A C P      CTC  PY GD             SEC + L       +  C   C  +A CTV N   +C C + + GNP + C            + + C  +S C    G+  C C+ G+FG    C   C V  +C +   C++ KC+                       C   + G+  E C                S C SN+IC + NN+A C C  G  G   NC       Q C     C+  +C           + C     C  NA C  +  Q  C C   F GD    CK+  +      T  C+P     N         G+C C  N  GD   +C    +C  N+ C  +N+ CI         +KC   C  +C   A+C+    +  C C   LTG+ +  C                  S C   + C +  E+  C C+  + G    C+                    K  C   CG NA C    ++  C C  G+ G+P   C             +P RK   I +  I    PC  S C PN++C        C C++N IG                    C N         SC  N+ C        C C+ GY  D              +I   C P  CG+NA C        C+CL    G+P+ +C     C   +DC P +  CV Q            +  C   C  N  C        C+CLPG  G+ I  C                     S C + + C P N   VCS   +       I +P  C+  C   ++C + K  CL        PG  G+       C + ++N +C        C+PG+ GD    F+       +C P  K           +  D ++ C   + C P++ C      +Q  CSC   +VG       RA  CRP C        N  C+N +C+            C     C     C V N R IC+   G+ GD        ECSPK               C  NAVC  +N    C C+PEY GD    C     C  N+DC  +    NN+C                   C   CG +A+C  +N    C C  G  GNP Q C    R            C  ++ C   N   VC     Y+G    C      +++C  +  CVN+ C                        C  G++GD    C                   S C +NS C  + E   C C   ++     C+P   EC     C  N  C+N +C+   PG              C   A C V N    C C +GY G+     P  GCN +                C  NA C  +     C CLP + GD    C     C  NS+C  +K          +N+K   P      C   C  NA+C   N    C CL G+ G+    C             P ++   C+P   G    C ++   ++C                CLQGF G          +C  E I   D     C    +   ++CV+   G+   +     +     C C PGF GD  N C                   S C PNS CL       C C  DY          GR P C P+C   A C                              +  CEC+PG+ GD    C                  S C  NA C        C C   ++G+        S C P C     C+ S+     +C     G           C +NA+C        C C  GY GD  R          C       I    CK              S C   +QC    S   C C +GY G   +C      S +C QN  CIN  C             C N A+C           +C C  G TG+ I+ C+ +       +P   + C  +++C     + +C C +G  G     +  C +   C  +  C+  ++RCV                   C   C  NA    V+ N  C C +G+ G+    C      +P              PH           C C + F GN +  QR  C+  C E    C   Q   R       + C+D     C + A C +      C+C PGY G+ F   + + +T     + C      PN  C    +Q +C   +       +   PNC+P       C P+  CV  KC+               + C +       + +C     S   IC C   +  D   +C + A      + +    S        C+P             S C  NA C        C C   FIG   +C    EC  NS+C    G    CI + +    C  S GF+    KC  L        N + I   C C+ G  G+ F++CT   E               C + A C     C C + Y G+  + CR E  C+L++DC   +K C+ +     RCV                C   C   A CE      VC C+ GY GD  + CR+             P  C S+  C+  N   V        C+C  G+     +      + ++     A   CV    +D C   C   A C +      C CPP   G+ +  C                     S C  N+ C   +    C C+P F G+   CRPE  C  N DC            +++ C+         N KC    CP  C  NA C     + +C C TGY+G   + C P  +          C  N++C E N  + C+ + +Y        R    L      +  C   +CQ  C          +A+     C C  GY GD   SC    V              C  N++C    G   C C   FIG   NC+P  EC +N +C   N+ C      NP  K             N  C+C PL +                       +   C P  C        + E   C CL  FIG   NC RP EC ++  C  DQ  + +   D     C        ++S+C+            Q     C C+G   GD    CF+           + D C   P              C  +++CR+   +C           C+P  +L        AC  K         CG+NSQC     + +C C  GY+  P V+    +P+  D CQ     P+S    + H   QG  C C+ G +   P    +CI  +                CP  C  FA C+       C C  G+ GD    C+                S C PN+ C   + +  C+C     IG   SC+P  +C I+ +C  +                  NA C +      C C +GY                        F  CQ +   I N   T  EPN C  N                   A+C  R G                        IG C C PD+ GD   SC+ +  C+  SDC                         N  C  +KC  PC      NA C     L  C C++G+TG+  +                   C P S C P S C + N  +VC      I +PP       C+P  + S+     K  +       C  +C   A C + +    C C +   G+  T C                  LP  C  +  C+N         +G   C C   F      C  + EC ++ +CP+   C+  +CI P
Sbjct: 9114 AACSCLPNFKGAPPVCQPECVVSSECAPNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFEGDPFVACSPIQDPGRDIPVPKNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSDKACINEKCQNPCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYP-NPCAENAVCTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRDPCTAACGANAECTVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFNAKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVINQDCPSNRACIRQRC----------EDPCIGI--CGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIVVLDPPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCR--PECVQNSDCP-NNRACI--------NMKCRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACVERPSNMYLPLPKDPCRPSPCGLFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPSDRACINQRCKDPCPGTCGYNARCRCTNHSPICSCYDGYTGDPFHQC-------------VPERKPPPIAD-PIVPPNPCVPSPCGPNSQCQVSSSGAVCSCVTNYIGRPPGCRPECSINSECPARMACINARCADPCIGSCGNNALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQP-CRPSPCGLNALCEERNQAAACKCLPEYFGDPYVECR--PECVINSDC-PRSRACVNQKC----------VDPCPGMCGHNALCAVFNHAPNCECLPGYTGNPIVGCHIVPESPRYPDPIVPENPCQPSPCGLYSNCRPVNGHAVCSCVPS------YIGSPPNCRPECMSSSECAQDK-SCLNERCKDPCPGTCGNNAL----CRVVNHNPICS-------CSPGFSGDP---FV-------RCFPQEK--------RPPITHDRIDPCVP-SPCGPNSECRVSAANEQAVCSCLQHYVG-------RAPNCRPECTSDSECPGNLACINLRCR----------DPCVGT--CGIQTTCLVNNHRPICRCIDGYAGD-----PFSECSPKINVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTECR--PECVLNSDCSKNRACLNNKC----------------RDPCPGVCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVCSCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPGTCGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPNCRP---ECTINTECPANLACINERCQDPCPG-------------SCGFNAFCSVVNHSPICTCDSGYTGD-----PFAGCNPQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCR--PECVVNSDCSRDKS--------CVNQKCVDP------CPGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPPP----PERDENPCRPSPCGPYSQCREVDGHAVC---------------SCLQGFIGSA-------PNCRPECIISSD-----CAQNLNCQNQKCVDPCPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYL---------GRPPNCRPECLSSADCPANLACVNQRCSNPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAICRERNGAGSCACLPEYFGD------PYSGCRPECVQNDDCDRSRACINNKCQDPCPG----------ACGINAECRVLNHGPNCNCFDGYTGDPHR---------SCSLIEVVTIRPEPCKP-------------SPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPECVVSSECPQNRACINQKCE------DPCRGSCGNNAKCQVVN----HNPICTCQPGMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQ--QERCV-----------------DPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRG-CRREC-ENNDDCTAVQACSR-------FKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGF-----INQPPNCKPECVVSAECAPEKACVHKKCV---------------DPCQHTCG---IRAICTTKNHS--PICTCPRTMTGDPFVECTRVAITNDNTTPSPAPAS--------CVP-------------SPCGPNAKCQIVGNSPACSCLPNFIGAPPRC--RPECVLNSEC----GPTEACI-NQKCADPCSGSCGFE---AKCHVL--------NHLPI---CNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGE-CRCQNNYQGNAYEGCRPE--CTLSADCPR-DKACMRN-----RCV--------------DPCPGICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAV--------CSCLEGYIGAPPQ---CRPECVVSSECSALQACVNKKCVDPCAAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPE--CIINPDCQ-----------STQACI---------NNKCSNP-CPESCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAVNHVPNCVCNDGYTGDPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPPNCKP--ECTVNAECPS-NRACHKFRCANPCAKTCGLNAKCEVINHNPICSC-PLDMTGDPFARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNC-RP-ECVVNTDCSPDQACIAEKCRDPCDGSC-------GVDSECR-----------VQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQDPCDLQP--------------CGSNAECRNGICSCLADYQGDPYTGCRPECTLSTDCAPTKACLNKKCVDPCPGVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNS----LCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPCPGACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSC-AATFIGTPPSCRP--ECSINPECPPTKACIRQKCSDPCVNACGFNARCNVANHQPICTCDVGYTGD--------------------PFTGCQKEQERIVNEQVTPCEPNPCGSN-------------------AVCRERNG------------------------IGSCQCLPDHFGDPYQSCRPE--CVRHSDC-----------------------ASNKACQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEPPQLPARVTEPSQPCRP-SPCGPNSQCRELNGQAVCSCLELYIGLPPN------CRPECVLSTECPTDKACISQRCQDPCPGTCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPPPVIERVERDPCLPSPCGLNSQCRN--------VQGVPSCTCLPDFLGAPPNC--RPECTISAECPSNLACIRERCIDP 12788          

HSP 3 Score: 211.46 bits (537), Expect = 1.595e-53
Identity = 992/4148 (23.92%), Postives = 1377/4148 (33.20%), Query Frame = 3
Query: 2064 AECYP--EISKCKCKPGFVGSGY-ECREEVNC--DIKCHENASCVNGY----CKCNRNLIGDGIN-----SCFDCLKCNTEADCSPYENR--------------------CYCRPGYTGNGF-TCIKSCDK----ICHKDALCQ----NSRCICKPNFEGD--------GVNYCFDCSKCHKLAQCHPKT---GNCTCRPPYVGDGVSECETFLPKGNCFP-PCANHAIC--TVENTCQCRKNYYGNPLEKCNIDC--------SKCHTDSDC--DKTNGYCKCRYGFFGDGF-----TCNKTCCVEKCHEQAQCV---DGK--CLCKPGFSGDGVETCF-HCSQCDSNAICDQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNC----------TSCHLNAKC--IPRQNTCECNSGFHGDGIQCKLLPLC--TPACHPQASCINGNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQR--CICQPGYEGNG-IKCVKTCFQSCHKLAVCKEGTCKCSN--GLTGDGVNFCFNC--SLCDKNAKCLINEEKCECMERFEGD------GFTCQDKVDCSSRCGENAFC----YNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGR----CRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQ---------------------------TCTCKRGYVKDGN-NCSII----SARCHP----ECGVNAQCIN-----GKCECLAGLQGNPF---QQCFDCKRCSQFADC------DP---------------WNERCVCQSGYIGNGF-TCTKIIN-----------CV-TKCHVNGFCENQE----CKCLPGLIGDGI---NFCFDCSTCDINAFCEPFNERCVCS-VGFTGNGKKCSILA-PITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSICDNNTVCYP--DQEKCVCNPGYYGDGTT------CFLFSQ--------------LCTEKCHPNAKC--VNR--KCKCNERLVGDGVNFCFNCTSCHPDALCFPD-------------QQECSCKSEFVGDGKICTLR------------------ADICRPTCGENAICV----NGQCQCQSGLQGNPLKHCFD-------------CRPCHSFAVC-DVENR-RCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADC--EPHNNRCTCYQGFTGNGLT-CNAIEL--------KCEPS-CGENAKCV----NGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISV---NGCNNKCDSNALCVNRH----CICLPGFTGDGTRFCFDCSS-----CPKNS------------NCLPEEQKCICQEGYIMNGAKCQP--------------IVHECR---PG-CGENAKCV----NGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCV--------------------CKNGYFGNGYMCTPINGCNLKCNENALCVNQK-----------------------CICLPGFIGDGIKFCFD-----------CSACPANSNCVPEKK----ECKCAKDYFMNEKI-CSP--------------IKQPVL--CTSKCHKNAKCL----KGNCECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNAL-RV---NQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVP-------KCHHYASCVQDKCECLPGFIGDGIKFCFKCSSCDPNADCVPEQQKCV---CKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSK--CQCNSGLKGDGVTSCF-------------NCSKCDVNAKCFP--SVKKCICVIGYKGDGF-RCYPVIL------------------ECPK-CHYRAQCVI----GKCQCKNGLQGDGINFCMNC------------SECDKNAQC--FPNFSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDEN--LCVCAQGFTGNG-ITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDG----------FQCALNL-------KTTCQNDCHPNA----VRVNNCCRCKNGFFGDGFSFCF--------------NCSNCSPNADCFPH--LSKCQCKEEFTGNGFICQRKEC--KPACSEATSLCIKNQCFCR-PGLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQP-PCHPKAVC--VKGKCICN--RNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQK--PACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAICTEKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQK----CECLPGLVGNGFIKCT---------------NCSECHKKALCHDQRG---CVCSHGYSGDGIQ-CRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCE----NGVCKCILGYVGDG--------IICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRS----ALCVI----GTCKCPPSFKGNGYSGCFDC------------SKCHANADCDE---SKGCTCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVC--LSNN--CVCKTGYSGTGL-------NCKPNDQCSQNSDCPE--PNSRCEMMKDYNRKCVCLPGFQ--------------DDNGKCSPKE----------CQPKCHMFAICITQ----TCYCVPGYFGDGIKSCTSCSV-------------CHKNAQCLP---DRGCVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDG-INCQR-------------PFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPIN--CHPLAQCKSGKCV--CQGELQGDGIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNFAYCRQ----KVCQCRLGFQGDGVFNCHDCSVCHPNAI--CSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEP--------NDCDVNN--------PASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPINCYQPCHKNAYC----NIGVCTCNPDYIGDGI---------TSCKKKNLCLED---SDCPI---IGSKCMTKSNPYSCKCPSGYE-------IDNNKCIAKKCLL-PCDPNAVCV----LGECICKVGFTGNGL-----QCMPTSKC------------NPLSGCSDTNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVCEPSCHPKAACIIGSCICMKPLIGNGITECKLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVDCPTRKICVNSKCICP 12290
            AEC P    ++C+C PGF+G+ Y +C     C  D +C  + +C+NG     C+C    + D +N      C      N +  CSP ++                     CYC  G TGN F  CI   D+     C  ++ C+    N  C C P +EG           N C D S C    QC   +     CTC P YV    +      P   C P PC   AIC  +    C C  N  GNP   C+             C  +++C        C CR G+ GD +          C    C   A CV   DG+  C+C  G SGD       H  +C  +A C  N+KAC+    ++     C +  +C+ + H         C CN GL GN    C+            + C  N++C  +  +  C C  G+ GD  Q    P C     C    SCIN  C          +  C     C +NA C+V      C+C  G+ G+  ++CV            C    C   +   + GDGV  C  C      +N +C     + EC+   +        G  C D   C   CG NA C    +N  C C  G  GNP E C    V   P     P   C                 C  NA+C +      C C     GD    C     C  NSDC  E+                             C C  GY  D +  C+        R HP     CG N++C         C CL   +G P     +C     C+    C      DP                N  C C++ + G+ F  C+ I +           CV + C  N  C+ ++    C C+   IG        C   S C  +  C   NE+C        G+  +C+++A    C      +     G  + +    GD +  C+  + C  N VC P  +  +C C   Y GD  +      C   S+               CT  C  NA+C  VN    C C     G+  + C       P+ +C P+                CSC+  + G    C                      D C  TCG NA C     N  C C +  +GNP + C                 PC S ++C +V NR  C C  G  G   NC+     +  C  N  CI Q C    E    GI        C  NA C  + H  +C+C + F G+  T C   E+         C PS CG NA C      G C C+    G+P  +C     C + +DC               N   CI++   + C N C  NA+C   H    C C P  TG+  R C +  S      PK+             + + E   C C   Y+     C+P              I   C+   PG CG NA+C     +  C C  G  G+P   C   +K    AD  V    CV                    C   Y G    C P    N +C     C+N +                       C+C PG+ GD    C+            C   P   N + E++     CKC  +YF +  + C P              + Q  +  C   C  NA C       NCECLPG+ G+ I  C       +  +  P      C+P   G   NC  +   ++C                   G   +    C + S C+ +  C+                E+C +   G+   C +NAL RV   N  C C PGF GD            P   C PQE+R     D            R   CVP       +C   A+  Q  C CL  ++G       +C+S   +++C P    C+   C+    G       I++TC          NN +  C+C  G  GD  + C              N S C  NA C     V  C C+  Y GD +  C P  +                   CP  C   A+C +      C C +G  G+   FC               S C   +QC      + C C   Y G    C      S +C Q+  C+N  C             C     C   AICK   +  +C C  G++G+  + C             +  C    C         G+N    C+   +  +C        C P F G             +C  NL       +  C   C  NA    V  +  C C +G+ GD F+ C                 S C PNA+C        C C  E+ G+ +   R EC     CS   S C+  +C    PG+ G    C        + + ++ S  C CL GY GN                  P+  C   I Q        L P  +   NP C+P PC P + C  V G  +C+  +  +G    CR   EC   +DC Q                        +L  Q QK    C G C  +A C +  N    C C PGF GD    CT           TEK G  C     G   +C+ +      S      GR   C    E +    C      +N +C    CI  C  ++VC   K    CEC+PG  G+ F  C                N S C   A+C ++ G   C C   Y GD    CR E  C  N DC D ++ CI                  N+ C    C   C   A C        C C  GY GD         ++   P+ CK S    Y   +C+   +S  +C+C  G+            + ++         C+   C   C  S    A C +      C C P   G+  SGC               S C  N+ C +      C+C  G+ G    CRPE  C  N +C + L  C Q                    +C+   CP  C  NA+C  + +N  C C  GY G  L          P +  S   +     P++ C   ++    C C  GF+              ++N  C+  +          C   C  +AIC       TC C PGY GD   SC    V             C  N+ C        C C++ FI    NC+P  EC ++ +C  P K C+    +   Q TC    I          CT+K H        +C C     GD  + C R             P  C + +PC    + CQ+  ++    C C+  F     +C+PE C +N  C P   C + KC   C G        +C   + CH   +  +  C C+ GY G+  V  T+ +        DR+                                  CG+N+ C  G C C++ Y  +     C P   C    DCP            + K CM  +   P          CP  C N A C       VC C  G++GD   NC    V     I  CSPS                      C  +S CRD N           C C  GYI        P  C  +C  + EC   Q           NK CV+P          C+V N        P     P + C+  P      V           C+P     PC  N+ C    N  VC C P++ G              C+    C+ +   + CP      ++C    +  SC CP+GY        +   +   K C   PC PNA C+       C C   + GN       +C+ +S C            +P  G    N+ C  V   +  +C+C  GY                           SC  ++    + +++  +P  C A+  C+  N        G   C C   F      C  K EC VN +CP+ + C   +C  P
Sbjct: 8366 AECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKCSSPCQCGAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNPICYCPKGLTGNPFKNCIPEGDECTPNPCGPNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPC-DPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICDSSRHPVCYCPDNKIGNPFRLCDKPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDADC-PNSKACMGYRCYDPCPGACGQGAHCQVEEHHPV------CSCNSGLTGNPGIRCYALDHPKKNPCVPSPCGRNSECKLLNNRAVCSCIPGYLGD-PQSGCQPECDINSDCGDTLSCINHKC----------VDPCAGA-ICGINAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGPHDVCSVYGDGVALCDPCFGPNAQQNPRC-----RPECVGNSDCPFDRACLGQRCLDP--CPGSCGRNAICNVYEHNPVCACPTGLFGNPYEQCTTKSVVETP-----PQPSCA-------------KLHCGANAECKRQHSGLACVCRKGYFGDPHIGCR--PECVLNSDCPAEKACLNSKCVEACTGVCGVNAVCRVVNHAPVCICAEGYSGDASIACNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQPECVVSSECAPNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFEGDPFVACSPIQDPGRDIPVPKNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSDKAC--INEKCQNPCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYP-NPCAENAVCTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRDPCTAACGANAECTVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFNAKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVINQDCPSNRACIRQRC----EDPCIGI--------CGFNAVCSTQNHQPKCSCIESFEGDPYTACKMREIVVLDPPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCR--PECVQNSDCP--------------NNRACINMKCRDPCANACGFNAICRVAHHQPVCSCEPHLTGNPLRACVERPSNMYLPLPKDPCRPSPCGLFSTCHVVGERPVCACLPDYMGAPPNCKPECMTSAECPSDRACINQRCKDPCPGTCGYNARCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIVPPNPCVPSPCGPNSQCQVSSSGAVCSCVTNYIGRPPGCRPECSINSECPARMACINARCADPCIGSCGNNALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALCEERNQAAACKCLPEYFGDPYVECRPECVINSDCPRSRACVNQKCVDPCPGMCGHNALCAVFNHAPNCECLPGYTGNPIVGCHIVPESPRYPD--PIVPENPCQPSPCGLYSNCRPVNGHAVC------------SCVPSYIGSPPNCRPECMSSSECAQDKSCL---------------NERCKDPCPGT---CGNNALCRVVNHNPICSCSPGFSGD------------PFVRCFPQEKRPPITHD------------RIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTS---DSEC-PGNLACINLRCRDPCVGTCG----IQTTC--------LVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRACLNNKCRDPCPGVCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVCSCVTNYIGTPPACRPECSVSSECAQDRACVNQRC----------ADPCP--GTCGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPC---------GRNS--QCRVVGETGVCS-------CLPNFVGRAPNCRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGCNPQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCRPECVVNSDCSRDKS-CVNQKCVDPCPGVCGLNAQC--------RVSNHLPS--CSCLAGYTGN------------------PSSACR-EIPQ--------LPPPPERDENP-CRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRP--ECIISSDCAQ------------------------NLNCQNQKCVDPCPGTCGIEARC-QVINHYPACSCAPGFTGDPFNRCTKIL---LEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNC--RPECLSSADCPANLACVNQRCS-NPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAICRERNGAGSCACLPEYFGDPYSGCRPE--CVQNDDC-DRSRACI------------------NNKCQ-DPCPGACGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPY--SQCL-DTNSHAVCSCLEGYIGAPPS---CKPECVVSSECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPE--CTNNDECQNHLS-CQQE-------------------RCVDP-CPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECR-ERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKP--ECVVSAECA-PEKACVHKKCVDPCQHTCGIRAI----------CTTKNHS------PICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASC-VPSPCGPN-AKCQIVGNSP--ACSCLPNFIGAPPRCRPE-CVLNSECGPTEACINQKCADPCSG--------SCGFEAKCH--VLNHLPICNCIEGYEGDPFVRCTKKE-------EDRSPPPPNDPCNPN----------------------PCGQNADCFAGECRCQNNYQGNAY-EGCRP--ECTLSADCP------------RDKACMRNRCVDP----------CPGICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIEACSPS---------------------PCGSNSQCRDVNG-------HAVCSCLEGYIG------APPQCRPECVVSSECSALQACV--------NKKCVDPCAAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSP----PQDPCVP----SPCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPECIINPDCQSTQACINNKCSNPCPESCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAV--NHVPNCVCNDGYTGDP---------------------FASCRRVEVTTPSPVSDPCIPSPCGANSKCRVAN--------GLAVCSCMETFIGAPPNC--KPECTVNAECPSNRACHKFRCANP 12038          

HSP 4 Score: 201.83 bits (512), Expect = 1.350e-50
Identity = 998/4020 (24.83%), Postives = 1384/4020 (34.43%), Query Frame = 3
Query: 2109 FVGSGYECREEVNCDIKCHENAS------CVNGYCKCNR-----NLIGDGINSCFDCLKCNTEADCSPYENR--CYCRPGYTGNGFTC--IKSCDKICHKDALCQNSRC---------ICKPNFEGDGVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANHAICTVEN---TCQCRKNYYGN-PLEKCNIDCSKCHTDSDCD--------KTNGYCKCRYGFFGDGFTCN-----KTCCVEKCHEQAQCV--DG--KCLCKPGFSGDGVETCFHCSQCDSNAICDQNNK--------ACICKSGF-----------------------------------EGNGINCLRAINCKQ-----KCHKQARCL----LGKCICNKGLNGNGVEYCFNCTSCH-----LNAKCIPRQNT--CECNSGFHGDGIQ-CKLLPLCTPACHP---QASCING----NCKCNNNLIG--DGISSCFDCD---------KCSMNARCDVSNQRCICQPGYEGNGIKCV-----KTCFQSCHKLAVCKEGT----CKCSNGLTGDGVNFCFNCS----LCDKNAKCLINEEKCECMERFEGDGFT---------CQDKVDCS------SRCGENAFCYNG----TCKCKLGFQGNPLEHCFDCRVCHYPAY--------CDIPNRKCIC------ITENDIFSRTPCSFSCHPNAKC-------IKGRCRCLSNLIGDGTTYCFNCSSCARNSDCKPE--QQTCTCKRGYVKD---GNNCSIISA-RCHPECGVNAQCINGK----CECLAGLQGNPFQQ---------CFDCKRCSQFADC--DPW--NERCVCQSGYIGNGFT--CTKIINCVTK-----CHVNGFCEN----QECKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVK-----GKCECLPGLRGDGVQSCFDCSICDNNT----------VCYPDQEKCVCNPGYYGDGTT--CFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADIC-RPTCGENAICVNG---QCQCQSGLQGNPLKHCFDCRPCH-------SFAVCDVENRRCICQSGFEGDGRNCKKIKEC-SPK--------CHRNAVCINQNCVCIPEYIGDGINFCFNCSS--CDRNADCEP--HNNRCTCYQGFTGNGLTCNAIELKCEPSCGENAKCV----NGKCECLPGLQGNPL-------QHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRHCICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNG----KCECLPGLQGNPMQHCFDCKK-------CHKFADCDVWNK--KCVCKNGYFGNGYM-CTPINGC-NLKCNENALCVNQ----KCICLPGFIGDGI--------KFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCT-SKCHKNAKCLKGNCECLPGFVGDGIQVCFNCST----------------------------------CDKNANCFPYQER--CVCKPRYSGNGENCVKIG--PESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNG-----EQCVENIEGSS------PKCHSNALRVNQQCICLPGFIGDGKNFCF-DCSTCPPNSDCLPQEQ--RCIC-----------------KKDYFMNDTQCIHT--------GRTPQCVP-----KCHHYASCV----QDKCECLPG-FIGDGIKFCFKCSS--CDPNADCVPEQQKCVCKTGFYGNGNKCDKIESTC-----EPPCAPGGFC----NNSKCQCNSGLKGDGV--TSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGFRCYPVILECPK---CHYRAQCVIGKCQC-KNGLQGDGI--NFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECS---PKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCA---QGFTGNGITCKAIDPSCNTNCHKDALCFKD-SCICKSGLSGDGKNYCFDCKRCDQNAICRPTEQRCVCK-PEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCC----RCKNGFFGDGFS---FCFNCSNCSPNADCFPHLSKCQCKEEFTGN----GFICQR-KECKPACSE-----ATSLCIKNQCFCRPGLIGDGYNCLDC-----RKCHEKATCN--IRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDP-ISKLC-INPNCQPPCHPKAVCVKGKCICNRNLVGDG---------YQCRAPEECNNDADCVQFQEVCRK--DQSS----------LKKICKCKDG--LVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTT-CTDCSGCDKNAICTEKQGC---ICKSGFIGDGRQCIVLNECADNSDCTTIRGRAS-ECIRSSEGIQKCQCSQ----------GFKL-LNGKC-EPLSCIYPCAKNAVCIYQK----CECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDGIICRLPDECKSSLDCKYE-------------------NQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNP-----------------------KCHRSALCVI----GTCKCPPSFKGNGYSGCFDC-----SKCHANADCDESKG---CTCKPGFEGNGCY--CRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNG--KCIILGCPVQCDKNAVCLSN----NCVCKTGYSGTGLN----CKP-NDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDN----------GKCSPKECQPK-CHMFAICITQT----CYCVPGYFGDGIKSCTSCSVCH----------KNAQCLPDRGCVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCP-INC--HPLAQCKSGKCVCQGELQGDGIRTCFKCSSCHARAVCSMD-GC----KCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPG--VDKGKKCQCKPGFSLENSLC-SPIACRPKCGKNSQCQL----GVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNFAYCRQ-KVCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYI-------KFNNSLCYP--------IPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCI-PINCYQPCHKNAYCNIG----VCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCDPNAVC-------VLG---ECICKVGFTGNGLQCMPTSKCNPLSG-CSD----TNSVCIQVPPTNYYDCMCKPGYIKSSNLS-ICK-PIV---CEPSCHPKAACIIGSCICMKPLIGNGITECKLPDECS---ASVHCKNKNAFCKNSTEG-QMKCICKHGFQLENSKCISKQECRVNVDCPTRKICVNSKCICP 12290
            F+G+  E  +E+ C   C ++ +      C+NG C CN      N +    N C     C+  A C+       C C PGY GNGF C  I  C          +N+ C          CK  +EGDG   C D  +C     C P                                  +A+CT      TC C   Y GN P  +   D  +C   + C         + +  C C  G+ GDG + +       C    C   A C+  DG  +CLC  G+SGD +  C    +C +N  C    +         C C SGF                                    G G+ CL    C Q     KC   A+C+      +C+C  G  G G  +C N   C       NA C     +  C C   + GD  + C  +  CT    P    A C N     NCKC     G  D   +C   D          C+ NA C + NQ C C  G+E  G  CV     +T  + C   A C        C+C  G  G               C  +A C  ++ +  C+     DG+T         C D  +C         CG+NA C N     TC C  GF G+P   C D   C   A          ++P     C      I + D   R     SC  N  C          RC C    IG+   +     +C  ++ C     Q  C C  GY  +      C+ I   R +P C   A C N      C+C  G  G+P+++         C D   C+    C  D +  N  C+C+ GY  N     C  +  C  +     C +N  C+N     EC+C  G  G+    C  C+T             C C   +   G  C +L+  +  +AC   A+C+        C C  G +     SC D   C+             V  P    C C  GY GD     C L  + C           +R+C  NE+ +  G                     EC C   +  D +        C R  CG NA C      QC C++G +G+PL  C D   C        ++ V      +C+C   + GD      I E  +PK        C  N  C+  +CV               CSS  C  NA CE   H   C C  G+  NG   + +    +  CG+ A C+       C+C  G  GNP          C   + C +   C     K  C+    G G TC   NG               CIC P F G+    C             P EQ                    +C PGCGENA C  G    +C C PG  GNP + C    K       C   A+C        C+C  G+ GN Y+ C  ++ C N  C  NA C+N+    +C+CL G  G+          KFC D + C  N       +  +C + Y   +  C       LC+ + C   A C  GNC C  G++GD       CS                                   C  NA C     R  C+C   + GN  N +++G  PE   P +  K               S +GIK C N  S     +C P++   +CK   +G+      E  V N   SS      P C S+A        C P  +G  K     D  TCP NS C+ ++   RC C                 +K +  N  +C  +         +T  C P     KC   A CV    Q +C+C PG F GD       C S  C  N DC P Q               C+++  TC     E  C     C    + + CQC  G KGD +   +C     C     C PS    IC +  +G   +C P+ +   K   C    QC  G   C  N +   G+  N C N   C  NA+C     K  C    R    +    D C+    KC  +  C  + C     Y G     C N   C     C   +N+CV A        +G+ C  ++  C   C  +  C +D SCI    L     N C     C  NA+C   +    C  PE    GF+     +  C        VRV   C    +C +G    G      C   ++C+    C+  + +  C   +T N    G IC   + C+P C        T LC+  +C C  G IG  + C D      + CH  A C     + +C C  G +G+G+   S   C+Q   C +P++  N       C      DP +  +C IN NCQ   H      +  C C    +GD           +C    +C  D  C      C K  D +S           K  C C +G  LV D+     +   +  CHS A C       S C C  G +GD +   C D + C  +A C     C    C+S        C   N C  N++C     +A   C  +S G    +C            G K  L+ KC +P S    C   A C  Q     C C  G  G+  + C     C +   C   +G +CSHG             CS N DC    ++C+     V +  CKS+              S C ++  C N +C          + CR   EC     C  +                   N ECVAR   +  C CK GF                     A SGC  I+C                          C  +ALC        C C P F G+    C        + C   A C  ++G   CTC PG  G+     CR   +C+ N DC  P   C +                 TNG  KC  +   +QC  NA C+       C C++GY G   +    CKP    C    DCP           Y    VC P    D           G+C     QP+ C   A C+ Q     C+C  G+ GD  K C    V            +++ CLP    VC +D            EC  NE C      C+L   + N           + + CL  +C   CH +  C      C +        C  P    ++NPC    + C +++   R  C C+           P P P + C   P  +C+  +        G+G+  CF+ S C  R +C+ D GC    +C  G      +C+ +++C +   C   N  C PG   D+G    C P  S     C  P A    CG N+ CQ       C+C +G   + N     P   C    DC  SN  C Y G  QGK   CR      +  +C+  TC   C+    C Q ++C+ R+   G           C  +  C+    C           + C+  + CR    C    A C +    ++CQC   ++       +     C+P          C  +C R E+C  GQ QC  G   N    C     C V     C+     C+    +   C   +  +N  G C  P    + C +NA C +     +C C   Y G+    C +   C  D+DC                         N +C   KC  PC     C       V+G   +C C   F GN     PTS+C PL G CS      NS C +VP    Y+C C  G I  ++   +C  P+V    +  C   AAC +         + N   EC  P++     A V C          T G ++    + G++    +    ++C  + DCP+ K C+   C  P
Sbjct:   81 FLGAD-ELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGYGGCNCVDKDENECKQ-RPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGP----------------------------------NALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAEC-IENQ-CFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNEAYCVCE---DGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANP-CAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNT-----------PECQCQSPYKLVGNSC-VLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCA---------ADRECAANEKCIQPG---------------------ECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLLGCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCV-------------SPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDG-DCVSQCQDVICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVCGIGATCDRNNG--------------KCICEPNFVGNPDLICMP-----------PIEQA-------------------KCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCN-------ERVECPEGYSCQKGQCK-----NLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSN-LQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCS---NVVCGPNE---LCKINPAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDA-NCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQM--------------CNRMTHTCFDVCDEESCGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGC-AAGTCHPSA---ICEVTPEGPVCKCPPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDN--ACGSNAECKVINRKPVCSCPLRFQPISDTAKDGCARTISKCLTDVDCGGALC-----YNGQCRIACRNSQDCSDGESCL--KNVCVVACLDHSQCASGLAC--VEGHCTIGCRSNKECKQDQSCIENKCL-----NPCQSANSCGPNALCSIDQHHSQCSCPE----GFEGNPTPEQGC--------VRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAVGERCYQQVCRKVC---YTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGY---SQPGCSQPRQCHKPDDCAN----NLACIHGKCTDPCLHTVCGINANCQSEGH------EALCSCPAGFLGDPNDTGVGCFKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINE-CLSQPCHSTAFCNNLPGSYS-CQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRS-------PCERQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQC--AQGSICSHGI--------CSPLCSTNRDCIS-EQLCLQG---VCQGTCKSN--------------SSCPQFQFCSNNICT-------KELECRSDSECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVAR-SHAPDCLCKEGFFGD------------------AKSGCRKIECTSDDDCSNDKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDC-PPHAACTK-----------------TNGVAKCRDVCAQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCP--------TNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMCLP----VCHNDL-----------ECASNEKCL--KGSCMLTCRVDN--------DCFLGHVCLHNKCVYGCHVDDDCSASE-SCRND------KCVNPC---LENPCGPN-AACSVSN--HRASCSCLESMV-------PNPTPQVGCVRSPPLECRENRDC------GNGL-ACFE-SVC--RPLCADDAGCLTNERCQQGVCK--PLCRHDNECGHGELCLGLN--CVPGCRSDQG----CPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCLCPEGLDGNANVACKVPRIACGRNEDC-QSNQLC-YAGSCQGK---CRNDQNCLADERCMRGTCRTVCNTDEACAQGQICENRMCQTG-----------CRTDLSCATDEACV---------NKKCQ--NPCRTPGQCGQC-ADCLVVNHGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQ-QCARGKCRNK---CGPKRQCTVGQ--LCE--RGACIAGCKSNGDCAADQSCVN--GKCSDPCANEKACGRNALCTVSEHRMLCYCPDGYEGEPSKECVQFE-CRVDTDC-----------------------DSNKRCDQGKCRNPCLEYGACGTNAQCRVVGRKAQCSCPPDFFGN-----PTSECRPLEGGCSSKPCGENSKCTEVP--GGYECACMDGCIGDAHQGCLCGGPLVNACRDQPCGLNAACHV---------LENNQAECYCPEDFPNGDAYVQCYLTTPKQDCRTLGCEVGGCVRQGYEYVCQQ--DTEQCYSDTDCPSEKSCLQGHCSDP 3644          

HSP 5 Score: 201.06 bits (510), Expect = 2.424e-50
Identity = 930/3866 (24.06%), Postives = 1289/3866 (33.34%), Query Frame = 3
Query: 2091 CKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGD-GINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKSCDKICHKDALCQNSRCICKPNFEGDGVNYCFDCSKCHKLAQCHPK--TGNCTCRPPYVGDGVSECETFLPKGN------------CFPPCAN----HAICTVEN---TCQCRKNYYGNPLEKCNI-----------DCSKCHTDSDCDKTNGY--CKCRYGFFGDGFTCNKTCCVE-KCHEQAQCVDGKC-----------------------LCKPGFSGDGVETCFHC------------SQCDSNAICDQ--NNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKC--IPRQNTCECNSGFHGDGI-QCKLLPLCTPACH-----------PQASCIN----GNCKCNNNLIGDGISSCFDCDK-CSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKEG----TCKCSNGLTGDGVNFCF-------------NCSLCDKNAKC--LINEEKCECMERFEGDGFTCQDKVDCSSRCGENAFCYNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICI-----------------TENDIFSRTPCSFSC-----HPNAKC-IKGR---CRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQ---------------------------TCTCKRGYV-----------KDGNNCSIISARCHPECGVNAQCINGKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCVCQ------SGYIGNGFTCTKIINCVTKCH-VNGFCENQECKC-LPGLIGDGINFCFDCSTCDINAFCEPFNERCVCS--VGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSICDNNTVCYPDQEKCVCNPGYYGDG-TTCFLFSQLCTE--KCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQ--ECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCFDCRPCHSFAVCDV--ENRRCICQSGFEGDG-RNCKKIKECSPK------CHRNAVCINQN----CVCIPEYIGDGINFC-------FNCSS----------------CDRNADCEP--HNNRCTCYQGFTGNGL-TCNAIELK--------CEPS-CGENAKC--VNG--KCECLPGLQGNPLQHCFNCK-RCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALC--VNRHCICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPG-CGENAKCV----NGKCECLPGLQG---------------NPMQHCFDCK-------KCHKFADCDVWNKK--CVCKNGYFGNGYM-----------CTPI--NGCNLK-CNENALCVNQKCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGN----CECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICK-AGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFD--------------CSTCPPNSDC--LPQEQRCICKKDYFMNDTQCIHTGRTPQCV--PKCHHYASCVQDKCE--CLPGFIGDGIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNG-NKCDKIE--------STCEP-PCAPGGFCNN----SKCQCNSGLKGDGVTSC-------FNCSK----------------CDVNAKCFPS--VKKCICVIGYKGDGFR---CYPVILECPKCHYRAQCVIGKC----QCKNGLQGDGINFCM--------NC-------SECDKNAQCFP--------------------NFSK-CECRQGYRGDG-------------KNCVKIDECSPK-CHQNAVCIN----SNCHCLPMYTG---NGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALC----FKDSCICKSGLSGDGKNYCFDCKRCDQN----------AICRPTEQ----RCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGDGFSFCFNCSNCSPNA--DCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYIGNGF----ECISITSCTQSSDCIRPN------EICNVAISQCICEANSFLDPISKLCINP--NCQPPCHPKAVCVKGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRD---------LQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTC-----------TDCSG--CDKNAICTEKQG---CICKSGFIGDG-----RQCIVLNECADNSDCTTIR---------GRASECIRSSEGIQKCQCSQGF-----KLLNGKCEPLSCIY-------PCAKNAVCIYQK----CECLPGLVGNG---FIKCTNCSECHKKALCHDQRGCV--CSHGYSGDGIQCRIEDQCSLNSDCTDPNKICIT--STDTVKRC------VCKSSFISSNSGCVPLTCL--SKCHKYANCENGV--CKCILGYVGDGIICR----LPDECKSSLDCKYENQECV-------------ARLDSSLMCTCKSGFQWKSEKSSLVNNQMM---IKRSMRAYSGCVPIDCNPK-CHRSALCVIGTCKCPPSFKGNGYSGCFDCSKCHANADCDESKGCTCKPGFEGNGCYCRPEDKCKFNSDC--NDPLKICVQSPDTSRNCV--CKPGTTPSTNGKCIILGCPVQCDKNAVCLSNNCVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICITQTCYCVPGYFGDGIKSCTSC-------------SVCHKNAQCL---PDRGCVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCE----GGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQG---DGIRT-CFKCSSCHARAVCSMDGCKCM-PGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGV--DKGKKCQCKPGFSLENSLCSPIACRPK-CGKNSQC----QLGVCVCKDGY--SPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNFAYCRQK----VCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFI-NKFGYCIPINCYQ---------------PCHKNAYCNIGVCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCD----PNAVCV----LGECICKVGFTGNG-LQCMPTSK 11864
            C C P ++G    CR E      C  N +CVN   +C+   IG  G++S    +K         +   C C PGYTG+ F+      +I   D     +R  C P             S C   A C  +   G+C C P Y GD  S C     + +            C  PC      +A C V N    C C   Y G+P   C++             S C   S C  TN +  C C  G+ G   +C   C V  +C +   C++ KC                        C+PG +GD +  C               S C  N++C Q  N  AC C +G+ G    C        +C     C   +C          V+ C    SC  NA C  +     C C  G+ G+ +  C+L+P  TP              P A C      G C C++   G+   +   C + C  N  C  + Q C        +  KCV  C   C   A+C       TC C  G TGD    C              N S C  N+ C  + N+  C C   F      C+ +   S+ C     C +  C        +P +H      C   A C   N   IC                    ND  + +P   SC      PNAKC I G    C CL N IG     C     C  NS+C P +                             C C  GY            +D +            CG NA C  G+C C    QGN ++ C     C+  ADC P ++ C+         G  GN   C +++N +  C  V G+  +    C +  ++ D I      S C  N+ C   N   VCS   G+ G   +C     ++ +  C     CV  KC   P     G+++   C + +++ +C        C PG  GD    C +   +     K  P   CV                     + C P+++C  D+    C C+ EF G    C     I  P C     C+N +C        NP         C + A C V      C C +G+ G+    C   +E  PK      C  NA CI +N    C CI EY G+    C        +C +                C  NA C    H   C C  G+TG+   +C  +E+         C PS CG N+KC   NG   C C+    G P     NCK  C   A+C   N+ C        +   C   N C   C  NA C  +N + IC                SCP +    P   +C         G K +P+   C+P  CG N++C        C CLP   G               +P Q C   K        C   ++C V N    C C+ G+ G+ ++             P+  + C+L+ C  NA C N  C CL  + GD    C     C  +++C P K          +N+K   P      C   C +N++C   N    C CL G+ GD    C + +   K+           C+P   G    C   G   +C                 + G        C   S CS+   CV    KC+    G  G   +C               +  N  C C  G+ GD    C+                S C PNS+C  L     C C   +      C      P+C   P+C    +C++ KC   C+     +   F  +C+  +        Q  C C  G+ G+    C K +        + CEP PC     C        CQC     GD   SC        +C+                 C  NA C  +  +  C C IGY GD +R     P  L          C    C    QC+  L G  +  C+        NC       +EC  +  C                      N S  C+CRQG+ GD                 V+ D C P  C  N+ C N     +C CLP + G   N    C   A+C +N  C                 I  + IDP C  +C   A C        C+C +G +GD  + C      +            + C P  Q     C C  EF GD +           + C P  V  ++C R K        + C     C  NA  D   H+  C+C E   G+ FI     C P       + + N C  RP   G    C   R+ +++A C+       CLP +IG       EC S + C  +  C+           C V  +  +   + F     +   NP   CQP   P    V     C  +  G   QCR           V     C   ++ + +   C+   V           +  +C  P C G C   A C   S+   +C+C  GF GD    C           T CS   C  NA+C ++ G   C C   + GD       +C++ ++C  N  C  +R         G  + C +    +  C C  G+     +  N   EP    Y       PC  N+ C        C CLP  VG       +CT  SEC     C +Q+ CV  C+    G+   CR+ +   + S        CI+  + D   RC      + ++        C+P  C   S+C       NGV  C C++ ++G    CR    +  EC S L C   NQ+C              + ++ + +C C  G+         + N       K             CNP  C  +A C  G C C P +KG+ Y  C    +C  N DC   + C        N C       C  N+ C  N+ + IC      S N    C+P         C    C        V  +  C C   Y G+   C+P  +C  NSDCP  +  C+ MK  +      PG    N  C+    +P C            C  G  G+   SC                S C  N++C        C C  +F+G   NCRP  EC  N +C   N+ C                   IN  C+   C   C +NA C       MC C  GF GD                   FS C    D+   V             C P PC +N     +  +G C C  +  G   DG R  C   S C +   C    C+   PG  G    CQ  +              C  G   D    C+       E    +P  C+P  CG NSQC    + GVC C   +  SP      C+    C ++  C   N KCV                          + CPN C   A CR +    +C C  GF GD    C+      P  +    L    P P              C  +S CR+        + +  C C   Y      L  P  C  +C  N EC        P      N+ C +P       P SC   L       N   IC C  G+I + F  C P    +               PC  N  CN GVC+C P+Y GD  T C+ +  C+  +DC                         +  C+  KC+ PC      NA+C     +  C C  G  GN  +QC P  K
Sbjct: 10831 CSCLPDYLGRPPNCRPECLSSADCPANLACVNQ--RCSNPCIGACGLHSVCTVIK---------HRPACECVPGYTGDPFSGCAIVQQIAPPD----ETRNPCNP-------------SPCGANAICRERNGAGSCACLPEYFGDPYSGCRPECVQNDDCDRSRACINNKCQDPCPGACGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPECVVSSECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQERC----------VDPCPG--SCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDC-TAVQAC--------SRFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCV-------DPCQH-----TCGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSPACSCLPNFIG-APPRCR--PECVLNSECGPTEACINQKCADPCSGSCGFEAKCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCR--PECTLSADC-PRDKACMRNRCVDPCPGICGNNAVC-EVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSSE--CSALQACVNKKC-VDPCAAACGLEA--RCEVINHSPICG-------CPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVP--------------------SPCGPNSICKNDRNGPVCQCQPEFFGSPPNCRPEC-IINPDCQSTQACINNKC-------SNPCPES-----CGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAVNHVPNCVCNDGYTGDPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPP----NCKPECTVNAECP-SNRAC--------HKFRC--ANPCAKTCGLNAKCEVINHNPIC----------------SCPLDMTGDPF-ARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCRPECVVNTDCSPDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQDPCDLQPCGSNAECRNGICSCLADYQGDPYTGCR--PECTLSTDCAPTKA--------CLNKKCVDP------CPGVCGQNSQCDVSNHIPICSCLQGYTGDPFVHCRHETPVAKDP----------CQPNPCGPNSLCHISGQGPVC------------ACQPGMLGSPPACKPECIVSSECSLHTACV--NRKCVDPCPGACGQFARC-------------QVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIGTPPSC-----RPECSINPECPPTKACIRQKCSDPCV-----NACGFNARCNVAN-------HQPICTCDVGYTGDPFTGCQKEQERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDHFGDPYQSCRPECVRHSDCASNKACQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEPPQLPARVTEPSQPCRPSPCGPNSQCRE-LNGQAVCSCLELYIGLPPNCRPECVLSTECPTDKACISQRCQDPCPGTCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPPPVIERVERDPCLPSPCGLNSQCRNVQGVPSCTCLPDFLGAPPNCRPECTISAECPSNLAC-----------------IRERCIDP-CPGSCGYAAECSVVNHTPICVCPAGFTGDPFSSCRPAPPPEPTQSEYVDPCNPSPCGPNAQCNAGICTCLAEFHGDPY-----------SGCRPECVLNSDCPRDKACHSSKCVNPCPG--TCGENAICDVINHIPMCRCPERTAGSAFI----RCSPV-----QITVSNPC--RPSPCGPNSQC---REVNQQAVCS-------CLPSFIGAPPSCRPECTSNSECAPTQACLNQRCGDPCPGTCGVGANCAVVSHSPFCTCPERFTGNPFIRCQPQIEPPVRDVAPVDPCRPSPCGPYSQCRP----------VGEAPACSCVETYIGRPPNCRPECVTSSDCSSQLACVNQKCVDP-CPGRCGLNAECFVVSHA-VQCICQQGFNGDPFVQCKPEIAYENEIRTPCSPSPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCRPECMLDSDCPSNRACQQLRCQDPCPGTCGLNANC-QVVNHLPTCTCLTGYVGDPYRQCNRLPEPPQNEYVNPCQPTPCGPNSQCRVSNEQAVCSCLPLFVGTPPSCRPECTISSECSADRACVNQK-CVDPCAADTCGNNAICRVRNHSPICS--------CISGYTGDAFTRCFLIPPPIIETKDEPLRDPCIPTPCGPNSECRNI----NGVPACSCLVNFIGQAPNCRPECTINSECPSQLACI--NQKCRDPCPGACGQNAVCSVINHTPLCACIDGY---------IGNPFTNCNPKPPEPPAPPVADDPCNPSPCGANAQCRNGQCSCIPEYKGDPYVSCR--PECVLNTDCPRDRACV------RNKCIDPCSGTCGVNALCEVNNHIPICRCPEQMSGNAFFECRPVPPAKIQNPCQPSPCGPNSQCRVVQQTAVCSCLANYVGSPPQCRP--ECVTNSDCPA-DQDCQNMKCRDP----CPGTCGFNALCNVVNHRPFCS-----------CPTGMSGNPFVSCQQLIIRDERPQNPCQPSPCGPNSECRVSGDSPSCSCLPEFVGAPPNCRP--ECISNSECPT-NQAC-------------------INQKCV-DPCPGLCGQNAICRVFSHSAMCLCDGGFTGD------------------PFSQCSPIRDSPPEVL----------QPCNPSPCGVNAKCEERGGAGSCQCLPDYFGNPYDGCRPECVLNSDCPSNQACVNQKCRDPCPGTCGQNAECQVVNHLA--------TCNCLVGYTGDPYSICRITVNEPPERVYVNP--CQPSPCGPNSQCREVNEQGVCSCLPEFIGSPPACRPECTSSSECAADKAC--VNRKCV--------------------------DPCPNVCGQQAECRVRNHNPICTCLSGFTGDPFTRCYR-QPPPPPVVEREPLDPCVPSP--------------CGANSQCRE-------IHGTPSCSCLPQY------LGTPPNCRPECSINAEC--------PSHQACINQKCRDPC------PGSCG--LNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLPPEDPCNPSPCGSNTQCNNGVCSCLPEYHGDPYTGCRPE--CVLHTDC-----------------------DRSRACVRHKCVDPCPGTCGTNAICEVLNHIPNCRCLEGMQGNAFIQCSPVPK 14207          

HSP 6 Score: 199.904 bits (507), Expect = 4.772e-50
Identity = 998/4130 (24.16%), Postives = 1377/4130 (33.34%), Query Frame = 3
Query: 2082 ISKCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGDGINSCFDCLKCNTEADCSPYENR--CYCRPGYTGNGFTCIKSCDKICHKDALCQNSRCICKPNFEGDGVNYCFDC--SKCHKLAQCHPKTGNCTCRPPYVGDGVSEC--ETFL----PK------GNCFPPC----ANHAICTVEN---TCQCRKNYYGNPLEKCNI---------DCSKCHTDSDCDKTN--GYCKCRYGFFGDGFTCNKTCCV-EKCHEQAQCVDGKC-----------------------LCKPGFSGDGVETCF----------------HCSQCDSNAICDQ--NNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKC--IPRQNTCECNSGFHGDG-IQCK--------LLPLCTPA-CHPQASCIN----GNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKE----GTCKCSNGLTGDGVNFCFNC--------------SLCDKNAKCLINEEK--CECMERFEGDGFTCQDKVDCSSRC--------------------GENAFC----YNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPC-SFSCHPNAKC--IKG--RCRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCINGKCE--CLAGLQGNPFQQCFDCKRCSQFADCDPWNER--CVCQSGYIGNGFTCTKIINC------------------VTKCHVNGFCENQECKCLPGLIGDGI---------------------NFCFD-CS-TCDINAFCEPFNER--CVCSVGFTGNGK-KCSILAPITCKRACHKKA-------KCVK--GKCECLPGLRGDGVQSCFDCSICDNNTVCYPDQE----KCVCN-PGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGD--GVNFCFNCTSCHPDALCFP--DQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCFDCRP--CHSFAVCDV--ENRRCICQSGFEGDG-RNCKKIKECSPK---------CHRNAVCINQ----NCVCIPEYIGDGINFC-------FNCSS----------------CDRNADCEP--HNNRCTCYQGFTGNGLTCNAIEL----------KCEPS-CGENAKC--VN--GKCECLPGLQGNP---LQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALCVNRH----CICLPGFTGDGTRFCFD-----------------CSSCPKNSNC--LPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDC--KKCHKFADCDVWNKK--CVCKNGYFGNGYMC--------------TPINGCNLK-CNENALCVNQKCICLPGFIGDGIKFCF-DC---SACPANSNCVPEK---------------------KECKCAKDYFMNEKI-CSPIKQPVLC-----TSKCHKNAKCLKGN----CECLPGFVGDGI---QVCFNCSTCDKNANCFPYQERCVCK-PRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKN---FCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGDGIKFCFK-------------CSSCDPNADCVPEQQ--KCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKC--FPSVKKCICVIGYKGDGFR-CYPVILECPKCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNA--QCFPNFS------KCECRQGYR-GDGKNCVK---IDECSPKCHQNAVCINSN----CHCLPMYTGNGVSFCFNC------------------AQCDANAICKP--DENLCVCAQGFTGNGITCKAIDPSC--NTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKRCDQNAICRPTEQ--RCVCKPEFRGDGF-QC---------ALNLKTTCQ-NDCHPNAVRVNNCCRCKNGFFGDGFSFC-------------FNCS----------NCSPNADC--FPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYIGNGF----ECISITSCTQSSDCIRPNEICNVA-------ISQC-ICEANSFLDPISKLCINP--NCQPPCHPKAVCVKGKCICNRNLVGDGYQCRAPEE---CNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDC------------SGCDKNAICTEKQG---CICKSGFIGDG-----RQCIVLNECADNSDCTTIRGR---ASECIRSSE-----GIQKCQCSQGF-----KLLNGKCEPLSCIY-------PCAKNAVCIYQK----CECLPGLVGNG---FIKCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCL-SKCHKYANCE----NGVCKCILGYVGDGIICR----LPDECKSSLDCKYEN------------QECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGNGYSGCFDCSKCHANADCDESKGCTCK------PGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNN----CVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICIT----QTCYCVPGYFGDGIKSCTSCSV---------------CHKNAQCLPDRG---CVCKSDFIGDGFNCRP----LDECR-----INEDCRDP-------NKMCLLNPSMKNLQCTCKPLHILINNY--CLPKE--------------CTSKCHKNAKC----EGGMCQCLS-GFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGK----CVCQGELQGDGIRTCFK------------CSSCHARAVCSMDG----CKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQL----GVCVCKDGY--SPSVN---GLSCSPIDHCQSENDCPDSNHKC-VYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNF----AYCR----QKVCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDS---------NAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVK--QCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPINCYQPCHKNAYCNIGVCTCNPDYIGDGITSCKKKNLCLEDSDCPI----------------IGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKC-LLPCDPNAVCVLGECICKVGFTGNGLQCMPTSKCNPLSGCSDTNSVC--IQVPPTNYYDCMCKPGYIKSSNLSICKPIVCEP----------SCHPKAACIIGSCI-------------------------CMKPLIGNGITECKLP----------DECSASVHCKNK--------------NAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVDCPTRKICVNSKCICP 12290
            +  C C P F+G+   CR E     +C  N +C+   C          I+ C     C   A+CS   +   C C  G+TG+ F                  S C   P  E     Y   C  S C   AQC+   G CTC   + GD  S C  E  L    P+        C  PC      +AIC V N    C+C +   G+   +C+            S C  +S C + N    C C   F G   +C   C    +C     C++ +C                        C   F+G+    C                   S C   + C       AC C   + G   NC         C  Q  C+  KC          V+ C     C LNA+C  +     C C  GF+GD  +QCK        +   C+P+ C P A C +    G+C+C     GD    C    +C +++ C  SN+ C          ++C   C  +C   A C+      TC C  G  GD    C                 + C  N++C ++ E+  C C+  F G   +C+ +   SS C                    G NA C    ++  C C  G+ G+    CF            IP      I   D   R PC    C PN++C  I G   C CL N IG                +C+PE                C+I S     EC     CIN KC   C                 C Q A C   N    C C  GYIGN FT     NC                   + C  N  C N +C C+P   GD                       N C D CS TC +NA CE  N    C C    +GN   +C  + P   +  C           + V+    C CL    G   Q   +C     N+ C  DQ+    KC    PG  G    C + +      C P     N    C + ++ D    N C   + C P++ C    D   CSC  EFVG           CRP C  N+ C   Q            + C D  P  C   A+C V   +  C+C  GF GD    C  I++  P+         C  NA C  +    +C C+P+Y G+  + C        +C S                C +NA+C+   H   C C  G+TG+  +   I +           C+PS CG N++C  VN  G C CLP   G+P      C +   C   AD    N+KCV               + C N C   A C  R+    C CL GFTGD    C+                   S C  NS C  +     C C   Y+     C       RP C  NA+C        P  Q    Q C D     C     C V N    C C  GY G+ +                 P + CN   C  N  C N  C CLP + GD    C  +C   + C  +  CV  K                       C+C +    N  I CSP+ +  +       S C  N++C   N    C C+  F+G        C   S C  N  C    ++C    P   G G  C        C               +CL+ ++G+   +C       IE    P ++ C+      G   QC E  E  S             C CLP +IG   N    C   S CP N  C+ Q+ R  C         +C     TP CV               C  G  GD    C +              S C  NA C   Q    C C   ++GN  +  + E      C     C   KCQ            C     C  NA C     +  C C+ GY GD +R C P  ++     Y   C    C         G N    C E ++ A   C P +       + EC         K CV    +D C   C   A+C   N    C C   YTG+    CF                      C   + C+   D   C C  G+ G    C+   P C  N  C     C  + C          ++ C     C   AIC        C C P + GD F QC          + L   C  + C PNA   N  C C   + GD +S C               CS           C+PNA C    H+  C C E + GN F+    +CKP    A          C+P   G    C   R+ +++A C+       C+PGYIG       EC S + C     C+  N+ CN          +QC +   N F   + +   NP   CQ    P    +  +  C  +  G   +CRA  E   C    D V     C+ +  +  +   C   L   +  +C+ P C G C S A C   S+  + C+C  G  GD  T C               S C  NA C ++ G   C C + + G+       +C++ ++C  N  C   + R      C +++E         C C  GF     +  +   EP +  Y       PC  N+ C   +    C CLP  VG       +C   +EC     C +Q+      G  G   QC + +   L S    P      + D + RC+         S  +   C+ S C  Y+ C        C C+  YVG    CR    +  EC S+L C  E              +C + ++ +  C+C +G+      S  V               C P  C      +ALC  G C C P + G+ Y+GC    +C  N+DC  ++ C  +      PG  G    C   D     + C+ P ++   +        C+P               P  C  NA CL  N    C C  GY G   NC+   +C  +SDC       ++    N KCV                C  KC + A+C        C C+P Y G+    C    V               C  N+QC    G   C C  +F G   NCRP     DEC      +N+ CRDP       +  C ++  + N QC   P+ +  + +  CLPK                 S C  NA C    E  +C+C    +IG+     RP EC  ++ C    +                     I SKCQ +PCP  C   A C        C C     G+    C +             S C   ++C +      C+C+PG+ GN +      +C   SDC  ++ AC                   NS C   AC  +CG  + CQ      VC C      +P V         PID CQ  + C  SN  C VY+G        C           C+ + C + C N     A CR    + VC C   F G             P A C   L    P P  I DG  C   D+  I+  CR+           A C +      C C  GY       CY + C    +C  NE C+              N+ CV+P                   GF       +CR  F ++                       C C   Y G+ +  C++   C  D +C                  IG++C  +++   C+CP+G+  +     A +C L+P  P    +  EC  K+   G   +    + C+    C   N++C  +   P     C C PGY+  +++   K    EP           C    AC  G+C+                         C +   G+  T C  P           EC  +  C NK              NA C+      + C C  G+  +      K EC++N DCP  K C+N  C+ P
Sbjct: 12748 VPSCTCLPDFLGAPPNCRPECTISAECPSNLACIRERC----------IDPCPG--SCGYAAECSVVNHTPICVCPAGFTGDPF------------------SSCRPAPPPEPTQSEYVDPCNPSPCGPNAQCN--AGICTCLAEFHGDPYSGCRPECVLNSDCPRDKACHSSKCVNPCPGTCGENAICDVINHIPMCRCPERTAGSAFIRCSPVQITVSNPCRPSPCGPNSQCREVNQQAVCSCLPSFIGAPPSCRPECTSNSECAPTQACLNQRCGDPCPGTCGVGANCAVVSHSPFCTCPERFTGNPFIRCQPQIEPPVRDVAPVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCRPECVTSSDCSSQLACVNQKC----------VDPCPG--RCGLNAECFVVSHAVQCICQQGFNGDPFVQCKPEIAYENEIRTPCSPSPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCRP--ECMLDSDCP-SNRAC--------QQLRCQDPCPGTCGLNANCQVVNHLPTCTCLTGYVGDPYRQCNRLPEPPQNEYVNPCQPTPCGPNSQCRVSNEQAVCSCLPLFVGTPPSCRPECTISSECSADRACVNQKCVDPCAADTCGNNAICRVRNHSPICSCISGYTGDAFTRCFL-----------IPP---PIIETKDEPLRDPCIPTPCGPNSECRNINGVPACSCLVNFIGQA-------------PNCRPE----------------CTINS-----ECPSQLACINQKCRDPCPGA--------------CGQNAVCSVINHTPLCACIDGYIGNPFT-----NCNPKPPEPPAPPVADDPCNPSPCGANAQCRNGQCSCIPEYKGDPYVSCRPECVLNTDCPRDRACVRNKCIDPCSGTCGVNALCEVNNHIPICRCPEQMSGNAFFECRPVPPAKIQNPCQPSPCGPNSQCRVVQQTAVCSCLANYVGSPPQCRPECVT---NSDCPADQDCQNMKCRDPCPGTCGFNALCNVVNHRPFCSC-PTGMSGNPFVSCQQLIIRDERPQNPC-QPSPCGPNSECRVSGDSPSCSCLPEFVG-------APPNCRPECISNSECPTNQACIN--------QKCVDPCPGLCGQNAICRVFSHSAMCLCDGGFTGDPFSQCSPIRDSPPEVLQPCNPSPCGVNAKCEERGGAGSCQCLPDYFGNPYDGCRPECVLNSDCPSNQACVNQKCRDPCPGTCGQNAECQVVNHLATCNCLVGYTGDPYSICRITVNEPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIGSPPACRPECTSSSEC--AADKACVNRKCV---------------DPCPNVCGQQAECRVRNHNPICTCLSGFTGDPFTRCYRQPPPPPVVEREPLDPCVPSPCGANSQCREIHGTPSCSCLPQYLGTPPNC-------RPECSINAEC--------PSHQACINQKCRDPCPGSCGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLPPEDPCNPSPCGSNTQCNNGVCSCLPEYHGDPYTGCRPECVLHTDCDRSRACVRHKCVDPCPGTCGTNAICEVLNHIPNCRCLEGMQGNAFIQCSPVPKLDVVQNPCQPSPCGPNSQCRVVNQQAICSCITSFIGSPPFCRPECTTNSECPLNLAC--RNQKCSDPCPGVCGRGAQCHVTNHSPFC---------------RCLERYTGNPFVSCQQI----IEPPVPPPRQTCL--PSPCGPYSQCREVNESPS-------------CTCLPEYIGAPPNCRPECVTSSECPTNQACIQQKCRDPCPG-LCGQSAECRVLSHTPSCV---------------CPEGMEGDPFTLCKEKRIQELDQLDPCSPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGCRPECVLNSDCPSNKACQQQKCQ----------DPCPG--TCGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVK----EYVNPCQPSPC---------GPN--SQCREVNEQAICSCLPEYVGAPPVCRPECTISSECPADKACVNQKCVDPCPNTCGDQAICRVVNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPCVPTPCGPYSQCRSQGDAPACSCLVGYIGAPPNCR---PECRINAECPSSQACINEKC----------RDPCP--GSCGYGAICNVINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCNNGVCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGYNGNAFV----QCKPTPPPALVQ------PCQPSPCGPNSQC---REVNQQAVCS-------CVPGYIGTPPLCRPECTSNSECLSHLACV--NQKCNDPCPGSCGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSE---CPSNLAC-INQKCRDP-CPGLCGSSATCRVVSHT-AMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGANAECIQRNGAGACQCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDPCPGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPCPGACGLNAQCHVRNHSPLCS--CQPG----FTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPCPGACGFAAQC-SVINHTPSCSCPAGYTGDPFTSCRV--LPPPPPPKTPSDPCQPSPCG----ANALCNNGQCSCLPEYHGDPYTGCR--PECVLNSDCPRNRACVNQKCVDPCPGHCGLNALC---DAVNHIAMCHCPERMTGNA-----FVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCR--LECYSSSDC------SQVHSCINNKCV--------------DPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDECANTLACMNQKCRDPCPGSCGQSAQCTVSLHIPNCQC---PVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRP-ECVGNSECPANQAC--------------------IRSKCQ-DPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCA-KDRACI------------------NSKCV-DACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQP-SPC-RSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGS------------PYAQCLRQLPEPEPKPECISDG-DCT-NDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACV--------------NQQCVDP------------------CGFTQCGTGAICRADFNHR---------------------ARCHCLDGYRGNPLVRCERPE-CRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGN----PAVRCDLVPTQPEGCTMDAECPSKLACFGGECK----NPCDVTHPCG-ANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHK----EPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRCQDPCAEANPCAGNAECRVQNSRPI-CFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDP 16407          

HSP 7 Score: 195.667 bits (496), Expect = 9.136e-49
Identity = 959/4022 (23.84%), Postives = 1335/4022 (33.19%), Query Frame = 3
Query: 2091 CKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGDGINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKSCDKICHKDALCQ----NSRCICKPNFEGDGVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANHAICTV-----ENTCQCRKNYYGNPLEKCNIDCSKCHTDSDCDKTNGYC---KCRYGFFGDGFTC--NKTCCVEKCHEQAQCVDGKCLCKPGFSGDGVETCF-------------HCSQCDSNAICDQNNKACICKSGFEGNG---INCLRAINCKQKCHKQARCLLGKCICN-KGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGDGIQ-CKLLPL-------CTPA-CHPQASC--INGN--CKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCK----EGTCKCSNGLTGDGVNFCFNC----------------SLCDKNAKCLINEEK--CECMERFEGDGFTCQD-------------------KVDCSSRCGENAFC----YNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFS-CHPNAKCIK----GRCRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCING----KCECLAGLQGNPFQQCFDCKRCS----------QFADCDPWNE--------RCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCSTCDINAFCEPFNE--RCVCSVGFTGNG-KKCS--ILAPITCKRA--------CHKKAKC--VKGK--CECLPGLRGDGVQ---SCFDCSICDNNTVCY---------------------PDQEKCVCNPGYYGDG-TTCFLFSQLCTE-----KCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRA-------DICRPTCGENAICV----NGQCQCQSGLQGNPLKHCF------------DCRPCHSFAVCDVENRRCICQ--SGFEGDGRNCKKIKECSPKCHRNAVCINQN-----------------------CVCIPEYIGDGINFCFNC------------SSCDRNADCEPHNNR--CTCYQGFTGNGLTCNAI---------ELKCEP---------SCGENAKCV----NGKCECLPGLQGNPLQHCFNCKRCDKF------------------ADCDVWN--KKCVCKNGYMGNGL----------------TCIS-------VNGCNNKCDSNALC-VNRH---CICLPGFTGDGTRFCFDCSSCPK-------------NSNC--LPEEQKCICQEGYIMNGAKCQP---IVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKK--CVCKNGYFGNGYM-CTPINGCN--------------LKCNENALCV----NQKCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGN----CECLPGFVGDGIQVCFN---------------CSTCDKNANCFPYQERCVCKPRYSGNG----------------------ENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCF-------------NCSSCSIEAIC--VPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALRVNQQCI-----------------------CLPGFIGDGKNFCFDCST-------CPPNSDCLPQE-------------QRCICKKDYFMNDTQCIHTGRTPQCV--PKCHHYASCVQDKCECLPGFIGDGIKFCFKCSSCDPNADC--VPEQQKCVCKTGFYGNG-----NKCDKIESTCEP-PCAPGGFC----NNSKCQCNSGLKGDGVTSC-------FNCSK----------------CDVNAKCFP--SVKKCICVIGYKGDGF-RCYPVILECPKCHYRAQCVI------GKCQCKNGL-----QGDGINFCMNC-SECDKNAQCFPNFSKCECRQGYRGDGKNCVKI---DECSPKCHQNAVC--INSN--CHCLPMYTGNGVSFCFNC-------------------AQCDANAIC--KPDENLCVCAQGFTGNGITCKAIDPSC--NTNCHKDALCFKDS-----------------------CICKSGLSGDGKNYCF-----------------DCKRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGDGFSFCFNCSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKE-------CKPACSEATSLC-IKNQ---CFCRPGLIGDG----YNCLDCRKCHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPIS-------KLCINPN--CQP-PCHPKAVCV----KGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRK----------------DQSSLKKICKCKDGLVRDLQGQCQK-----------PACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTC-------TDCSG----------------CDKNAICT---EKQGCICKSGFIGDG-RQCIV-----------------LNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYP--CAKNAVCIYQKCECL-PGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSGDG------------IQCRIE------DQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGNGYSGCFDCSKCHANADCDESKGCTCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNN----CVCKTGYSGTG-LNCKPNDQCSQNSDCPE---PNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICI-TQTCYCV------PGYFGDGIKSCTSCSVCHKNAQCLPDRGCVCKSDFIGDGF-NCRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQC----KSGKCVCQGELQGDG-------------IRTCFKCSSCHARAVC----SMDGCKCMPGYVGNGIV-CQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQ----LGVCVCKDGY------------SPSVNGL--SCSPIDHCQSENDCPDSNHKCVYH--GLFQGKRCMCRKGFIPKSV---------FQCIEETCPNKCHNFAYCRQK----VCQCRLGFQGDGVFNCHDC------------------SVCHPNAICS-----PSLGCTCPGPHLIGDGRSCKPKDQCRIDSD-----------CRD-------SNAVCTLTYDSLKCQCKLGYI--KFNN---------------SLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNS----NKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAIC-------VCR---KGFINKFGYCIPINCYQ--------PCHKNAYCNI----GVCTCNPDYIGDGITSCKKKNLCLEDSDCP 11666
            C C P ++GS   CR E     +C ++ SC+N  CK                                                C   C  +ALC+    N  C C P F GD    CF   K                RPP   D +  C   +P      PC  ++ C V     +  C C ++Y G     C  +C+   +DS+C   N  C   +CR    G   TC    TC V       +C+D       G++GD    C              + S C +NA+C + N    C    E NG     C         C K   CL  KC     G+ G   E       CH+    I    +C C SGF G+  Q C+ +P        C P+ C P + C  +NG+  C C  N IG    +C    +CS+++ C   ++ C+ Q        +C   C  +C   A+CK       C C  G +GD    C                   S C +N++C +  E   C C+  F G    C+                    +  C   CG NAFC    ++  C C  G+ G+P   C        P    IP+ +            TPC  S C PNA+C +    G C CL    GD  + C     C  NSDC  ++   +C      D          C   CG+NAQC        C CLAG  GNP   C +  +            + + C P+++         C C  G+IG+   C       + C  N  C+NQ+C          ++ C    TC I A C+  N    C C+ GFTG+   +C+  +L P   +++        C   +KC  V+G   C CLP   G        C   + C  N  C                        +  C C PGY GD  + C +  Q+         C+P+    N  C+  ER   +G   C    +C P+    P      C+ E V +      RA       D C   CG NA C        C C  G  G+P + C                PC  ++ C   N   +C    G+ G   +CK     S +C +N  CINQ                        C C P   GD I+ C               S C  N+ C    N+  C+C  G+ G   TC             L C+          SCG NA C     N  C C  G +G PL   F C+                       A+C   N    C C +G+ GN                  T +        V+ CNN C   A+C V++H   C C PG+TGD    C      P+             NSNC  +  +  C CQ G+I     C+P   +  EC P       CV+ KC        +P QH      C   A C   N    C C     G+ ++ CT +   N                C  NA C     +  C CLP FIG   +   +C     NS C P         +  +N+K   P      C+  C   AKC   N    C C+ G+ GD    C                  + C +NA+CF  +  C C+  Y GN                         CV   P  IC N    +       C C++G+ GD    C              + S C   + C  V     C C  G+ G   QC      SS +C +    VN++C+                       C PG  GD    C             PP   C+P                 C C+ ++F +   C      P+C+  P C    +C+ +KC             C +  SC  NA+C  +     C C TG+ GN       + ++    C+P PC P   C      + C+C    +G+    C        +C                  C +NA+C+    V  C+C  GY GD F  C  V +  P       C+        KC+  NGL         I    NC  EC  NA+C  N              + C K    + C+  C  NA C  IN N  C C    TG+  + C+                     + C  N+ C  + ++  C C   F G    C+   P C  NT+C  D  C  +                        C C+ G +GD    CF                 D + C  NA CR     C C  +++GD +      + T   DC P    +N   +C +   G     C   S C    D   H+  C C + +TG+ F+  R E       C+P      SLC I  Q   C C+PG++G        C+   +C     C  R     C PG  G    C  I                      C C      DP +       K    P+  CQP PC P + C        C C    +G    CR   EC+ + +C   +   R+                + ++ + IC C  G   D    CQK           P     C S AVC + + + S C CLP   GD   +C       +DC+                 C  NA C+       C C+ G+ GD  R C V                  + C  NS C  + G+A            C C + +  L   C P  C+    C  +  CI Q+C+   PG  G         +EC  +   +    C C  G++GD             +  R+E        C LNS C +           V  C C   F+ +     P  C  +C   A C +      L  + +  I   P  C  + +C   N         + +C C +GF      S          +S      C P  C P    +A C  G C C   F G+ YSGC    +C  N+DC                    P DK   +S C +P                                CP  C +NA+C   N    C C    +G+  + C P      N   P    PNS+C  + +    C CLP F       +P  C+P+C   + C  TQ C         PG  G G     +C+V   +        C C   F G+ F  C+P    +I    RD   +    PS       C+P+                       E   C C+  +IG   NC RP EC   + C  Q +                     +N KC  +PCP  C   A+C     + +C+CQ    GD              IRT    S C   AVC     +  C+C+P Y G+    C+ E  C  DSDC   N AC     +  +CQ                C   CG N+ CQ    L  C C  GY             P  N     C P   C   + C  SN + V     LF G    CR      S           +C++    + C N A CR +    +C C  G+ GD    C                     + C PN+ C      P+  C     + IG   +C+P  +C I+S+           CRD        NAVC++   +  C C  GYI   F N                 C P P    C  N +C  GQC C P +  +        CV   DC  +        ++ C G     A+C       +CR   +   N F  C P+   +        PC  N+ C +     VC+C  +Y+G     C+ +  C+ +SDCP
Sbjct: 10080 CSCVPSYIGSPPNCRPECMSSSECAQDKSCLNERCK----------------------------------------------DPCPGTCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEK----------------RPPITHDRIDPC---VPS-----PCGPNSECRVSAANEQAVCSCLQHYVGR-APNCRPECT---SDSECPG-NLACINLRCRDPCVG---TCGIQTTCLVNNHRPICRCID-------GYAGDPFSECSPKINVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRACLNNKCRDPCPGVCGVSAE-------CHV----INHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCREVNGHAVCSCVTNYIGT-PPACR--PECSVSSEC-AQDRACVNQ--------RCADPCPGTCGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPNCRPECTINTECPANLACINERCQDPCPGSCGFNAFCSVVNHSPICTCDSGYTGDPFAGC-------NPQPPAIPDER-----------LTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCR--PECVVNSDCSRDK---SCVNQKCVDP---------CPGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISSDCAQNLNCQNQKC----------VDPCP--GTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAICR--ER---NGAGSC----ACLPEYFGDPYS---GCRPECVQNDDCDRSRACINNKCQDPCPGACGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPECVVSSECPQNRACINQKCEDPCRGSCGNNAKCQVVNHNPICTCQPGMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPL---FGCQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKPECVVSAECAP----EKACVHKKCV-------DPCQH-----TCGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSPACSCLPNFIGAPPRCRPECV---LNSECGP--------TEACINQKCADP------CSGSCGFEAKCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGE--CRCQNNYQGNAYEGCRPECTLSADCPRDKACMRNRCVDPCP-GICGNNAVCEVMNHIPVCSCVKGYEGDPFVNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRPECVVSS-ECSALQACVNKKCVDPCAAACGLEARCEVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPNC-----RPECIINPDCQSTQACINNKCS----------NPCPE--SCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRPECVLSSDCPTDKTCIRNKCQDPCPGICGLNAQCYAVNHVPNCVCNDGYTGDPFASCRRVEVTTPS-PVSDPCIPSPCGANSKCRVANGLAVCSCMETFIGAPPNCKPECTVNAECPSN--------------RACHKFRCANPCAKTCGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCR---PECVVNTDCSPDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQDPCDLQPCGSNAECR--NGICSCLADYQGDPYT-GCRPECTLSTDCAPTKACLNK--KCVDPCPG----VCGQNSQC----DVSNHIPICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQGPVCACQPGMLGSPPACKPECIVSSECSLHTACVNRKCVDPC-PGACGQFARCQVINH-----------------NPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPCQPSPCGPNSECKVLNGNAACSCAATFIGTPPSCRP--ECSINPECPPTKACIRQKCSDPCVNACGFNARCNVANHQPICTCDVGYTGDPFTGCQKEQERIVNEQVTPCEPNPCGSNAVCRERNGIGS-CQCLPDHFGDPYQSCRPECVRHSDCASNKACQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEPPQLPARVTEPSQPCRPSPCGPNSQCRELNGQA-----------VCSCLELYIGLPPNCRP-ECVLSTECPTDKACISQRCQDPCPGTCGIN-------AECRVR---NHSPLCQCRQGFTGDSFTRCYPLPPPPPVIERVERDPCLPSPCGLNSQCRN--------VQGVPSCTCLPDFLGA-----PPNCRPECTISAECPSN-----LACIRERCIDPCPGSCGYAAECSVVNH--------TPICVCPAGFTGDPFSSCRPAPPPEPTQS-EYVDPCNPSPCGP----NAQCNAGICTCLAEFHGDPYSGCR--PECVLNSDC--------------------PRDKACHSSKCVNP--------------------------------CPGTCGENAICDVINHIPMCRCPERTAGSAFIRCSPVQITVSNPCRPSPCGPNSQCREV-NQQAVCSCLPSFIG-----APPSCRPECTSNSECAPTQACLNQRCGDPCPGTCGVGA----NCAVVSHSP------FCTCPERFTGNPFIRCQP----QIEPPVRDVAPVDPCRPSPCGPYSQCRPVG----------------------EAPACSCVETYIGRPPNC-RP-ECVTSSDCSSQLAC--------------------VNQKCV-DPCPGRCGLNAECFVVSHAVQCICQQGFNGDPFVQCKPEIAYENEIRTPCSPSPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCRPE--CMLDSDC-PSNRAC-----QQLRCQ--------------DPCPGTCGLNANCQVVNHLPTCTCLTGYVGDPYRQCNRLPEPPQNEYVNPCQPTP-CGPNSQCRVSNEQAVCSCLPLFVGTPPSCRPECTISSECSADRACVNQKCVDPCAADTCGNNAICRVRNHSPICSCISGYTGDAFTRCFLIPPPIIETKDEPLRDPCIPTPCGPNSECRNINGVPACSCLV---NFIGQAPNCRP--ECTINSECPSQLACINQKCRDPCPGACGQNAVCSVINHTPLCACIDGYIGNPFTNCNPKPPEPPAPPVADDPCNPSP----CGANAQCRNGQCSCIPEYKGDPYVSCRPECVLNTDCPRDRACVRNKCIDPCSGTCGVNALCEVNNHIPICRCPEQMSGNAFFECRPVPPAKIQNPCQPSPCGPNSQCRVVQQTAVCSCLANYVG-SPPQCRPE--CVTNSDCP 13621          

HSP 8 Score: 191.43 bits (485), Expect = 1.934e-47
Identity = 960/3825 (25.10%), Postives = 1342/3825 (35.08%), Query Frame = 3
Query: 2091 CKCKPGFVGSGYECREEVNCD-----IKCHENASCVN----GYCKCNRNLIGDGINSCFDCLKCNTEADC--------SPYENRCYCRPGYTGN-----GFTCIKSCD--KICHKDALCQN----SRCICKPNFEGDGVNY--CFDCSKCHKL-----AQCHPKTGN--CTCRPPYVGDGVSECETFLPKGNCFP--PCANHAICT-VENTCQCR------------KNYYGNPLEKCNIDCSKCHTD-SDCDKTNGYCKCRYGFF-GDGFTCNKTCCVEKCHEQAQCVD----GKCLCKPGFSGDGVETCFHCSQCD-----SNAICDQN--NKACICKSGFEGNGIN-CLRAINCK---QKCHKQARC---LLG-KCICNKGLNG--------NGVEYCFNCTS---CHLNAKCIPRQNTCECNSGFHGDGIQCKLLPLC---TPACHPQASCING----NCKCNNNLIGDGI-----SSCFDCDKCSMNARC--DVSNQRCICQPGYEGNGIKCVKTC------------FQSCHKLAVCKEG----TCKCSNGLTGDGVNFCFNCSLCDKNA-KCLINEEKCECMERFEGDGFTCQ----------------DKVDCSSR--CGENAFC-YNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGR---------------CRCLSNLIGDG---------TTYCFNCSSCARNSDCKPEQQT----CTCKRGYVKDGNN--------CSIISARCHPECGVNAQCIN----GKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCVCQSGY--IGN---------GFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCSTCD--------INAFC--EPFNERCVCSVGFTGNG-KKCSILAPITCK--RACHKKAKCVK-GKCECLPGLRGDGVQS--------CFDCSICDNNTVCYP-DQEKCVCNPGYYGDGTTCFLFSQLCTE-KCHPNAKCVNRK----CKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFV-GDGKICTLRADICRPTCGENAICVN----GQCQCQSGL----QGNPLKHCFDCRPCHSFAVC--DVENRRCICQSGFEGD---GRNCKKIK-ECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGN-GLTCNAI--ELKCEPSCGENAKCVNG----KCECLPGLQGNPLQHCFNCKR-------CDKFADCDVWNK--KCVCKNGYMGNG-LTCISVNGCNNK-CDSNALCVNR----HCICLPGFTGDG--------TRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCK---KCHKFADCDVWNKKCVCKNGYFGNGYM-CTPINGCN-LKCNENALCVNQ----KCICLPGFIGDGIKFCFDCSACPANSNCVPEKKE-CK----CAKDYFMNEKICSPIKQPV-LCTS-KCHKNAKCL-----KGNCECLPGFVGDGIQVC---FNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDG----------IKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPG-FIGDGKNFCFDCST--------CPPNSDCLPQEQRC--ICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGDGIK--FCFK-----CSSCDPNADC--VPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNC-SKCDVNAKCFPSVKKCIC--------VIGYKGDGFRCYPVILECPKCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPN------FSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDEN--LCVCAQGFTGNGIT---CKAIDPSC--NTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKRCDQNAICRP---TEQRCVCKPEFRGDGFQCALNLKTTCQ------NDCHPNAVRVNNCCRCKNGFFGDGF--SFCFNCSN--CSPNADC--FPHLSKCQCKEEFTGNGFI----CQRKEC-KPACSEATSLCIKNQCF--CRPGLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYIGNG---------FECISITSC-------TQSSDCIRPNEI-------CNVAISQCICEANSFLDPISKLC--INPNCQPPCHPKAVC--VKG--KCICNRNLVGDGYQ--CRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAICTEKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKC-EPLSCIYPCAKNAVCIYQK----CECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDGIICRLPDECKSSLDCKYE-------------------NQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNP-----------------------KCHRSALCVI----GTCKCPPSFKGNGYSGCFDC-----SKCHANADCDESKG---CTCKPGFEGNGCY--CRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNG--KCIILGCPVQCDKNAVCLSN----NCVCKTGYSGTGLN----CKP-NDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDN----------GKCSPKECQPK-CHMFAICITQT----CYCVPGYFGDGIKSCTSCSVC----------HKNAQCLPDRGCVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCP-INC--HPLAQCKSGKCVCQGELQGDGIRTCFKCSSCHARAVCSMD-GC----KCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPG--VDKGKKCQCKPGFSLENSLC-SPIACRPKCGKNSQCQL----GVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIEETCPNKCHNFAYCRQ-KVCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYI-------KFNNSLCYP--------IPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCI-PINCYQPCHKNAYCNIG----VCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKCLLPCDPNAVC-------VLG---ECICKVGFTGNGLQCMPTSKCNPLS-GCSD----TNSVCIQVPPTNYYDCMCKPGYI 11960
            C C PG+ G+G+ C +   C       +C ENA C N      CKC     GDG   C D  +C    +C        +P    C C  GY GN     G   +  C    +C   A+C N     RC C P ++GDG +   C D  +C +      A C    G+  C C   Y GD ++ CE       C    PC   A C  +  + QCR             +    PL    +      TD +   +T+G      G    D   CN+   V KC   A+C++     +CLC  GF G G   C + ++C       NAIC     +  C CK  + G+    C+    C    + C + A C   + G  C C +G +G          V+    C+S   C  NA+CI  +N C C  GF   G  C  +  C      C P A C+N      C+C    +G          C D  +C  +A C  D +   C+C+ G+  N       C            F SC + A C       TC C  G +GD  + C +   C   A KC       EC+    G G+TC+                  V CS+   C  N+ C     C C     GN   H  +   C   A C + N +  C+        +  +  C+   +C                   C+C     GD          T  C + + CA    C  +  T    C C++GY ++  N        CS+   R  P CG+NA C N     +C C  G  GNPF  C  C               C CQS Y  +GN         G  C     C++      +     C C  G        C D   C+          A C  +P +  C C  G+ G+       LA   C   R C    KC++ G+C C P    D   +         F C I   N  C P D  +C+C  G+ GD          C+   C   A CVN+K    C C +   GD         S  P + C  +     C S     +G   +  + +    CG NA C      G C+C+ G      G+ +  C D   C   A+C    E   C C  G  G+   G +C   +   +  C    +CIN  C    E +  GI      ++CDRN      N +C C   F GN  L C     + KC P CGENA C  G    +C C PG  GNP + C    +       C   A+C        C+C  G+ GN  + C  V+ C NK C  NA C+NR     C+CL G  G+         ++FC D + C  N       ++  C EGY     +C+ +  +    CG  A C  G C C  G  G+P      C    +C   ADC + ++ C       G G   C  ++ C+ ++C  NALCV++     CIC  GF G+       C         VPE+++ CK    C++ Y     + + IK+ + LC++  C  N  C         C C   +V + +       +   C  +ANC    +   C+P   G  + CV I     CP      A+  + +C CL GF G+              C N + C     C+ D+         + +  +C     G    C +N  +   QC C PG F GD  +    C +        CPP+  C      C  +C ++   ++  C+             H A C     +C PGF GD +    C K       +C P+A C   PE   C C   F G+              C P G C N    C +     G      C + C  NA+C    +K +C        +     DG  C   I    KC     C  G   C N   G     C N  +C     C  N          +C  G      +C      + +C Q+  CI + C          ++ C +   C  NA+C  D++   C C +GF GN      C  +   C  +  C    +C  + C     L       C   +RC Q  +CR    T   C+        G  C  N   TCQ       DC P  + +   C+C  GF G  F  S    C+   C  +A C   P   +C C E   G+G+      Q ++C KP        CI  +C   C   + G   NC    + HE          C C  G++G+           ECI    C        +++ CI+P ++       C V   +  C        ++ +C  IN     PCH  A C  + G   C C   L+GD  Q  CR P EC +DADC                               CQ   C   C  +  C  ++N                     C      AICT      C     GD     V  ECADN DC+              G + C        L+ KC +P S    C   A C  Q     C C  G  G+  + C     C +   C   +G +CSHG             CS N DC    ++C+     V +  CKS+              S C ++  C N +C          + CR   EC     C  +                   N ECVAR   +  C CK GF                     A SGC  I+C                          C  +ALC        C C P F G+    C        + C   A C  ++G   CTC PG  G+     CR   +C+ N DC  P   C +                 TNG  KC  +   +QC  NA C+       C C++GY G   +    CKP    C    DCP           Y    VC P    D           G+C     QP+ C   A C+ Q     C+C  G+ GD  K C    V            +++ CLP    VC +D            EC  NE C      C+L   + N           + + CL  +C   CH +  C      C +        C  P    ++NPC    + C +++   R  C C+           P P P + C   P  +C+  +        G+G+  CF+ S C  R +C+ D GC    +C  G      +C+ +++C +   C   N  C PG   D+G    C P  S     C  P A    CG N+ CQ       C+C +G   + N     P   C    DC  SN  C Y G  QGK   CR      +  +C+  TC   C+    C Q ++C+ R+   G           C  +  C+    C           + C  ++ CR    C    A C +    ++CQC   ++       +     C+P          C  +C R E+C  GQ QC  G   N    C     C V     C+     C+    +   C   +  +N  G C  P    + C +NA C +     +C C   Y G+    C +   C  D+DC                         N +C   KC  PC     C       V+G   +C C   F GN     PTS+C PL  GCS      NS C +VP    Y+C C  G I
Sbjct:  153 CTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDV---DECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSG-----AGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTNNAECI--ENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDV-RCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGA---ECV-NVPGGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSV--QRGKPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICN-----------TPECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSY-----CACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGI---NAKCTPSDPPQCMCEAGFKGDPLLGCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDD---CASNLACLEGSCVSPCSSL---LCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVI-CGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTDQCSAARPCGERQICINGRCKERCEGVVCGIG-----ATCDRN------NGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCN-------ERVECPEGYSCQKGQCKNLCSQA--SCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADC-LHSEICF----QLGKGLRKC--VDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQP----ERTVPEEEDKCKSDQDCSRGYGCQASV-NGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDANC---PDASACRPDVLGVLK-CVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKC-----GPRAVCVTNNHQA--QCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEESCGDNAICLAE----------DHRAVC-----QCPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKCPPLFVGDAKSGG---------CRPDGQCPNGDADCPANTICAGGVCQNPCDNACGSNAECKVINRKPVCSCPLRFQPISDTAKDG--CARTIS---KCLTDVDC--GGALCYN---GQCRIACRNSQDCSDGESCLKNVCVVACLDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIENKC----------LNPCQSANSCGPNALCSIDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQC----NLPCTKTASCAVGERCYQQ-VCRKVCYTSNNCLA-------GEIC--NSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCANNLACIHGKCTDPCLHTVCGINANCQS--EGHEAL--------CSCPAGFLGDPNDTGVGCFKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQPCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADC--------------------------PASASCQNSRCRSPCERQNACGLNAN---------------------CQAQAHQAICT------CPLNSRGDPTIECVHIECADNDDCS--------------GEKAC--------LDSKCIDPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQC--AQGSICSHGI--------CSPLCSTNRDCIS-EQLCLQG---VCQGTCKSN--------------SSCPQFQFCSNNICT-------KELECRSDSECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVAR-SHAPDCLCKEGFFGD------------------AKSGCRKIECTSDDDCSNDKSCDNHMCKIACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDC-PPHAACTK-----------------TNGVAKCRDVCAQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKPLPSPCQVTGDCP--------TNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMCLP----VCHNDL-----------ECASNEKCL--KGSCMLTCRVDN--------DCFLGHVCLHNKCVYGCHVDDDCSASE-SCRND------KCVNPC---LENPCGPN-AACSVSN--HRASCSCLESM-------VPNPTPQVGCVRSPPLECRENRDC------GNGL-ACFE-SVC--RPLCADDAGCLTNERCQQGVC--KPLCRHDNECGHGELCLGLN--CVPGCRSDQG----CPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCLCPEGLDGNANVACKVPRIACGRNEDC-QSNQLC-YAGSCQGK---CRNDQNCLADERCMRGTCRTVCNTDEACAQGQICENRMCQTG-----------CRTDLSCATDEACV---------NKKC--QNPCRTPGQCGQC-ADCLVVNHGVQCQCPAAFMGDGLTGCQLPPERCHPDCECDENGAYCAPKCSRTEDCACGQ-QCARGKCRNK---CGPKRQCTVGQ--LCE--RGACIAGCKSNGDCAADQSCVN--GKCSDPCANEKACGRNALCTVSEHRMLCYCPDGYEGEPSKECVQFE-CRVDTDC-----------------------DSNKRCDQGKCRNPCLEYGACGTNAQCRVVGRKAQCSCPPDFFGN-----PTSECRPLEGGCSSKPCGENSKCTEVP--GGYECACMDGCI 3536          

HSP 9 Score: 186.422 bits (472), Expect = 5.577e-46
Identity = 941/3903 (24.11%), Postives = 1302/3903 (33.36%), Query Frame = 3
Query: 2091 CKCKPGFVGSGYECREEVNCDIKCHENASCV-----------------------NGYCKCNRNLIGDGINSCF-----------DCL--KCNTEADCSPYENR--CYCRPGYTGNGFTCIKSC--DKICHKDALCQNSRCICKPNFEGDGVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETF------LPKGNCFP-PCANHAICTVEN---TCQCRKNYYGNPLEKCNIDCSKCHTDSDCDKTNG--YCKCRYGFFGD-GFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGDGVETCFH---------------CSQCDSNAICD--QNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGDGI-QC----KLLPLCTPACHP--------------QASCINGNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVC----KEGTCKCSNGLTGDGVNFCFNC-------------SLCDKNAKCLINEE--KCECMERFEGDGFT-CQDK------------------VD-CSSRCGENAFC----YNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCD--IPNRKCICITENDIFSRTPCSFSCHPNAKCIKGR--CRCLSNLIGDGT---TYCFNCSSCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCI----NGKCECLAGLQGNPFQQCFDCKR----------------CSQFADC--DPWNERCVCQ--SGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIGDGINFCFDCSTCDINAFCEPFNER--CVCSVGFTGNG-KKCS--ILAPITCKRACHK---------KAKCVKGKCECLPGLRGDGVQSC-------FDCS---ICDNNT-------VCYPDQE--------KCVCNPGYYGDGTT-CFLFSQL--CTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLR-ADICRPTCGENAICV----NGQCQCQSGLQGNPLKHCFDCR----------------PCHSFAVCDV--ENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEP--HNNRCTCYQGFTGNGLT-CN----AIE----LKCEPS-CGENAKCVN----GKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALC-VNRH---CICLPGFTGDGTRFCFDCSSCP----------KNSNCLPEEQ--------KCICQEGYIMNGAKCQP--IVHECRPGCGENAKCVNGKC-ECLPGLQGNPMQHCFDCKKCHKFADCDVWN--KKCVCKNGYFGNGY-MCTPI-----------NGC-NLKCNENALCVNQK----CICLPGFIGDGI---KFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGDGIQVCF---------------NCSTCDKNANCFPYQER-----CVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFN-------CSSCSIEAIC--VPDQEKCICKAGFSGNGEQCVENIEGSSPK----------CHSNALRVNQQ--CICLPGFIGDG---KNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGDGIKFCFKC------------SSCDPNADC--VPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDG-VTSCFNCSKCDVNAKC--FPSVKKCICVIGYKGD---GFRCYPVILEC-------------PKCHYRAQCVIGKCQCKNGLQGDGINFCMNC-SECDKNAQC--FPNFSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCI----NSNCHCLPMYTGNGVSFCF-------------NCAQCDANAICKPDEN--LCVCAQGFTGNGITCKA-------------------IDPSCNTNCHKDALCFKDS----CICKSGLSGDGKNYCFDCKRCDQNAICRPTEQRCV--------------------CKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNN-----------------------CCRCKNGFFGDGFSFCFN---------------CSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATS-----LCIKNQCFCR-PGLIGDGYNCLDCRKCHEKATCNIRSM--KCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQP-PCHPKAVC--VKGKCICN--RNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDC------------------SGCDKNAICTEKQG---CICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIY----QKCECLPGLVGNGFIKCT----------NCSECHKKALCHDQRG---CVCSHGYSGDGIQ-CRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDGII-CR--------------LPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKS---EKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVI----GTCKCPPSFKGNGYSGCFDC-------------------SKCHANADC---DESKGCTCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICV------------------QSPDTSRNCVCKPGTTPSTNGKCIIL-------------GCPVQ-CDKNAVCLSNNCVCKTGYSGTGLN-CKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCL-PGFQDDNGKCSPKECQPKCHMFAICITQTCYCVPGYFGDGI----------------KSCTSCSVCHKNAQCLPDRGCVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHIL-INNYCLPKECTSKCHKNAKCE----GGMCQCLSGFIGDGINC----QRPFECGIDNPCKDQFSVCQLTSDAKRF----VCVCVFGFQMINSKCQPEPCPIN--CHPLAQCKSGKCVCQGELQGDGIRTC---FKCSSCHARAVCSMDGCKCMPGYVGNGIV-CQTEDQ--------------CQYDSDCRDRNA----ACFPGVDKGKKCQCKPGFSLENSLCSPIACRPK---------CGKNSQC----QLGVCVCKDGYS-----------PSVNGLSCSPIDHCQSE-----NDCPDSNHKCV------YHGLFQGKRCMCRKGFIPKSVFQCI----EETCPNKCHNFAYCRQK----VCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFI-NKFGYCIPINCYQ-------------PCHKNAYCNIGVCTCNPDYIGDGITSCKKKNLCLEDSDCP 11666
            C C+ G+ G+  +CR E     +C ++ SC+                       N  C C  N  G+    C             CL   C + + C    NR  C C PG  G    C   C  ++ C  +  C   RC      E   +  C   + C       PK   C+C   + GD  + C+         P   C+P PC  +AIC V N   +C C +NY+G+P   C  +C +   +SDC         KCR       GF  N  C V   H Q       C C+P  +G+ +  C                  S C   + C        C C   + G         NCK +C   A C   +   N+       + C      +   +C      C C  G+ GD   QC    K  P+  P   P              Q S     C C  N IG     C    +CS+N+ C  +   CI          +C   C  SC   A+C        C C  G +GD  + C+               S C  NA C    +   C+C+  + GD +  C+ +                  VD C   CG NA C    +   C+C  G+ GNP+  C    V   P Y D  +P   C           +PC    + N + + G   C C+ + IG        C + S CA++  C  E+    CK                C   CG NA C     N  C C  G  G+PF +CF  ++                C   ++C     NE+ VC     Y+G    C       ++C  N  C N  C+          + C    TC I   C   N R  C C  G+ G+   +CS  I  P+   + C+          K +   G C CLP   GD    C        DCS    C NN        VC    E         C C  G+ G+ +  C    +L    E C P+      +C+    + G  V  C       P A C P   ECS  SE   D      R AD C  TCG  AIC     N  C C +G  G+P   C   +                PC   + C V  E   C C   F G   NC+     + +C  N  CIN+ C           + C    SC  NA C    H+  CTC  G+TG+    CN    AI       C+PS CG NA+C      G C CLP   G+P   C     C   +DC   +K CV +            V+ C   C  NA C V+ H   C CL G+TG+ +  C +    P          + S C P  Q         C C +G+I +   C+P  I+      C +N  C N KC +  PG              C   A C V N    C C  G+ G+ +  CT I           N C    C  N+ C++ +    C CLP ++G        C   + CPAN  CV ++    C     ++  +C+ IK         H+ A      CEC+PG+ GD    C                N S C  NA C   +ER     C C P Y G+        P S C             + +C+Q    D  + C N         +C I A C  +     C C  G++G+  +    IE  + +           +S  L  N    C CL G+IG     K  C   S CP N  C+ Q+    C+     N+ +C      P C                C PG  GD I  C               S C PN+ C  +  Q  C C  G+ G          TC P C      NN +CQ +   + +  V  C     C  NA C        C C  GY+G+   G +  P +                P    R +   G C C +G +G+  +    C  EC+ N  C      S+ +C             +D C+  C   A+C        C C P YTG+    C              N + C  N+ C+   N  +C C  GF      CK                    +DP C   C   A+C   +    C C   ++GD    C      + N    P    CV                    C P F G   +C    +    ++C P    +N                         C C  G+ GD F  C                  + C  NADCF    +C+C+  + GN +    + C+P C+ +        C++N+C    PG+ G+             A C + +    C C+ GY G+ F                                N  + P+ +  I   C P PC   + C  V G  +C+     +G   QCR   EC   ++C   Q    K         KC D              C  AC  +A C +  N    C C PG  GD    C                     S C  N+IC   +    C C+  F G    C    EC  N DC              +  Q C        +N KC    C   C  NA C        C C  G  GN F++C             S C   A C ++ G   C C   Y G+  + CR E  C L+SDC   +K CI       R  C+           P  C      YA      C C  GY GD    CR              +P  C ++  C+  N   V        C+C   F       +    VN +    R+   +    P  C   C  +A C +      C CP    G+ ++ C+                     S C  N++C   DE   C+C P F G    CRPE  C  N+DC+ P + C+                  +  +    C C+ G T     +C                 C +Q C  NA C +  C C   Y G     C+P  +C+ ++DC  P   C      N+KCV   PG    N +C      P            C C+ GY GD                    C   S+CH + Q      C C+   +G    C+P  EC ++ +C                      LH   +N  C+   C   C + A+C+       C C +G+ GD        +R      DNPC  Q S C   S+ K       C C   F      C+PE C IN  C P   C   KC          +  C    +C+  + + +C+ D      GY G+    CQ E +              C  ++ CR+RN      C P         C+P     +   S  AC+ +         CG N+ C     L  C C+ GY+           P +      P   C+       + C + N + V      Y GL    R  C       +   CI    ++ CP  C   A CR +    +CQCR GF GD    C+         I         P P              C ++S CR+   V         C C   +      L  P  C  +C  + EC        P  +    + C++P       P SC    E  +   N   ICVC  GF  + F  C P    +             PC  NA CN G+CTC  ++ GD  + C+ +  C+ +SDCP
Sbjct: 9435 CSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCVGTCGFNAKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLPSPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVINQDCPSNRACIRQRC------EDPCIGICGFNAVCSTQNH-QPK---CSCIESFEGDPYTACKMREIVVLDPPTDPCYPSPCGANAICRVRNGAGSCSCIQNYFGDPYINCRPECVQ---NSDCPNNRACINMKCRDPCANACGF--NAICRVA--HHQP-----VCSCEPHLTGNPLRACVERPSNMYLPLPKDPCRPSPCGLFSTCHVVGERPVCACLPDYMG------APPNCKPECMTSAECPSDRACINQRCK----DPCPGTCGYNARCRCTNHSPICSCYDGYTGDPFHQCVPERKPPPIADPIVPPNPCVPSPCGPNSQCQVSSSGAVCSCVTNYIGR-PPGCR--PECSINSECP-ARMACI--------NARCADPCIGSCGNNALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALCEERNQAAACKCLPEYFGDPYVECRPECVINSDCPRSRACVNQKCVDPCPGMCGHNALCAVFNHAPNCECLPGYTGNPIVGCH--IVPESPRYPDPIVPENPC---------QPSPCGL--YSNCRPVNGHAVCSCVPSYIGSPPNCRPECMSSSECAQDKSCLNER----CKDP--------------CPGTCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRPECTSDSECPGNLACINLRCR----------DPCV--GTCGIQTTCLVNNHRPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPCGANAVCKERNGVGSCSCLPEYNGDPYTECRPECVLNSDCSKNRACLNNKCRDPCPGVCGVSAECHVINHAPSCSCPSGFTGNPSQFCREIPRLPAPVEPCRPSPCGPYSQCR---EVNGHAVCSCVTNYIGTPPA-CRP---ECSVSSECAQDRACVNQRCADPCPGTCGNEAICKVTNHNPICSCPAGYSGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPNCRPECTINTECPANLACINERCQ----------DPCPG--SCGFNAFCSVVNHSPICTCDSGYTGDPFAGCNPQPPAIPDERLTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCR--PECVVNSDCS-RDKSCVNQK----------CVDPCPGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPPPPERDENPCRPSPCGPYSQCREVDGHAVCSCLQGFIGSAPNCRPECIISS---DCAQNLNCQNQKCVDPCPGT-------------CGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCRPECLSSADCPANLACVNQRCSNPCIGACGLH-SVCTVIK---------HRPA------CECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAIC---RERNGAGSCACLPEYFGD--------PYSGC-------------RPECVQNDDCDRSRACINNKCQDPCPGACGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPECVVSSECPQNRACINQKCEDPCRGS-CGNNAKCQVVNHNPICT---------------CQPGMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGR-------PPTCRPECT-----NNDECQNHLSCQQERCVDPCPG--SCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKC-------------VDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVDP-CQHTCGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSPACSCLPNFIGAPPRC--RPECVLNSECGPTEACINQKCADPCSGSCGFEAKCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCF--AGECRCQNNYQGNAY----EGCRPECTLSADCPRDKACMRNRCVDPCPGICGN------------NAVCEVMNHIPVCSCVKGYEGDPF-------------------------------VNCRVKPVVEDPIIEACSPSPCGSNSQCRDVNGHAVCSCLEGYIGAPPQCRP--ECVVSSECSALQACVNK---------KCVD-------------PCAAACGLEARC-EVINHSPICGCPPGRTGDPFKQCVVLPPIAVPDVKSPPQDPCVPSPCGPNSICKNDRNGPVCQCQPEFFGSPPNC--RPECIINPDC--------------QSTQAC--------INNKCS-NPCPESCGTNAECRVIGHAVSCSCPTGYAGNAFVQCVPQQEEPPKPCQPSPCGPNAECIERNGAAACKCIDEYQGNPYEGCRPE--CVLSSDCPT-DKTCI-------RNKCQDP--------CPGICGLNAQCYAVNHVPNCVCNDGYTGDPFASCRRVEVTTPSPVSDPCIPSPCGANSKCRVANGLAV--------CSCMETFIGAPPNCKPECTVNAECPSNRACHKFRCANP--CAKTCGLNAKCEVINHNPICSCPLDMTGDPFARCYPAPPPPPPGPKDEPVRRPCQPSPCGLNSECRVRDEQASCSCLPNFIGAPPNCRPE--CVVNTDCS-PDQACIAEKCRDPCDGSCGVDSECRVQNHLAICTCRGGFTGDPFVRCFEFVEETTKSPPLTQDPCDLQPCGSNAECRNGICSCLADYQGDPYTGCRP--ECTLSTDC-APTKAC-----LNKKCVDPCPGVCGQNSQCDVSNHIP-----------ICSCLQGYTGDPFVHCRHETPVAKDPCQPNPCGPNSLCHISGQ---GPVCACQPGMLGSPPACKP--ECIVSSECS---------------------LHTACVNRKCV-DPCPGACGQFARCQVINHNPSCSCNTGYTGDPFTRCYQEERKPPTTPDNPC--QPSPCGPNSECKVLNGNAACSCAATFIGTPPSCRPE-CSINPECPPTKACIRQKC------SDPCVNACGFNARCNVANHQPICTCDV-----GYTGDPFTGCQKEQERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDHFGDPYQSCRPECVRHSDCASNKACQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEPPQLPARVTEPSQPCRPSPCGPNSQCRELNGQAVCSCLELYIGLPPNCRPECVLSTECPTDKACISQRCQDPCPGTCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPP-PVIERVERDPCLPSP--------------CGLNSQCRNVQGV-------PSCTCLPDF------LGAPPNCRPECTISAEC--------PSNLACIRERCIDP------CPGSCGYAAECSVV--NHTPICVCPAGFTGDPFSSCRPAPPPEPTQSEYVDPCNPSPCGPNAQCNAGICTCLAEFHGDPYSGCRPE--CVLNSDCP 12880          

HSP 10 Score: 184.496 bits (467), Expect = 2.292e-45
Identity = 966/4157 (23.24%), Postives = 1383/4157 (33.27%), Query Frame = 3
Query: 2088 KCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGDGINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFT-CIKSCDKICHKDALCQNSRCICKPNFEGDGVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSEC--ETFLP--------------KGNCFPPCANHAICTVEN---TCQCRKNYYGNPLEKCNIDC--------------SKCHTDSDCDKTN--GYCKCRYGFFGDGFTCNKTC--------------------CVEKCHEQAQCV----DGKCLCKPGFSGDGVETCFH-----------------CSQCDSNAICDQ--NNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKC--IPRQNTCECNSGFHGDGIQ-CKLLPL-------------CTPA-CHPQASCINGNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKE----GTCKCSNGLTGDGVNFCFNC------------SLCDKNAKC-LINEEK-CECMERFEGDGFTCQDKVDCSSRCGENAFCYNGTCK------CKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFS-RTPCSFS-CHPNAKCIK----GRCRCLSNLIGDGTT---YCFNCSSCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCI----NGKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQE----CKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSICDNNTVCYP-------------DQEKCVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQE--CSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQSGLQGNPLKHCFDCRPCHSFAVCDVEN--RRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEP--HNNRCTCYQGFTGNGLT-----------CNAIELKCEPS-CGENAKCVNGKCECLPGLQGNPLQHC-------------FNCKR----------CDKFADCDVWN--KKCVCKNGYMGNGLT-------CISVNGCN-NKCDSNALC--VNRH--CICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPGCGENAKCV----NGKCECLPGLQGNPMQHCFDC----------------KKCHKFADCDVWNKK--CVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKC-----------------------ICLPGFIGDGIKFCFDC------------SACPANSNCVPE--KKECKCAKDYFMNE-----------------KICSPIKQPVLCTSKCHKNAKCLKGN----CECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIK---TCFNCSSCSIEAICVPD--QEKCICKAGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDC-----------------STCPPNSDC--LPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYA------SCVQDKC-ECLPGFIGDGIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGNGNKCDKI----------ESTCEP-PCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGFRCYPVILECP-KCHYRAQC----VIGKCQCKNGLQGDGINFCM---------------NCSECDKNAQCFPNFSK--CECRQGYRGDGKNCVK-------------------IDECSPKCHQNAVCI----NSNCHCLPMYTGNGVSFCF---------------NCAQCDANAICKP--DENLCVCAQGFTGNGITCKA-------------------IDPSCNTNCHKDALCFKD----SCICKSGLSGDGKNYCFDCKR-----------------CDQNAICRPTEQRCVC---KPEFRGDGFQ-----------CALN---LKTTCQNDCHPNAVRVNNCCRCKNGFFGDGFSFCFNCSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVA-ISQCICEANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICNRNLVGDGY-QCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLV--------------RD---LQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCT----------------DCSG------------CDKNAICT---------EKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQ-----KCECLPGLVGNGFIKCTNCS-----ECHKKALCHDQR--------------------GCVCSHGYSGD-GIQCRI----EDQCSLNSDCTDPNKICITSTDTVKRC----VCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDGII-----------CRLPDECKSSLDCKYEN--------------QECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGNGYSGCFDCSKCHANADC---DESKGCTCKPGFEGNG---CYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNN----CVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICITQ----TCYCVPGYFGDGIKSCTSCSVCHKNAQCLPDRGCVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCK-PLHIL--INNYCLP---KECTSKCHKNAKCEGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQ----------MINSKCQPEPCPINCHPLAQCKSGKCVCQGEL--QGDGIRTCFKCSSCHARAVCSMDGCKCMPGYVGNG------------IVCQTEDQCQYDSDCRDRNAA----CFPGVDKGKK-----CQCKPGFSLENSL-CSPIACRP--KCGKNSQCQ----LGVCVCKD---------GYSPSVN-----GLSCSPID-----HCQSENDCPDSNHKCVYHGLFQ--GKRCMCRKGFIPKSVFQCIEETCPNKC---HNFAYCRQKVCQ--CRLGFQGDGVFNCHD------CSV---CHPNAICS-------PSLGCTCPG---PHLIGDGRSCKPK--DQCRIDSDCRD----------------SNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCV--KQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFI-NKFGYCIPINC-----------------------YQPCHKNAYC----NIGVCTCNPDYIGDGITSCKK--KNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYEIDNNKCIAKKC------LLPCDPNAVCVLGE--------CICKVGFTGNGLQ-CMPTSKCNPLSGCSDTNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVCEP-SCHPKAACIIGS----CICMKPLIGN-----GITECKLPDECSASVHCKNK-------------NAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVDCPTRKICVNSKC 12281
             C C P FVG+   CR E   + +C  N +C+N  C          ++ C      N       +   C C  G+TG+ F+ C    D        C  S C         GVN     +KC +        G+C C P Y G+    C  E  L               +  C   C  +A C V N   TC C   Y G+P   C I                S C  +S C + N  G C C   F G    C   C                    C   C +QA+C     +  C C  GF+GD    C+                   S C +N+ C +     +C C   + G   NC    +   +C     C+  KC           + C    SC LN +C  I     C C +G+ GD    C   P+             C P+ C     C NG C C     GD  + C    +C ++  CD S + C+          KCV  C  +C   A+C+       C+C  G+ G+    C               S C  N++C ++N++  C C+  F G    C+ +   +S C  N  C N  C       C  G Q +   H   CR      Y   P   C  I E  +   R  C  S C P ++C +      C CL   IG        C   S C  N  C   QQ C       +D          C   CG +A+C        C C  G++G+PF  C + KR  +    DP +                       + C +N  C +++    C+CLP   G+    C     C +N+ C P N+ C          +KC    P TC +            C C+ G  GD  +SC    + +    C P             +Q  C C P Y G    C     + +E C  +  CVN+KC          V+ C N  +C   A+C        CSC++ + GD                    C        + +Q  P+  C    PC  ++ C  +     C C  G+ G   NC+      P+C  NA C +    CI E   D         SC   A C    H   CTC  G++G+  +              ++  C PS CG NA+C NG C C+P   G+P   C               C R          C   A C V N    C C  GY GN             V  C  + C  N+ C  VN+   C C+PG+ G       +C+S   NS CL     C+ Q        KC      C   CG NA+C     N  C CLP   GNP   C                     C   ++C    +   C C   + G+   C P    N +C  N  C+NQKC                       IC  G  GD    C               S C AN+ C+       C+C  DYF N                  + C   K    C   C +NA+C   N    C C  GF+GD  + C             P      C+P   G    C +   ++IC                CL  F G        C   + C  +  C+    Q+ C    G  G   QC  ++   SP C            C PGF GD    C                    S C P S C  +     C C  +Y          G  P C P+C   A      +C+ +KC +  PG  G    F  +CS        +     C C  G+ G+     ++             C+P PC     CNN +C C     GD  T C    +C +N+ C P  + C+          +C   +  CP  C   A C     I  C C   + G+    C                  S C  NAQC        C C  GY G   NC                     +D C  KC  NAVC      ++C C+P YTGN    C                  + C  N+ C     +  C C Q F G    C+                     DP C  +C + A C       +C C  G++GD    C    R                 C  NA+CR   +  VC   + E+ G+ ++           C  N   +++ CQ+ C P    +   C   N                        H+  C C   +TGN F     +C    +            C P  I        CR  +EKA C       ECLPG+ GN         CT SSDC +     N   +  C+ E          +C   N  P            C C  N+VG+ + QC  P +        +  + C+        IC+  +G                RD   +  +C+ P C  AC   A+C ++ N ++ C C P F G     C                 DC+             C+++ IC           +  C+C  G+ G+  Q   L  C  + +C      A+E   + + +  C  +Q                 C   A+C        +C CL G  GN  ++C         EC     C ++R                     C C  G+SG+  ++C +     + C+++++C  P+K+     +    C     C ++ I      +PL  +            +C C+ GYVG+  I           C   D+C+ +  C+  N               +C+A+   ++ C+C    Q     +     ++         +GC     + +C  +  C+   C+ P          C + + C  NA+C   +    C C  G+ G+    CY +PE  CK N+DC    K C+     + NCV      P T+G+       V+C   A CL+ N    C+C TG  G          C  N DC + +  C+ +                N  C P   Q  C + AIC+ +     C C PGY G+    C    V     QC+ D  C  K   I +    R  D C     C  P + C +  ++      CK P   +  I+  C+P    +  S C  N++C      C +G   D    +R   CG++  C  +    Q         C C  GFQ           ++    P P    C     C   + +C+ E+         C   + CH +   ++  C+C PGY GN             + C++   C  +  C +   A    C P  +   K     C CKPGFS      C+PI CR   +C  + QC     +  C+  D         G +   N     GL   P        C S+ DC  SN  CV +      G+R  C +  I +++       CP++    + +AYC  +  +  CR          C D      CSV   CHP A CS        ++ C C     P   G  R   P     C  D DC D                +NAVC +T     C C+ G+     + C  I C    +CD  + C+ G C                 N C +N+P     P   C    N +A C C  G+  N +  C  I C                       + PC   A C    ++ VC C  D++G+    C+   + +C  D+DCP                           CI ++C      L PC   A+C +          CIC  G+   G   C PT     + GC  ++S C    PT+           KS   S+C+    +P +C   A C I      C C +   GN        EC +  +C  +  C+N+             NA C  + E +  C C  G         +   CR + +CPT K CVN KC
Sbjct: 13701 SCSCLPEFVGAPPNCRPECISNSECPTNQACINQKC----------VDPCPGLCGQNAICRVFSHSAMCLCDGGFTGDPFSQCSPIRDSPPEVLQPCNPSPC---------GVN-----AKCEERG----GAGSCQCLPDYFGNPYDGCRPECVLNSDCPSNQACVNQKCRDPCPGTCGQNAECQVVNHLATCNCLVGYTGDPYSICRITVNEPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIGSPPACRPECTSSSECAADKACVNRKCVDPCPNVCGQQAECRVRNHNPICTCLSGFTGDPFTRCYRQPPPPPVVEREPLDPCVPSPCGANSQCREIHGTPSCSCLPQYLGTPPNCRPECSINAECPSHQACINQKC----------RDPCPG--SCGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLPPEDPCNPSPCGSNTQCNNGVCSCLPEYHGDPYTGCRP--ECVLHTDCDRS-RACVRH--------KCVDPCPGTCGTNAICEVLNHIPNCRCLEGMQGNAFIQCSPVPKLDVVQNPCQPSPCGPNSQCRVVNQQAICSCITSFIGSPPFCRPECTTNSECPLNLACRNQKCSDPCPGVCGRGAQCHVTNHSPFCRCLER--YTGNPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYIGAPPNCRPECVTSSECPTNQACI--QQKC-------RDP---------CPGLCGQSAECRVLSHTPSCVCPEGMEGDPFTLCKE-KRIQELDQLDPCSP----------------------SPCGINARCTSRQDAGSCQCLPDYFGNPYEGCR--PECVLNSDC-PSNKAC--------QQQKCQDPCPGTCGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVKEYVNPCQPSPCGPNSQCREVNEQAICSCLPEYVGAPPVCRPECTISSE-CPADKACVNQKC----------VDPCPN--TCGDQAICRVVNHSPICSCRAGYTGDAFF----------------RCFPKPPVPPTPVQKTPVDPCVP-TPCGPYSQCRSQGDAPACSCLVGYIGAPPNCR------PECRINAECPSSQ-ACINEKCRDPCP-----GSCGYGAICNVINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCNNGVCTCIPEYHGDPYSGCRPECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLCRPECTS---NSECL-SHLACVNQ--------KCN---DPCPGSCGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECPSNLACINQKCRDPCPGLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGANAECIQRNGAGACQCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDPCPGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPPAPEYVNP------CQPSPCGANSQCRESQGQAIC---------------SCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPC---PGACGLNAQC--HVRNHSPLCS-----------CQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYV---------GAAPNCRPECTINAECPSNLACINEKCRDPCPGACG----FAAQCS-------VINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCR--PECVLNSDC-PRNRACV--------NQKC---VDPCPGHCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRPECVSHDECANTLACMNQKCRDP-CPGSCGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPC-PGVCGLEAICTMNN------------------------HIPICSCPPGYTGNAF----AQCTRQVTPPPPSDPCYPSPCGPNSI--------CRIQNEKAVC-------ECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDACVGECG-----FGAVCQTINHSP-----------VCSCPANMVGNPFVQCEEPRQ-------AEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDP-CLNACGINAIC-RAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECA-----ANEACVNQQCVDPCGFTQ-----------------CGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAEC--PSKLACFGGECKNPCDVTHPCGANAICEVVDTLPLRTM------------MCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAI-CSCPERTQGDPFTNCYEPPEIK--------TGCT---HDSECQPTTACINKRCQDP----------CAEANPCAGNAECRVQNSRPICFCPAGWGGDPQVQCY-KPE--CKINADCPY-DKTCL-----NENCV-----DPCTHGQ-------VRCGNGAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCAD-HEACDRL----------------NRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQC-DIPVKTPKPQCIQDADCPSKLACINE----RCADPCATPHVCT-PQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEV-CSNGNCLDACRLER---CGVNAQCTARDHYAQ---------CNCPKGFQGNPRIECYTTEVDVPRIPNP---GCSRNDDCPRDQ-ICRNEICISPCAADDCGIGAYCHVQQRKAI--CRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDC-ASNLACVSNECVSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACINGDCI----------------NPCLINDPCG---PNAECYVQSN-RAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDKTCQNEQCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCP-----------------------GRQACINEQCVDPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCI-SDSDC----PTD-----------KSCLNSVCR----DPCNCGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRNQLCIPACQGEQCGSNAQCL-AIEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKACVNGKC 17368          

HSP 11 Score: 180.644 bits (457), Expect = 3.838e-44
Identity = 889/3760 (23.64%), Postives = 1251/3760 (33.27%), Query Frame = 3
Query: 3261 DKCSMNARCDVSNQR--CICQPGYEGNG-IKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCL-INE-EKCECMERFEGDGFT-------CQDKVDCSS-------------RCGENAFC----YNGTCKCKLGFQGNPLEHCF------DCRVCHYPAYCDIPNRKCIC--------------ITENDIFSRTPCSFSCHPNAKCIK----GRCRCLSNLIGDGTTY-CFNCSSCARNSDCKPEQQ---------TCTCKRGYVKDGNN---CSIISARCHP-ECGVNAQCINGK---CECLAGLQGNPFQQCFDCKRCSQFADCDPW-------------NERCVCQSGYIGNGFT-CTKIINCV---TKCHVNGFCE-----NQECKCLPGLIGDGINF------------------------CFDC--STCDINAFC--EPFNERCVCSVGFTGN-GKKCSIL--------APITCKRACHKKAKCVKGKCECLPGLRGDGVQSC-------FDC-----------------SICDNNTVCYPDQEK--CVCNPGYYGDG----TTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRA-------DICRPTCGENAIC----VNGQCQCQSGLQGNPLKHC-----FDCRP--------CHSFAVCDVENR--RCICQSGFEGDGR--------------------NCKKIKECSPKCHRNAVCINQN----CVCIPEYIGDGINFC--FNCSSCDRNADCEPH----NNRC----------TCYQGFTGNGLTCN---AIELKCEPS---------------CGENAKCV----NGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCV--------------------CKNGYMGNGLTCIS-------------------VNGCNNKCDSNALCV----NRHCICLPGFTGDGTRFCFD--------------CSSCPKNSNCLP--EEQKCICQEGYIMN--GAKCQP--------------IVHECR----PGCGENAKC--VN--GKCECLPGLQGNPMQHCFDCKKCHKFADCDV-------------WNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQKCI--CLPGFIGDGIKFCFDCS----ACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCL----KGNCECLPGFVGDGIQ---VCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKI-GPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQC-VENIEGSSPKCHSNALRVNQQCICLPGFIGDG----KNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGDGIKFCFKCSS----------CDPNA-------DCVPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDGFRCYPVILECPKCHYRAQCVIGKCQCKNGLQGDGI---NFCMNCSECDKNAQCFPNFSK--CECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDEN--LCVCAQGFTGNGIT---------CKAIDPSCNTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGDGFSFCFNCSNCSPNADC--FPHLSKCQCKEEFTGNGFI-CQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYIGNG----FECISITSCTQSSDCIRP------------NEICNVAISQCIC------EANSFL--------DPISKLCINPNCQPPCHPKAVC------VKGKCICNRNLVGDGYQCRAPEECNNDADCV------------------QFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQ----------KPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAICTEKQGCI---CK---SGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCI----YQKCECLPGLVGNGFI---KCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKICITSTDTVKRCVC----KSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGDGIICR----LPDECKSSLDCKYE------------NQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGNGYSGCFDCSKCHANADCDESKGCTCK------PGFEGNGCYCRPEDKCK----FNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNNCVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICIT----QTCYCVPGYFGDGIKSCTSC----------------SVCHKNAQCLPDRG---CVCKSDFIGDGFNCRPLDECRINEDCRDPNKMCLLNPSMKN------------------LQCTCKPLHI--------LINNYCLPKEC-----TSKCHKNAKCE----GGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCK----SGKCVCQGELQGDGIRTCF------------KCSSCHARAVC----SMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQL----GVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVY---------HGLFQGKRCMCRKGFIPKSV---------------FQCIEE----TCPNKCHNFAYCR----QKVCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLI------------GDGRSCKPKD-------QCRIDSDCRDSN------------------AVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCVKQ----------CDRNEECLF----GQCQCKPGFIHNS--------------------NKTCVEP--NDCDVNNPASCK--SPLEVCLGFPNAKAICVCRKGFI---NKFGYCIPINCY-QPCHKNAYCNI----GVCTCNPDYIGDGITSCKKKNLCLEDSDC-------------PIIGS-----KCMTKSNPYSCKCPSGYEIDN-NKCIAKK------------CLLPCDPNAVCVLGECICKVGFTGNGLQ-----------------CMPTSKCNPLSGCSDTNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVCEPSCHPKAACIIGSCICMKPLIGNGITECKLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVDCPTRKICVNSKCICP 12290
            D C+ NA C  SN    C C  G++GNG + C       C     C     K  + L    +N C   S C +NA+C+ +N   +C C+  F G+ +        C+   +C S             +CG  A C    + G CKC  G+ GNP   C       D   C   A C++ N   IC              I E D  +  PC     PN+ C +      C CL    G   +  C   S+    S C P  Q          CTC   YV+  N    C      C P  CG  A C + +   C C     GNPF+ C   K       C P               E C C+SGY+G+ +  C +    V     C  N  C         C C  GL GD  +                         C+D     C   A C  E  +  C C+ G TGN G +C  L         P  C R    K    +  C C+PG  GD    C        DC                 +IC  N +C   Q    C+C  G+ GD         +   +  + C P+    +  C     + GDGV  C  C    P+A     QQ   C+ E VG+      RA       D C  +CG NAIC     N  C C +GL GNP + C      +  P        C + A C  ++    C+C+ G+ GD                      N K ++ C+  C  NAVC   N    C+C   Y GD    C  F     +R   CEP     N+RC          +C   F G    C     +  +C P+               CG  A+C     N  C C    +G+P   C   +  D   D  V    CV                    C   Y+G+   C                      N C N C  NA C     + HC C   + GD    C                 + C +N+ C P     +C C E Y  +     C+P              I   CR      CG NA+C  VN    C C  G +GNP   C           C+               +  C C+ GYFG    C P    + +C ++  C+NQKC+  C+ G  G   K   +      +CPAN    P ++      +   N   C P        S C  N+ C     +  C C PG  G        C     C  N  C   ++RC          + C+ I G  ++C        +  + KC C++ F GD        ++C +  I V D     C     G    C V N  GS              C C+  + GD     +  C   S CP N  C+  + R  C      N    +            HH     Q  C C P   G+ ++ C +  S          C P+          V E+  C C   + G           C+P C     C + +   N   K     +C   ++C    +C      C C  GY GD F                QCV  +   K     D I   N C+  S C  N+QC  + S   C C   Y G    C      + +C     CIN+ C             C     C  NA+C    +  +C+C  G++G+  +          + I P   + C  +ALC +                       +Q A C+       C PE+ GD +            +C P  V  ++C R +          C     C  NA C  F H   C+C   +TGN  + C      P   +     I  +  C+P   G   N   CR  +  A C+       C+P YIG+      EC+S + C Q   C+              N +C V     IC        + F+         PI+   I+P    PC P + C       +  C C ++ VG    CR   EC +D++C                     Q  C  +    + IC+C DG   D   +C           +P     C + AVC K  N    C CLP + GD  T C     C  N+ C++ + C+   C+    G  G   +C V+N     S  +   G  S+  R                L    EP     PC   + C     +  C C+   +G       +C+  SEC +   C +QR      G  G+   C++ +    N  C+ P      S D   RC           S+ + CVP  C          E GVC C+  +VG    CR    +  EC ++L C  E            N  C + ++ S +CTC SG  +  +  +  N Q       R  + C P  C P          G+C C P + G+ YSGC    +C  N+DC   K C  +      PG  G    CR  +             +P   C + P        +    P     C       + D +AV     C C  G+ G+  NC+P  +C  +SDC + N  C+     N+KCV                C   C + A C        C C PG+ GD    CT                  S C  N++CL  RG   C C  D++G   NCRP  EC  + DC  P  +  +N    N                    C C P +         ++     P E       S C  NA C      G C CL  + GD  +  RP EC  ++ C D+   C                   IN+KCQ +PCP  C   A+C+       C C     GD  R+C             K S C   + C    S   C C+ GY+G    C+ E  C   S+C  +N AC       +KC+                CR  CG N++CQ+     +C C+        G++  PI  C+   +  +  + CV            +     C C  G+I +                   C +E     CP  C + A C+      VC C  G++G+ +F C       P    S     +  GPH               DG    P D       +C  + DC                      A+CT+      C C  GY       C P+P   +          C  N  C        C C+ GFI+                      +K CV+P  + C +    + K  SP+  C           C +  I   N      P +C   PC  NA C I      C+C P++IG     C+ +  C+ +S+C             P  GS     KC   ++   C C  GYE D   +C  K+               PC  NA C  GEC C+  + GN  +                 CM     +P  G    N+VC  +   +   C C  GY +      C+                     +KP++ + I E   P  C ++  C++ N        G   C C  G+     +C  + EC V+ +C   + CVN KC+ P
Sbjct: 8295 DPCATNAVCINSNHAADCSCADGFQGNGFVGCQPARSHVCQYNEDCPPT--KLCDRLNRRCINPCQEDS-CGENAECIPVNHGTECRCLPGFLGNAYVQCLPSQGCRSDSECDSSQACINGKCSSPCQCGAYALCDVVNHRGVCKCPPGYNGNPKVGCSPPQDPCDPNPCGLNALCELDNGNPICYCPKGLTGNPFKNCIPEGDECTPNPCG----PNSGCRRVGGNPVCFCLPEYEGQPPSIPCELPSNPCDPSPCGPNTQCSVLSNGFSKCTCLPNYVESPNTIRGCVEPINPCDPNPCGTGAICDSSRHPVCYCPDNKIGNPFRLCD--KPAVTIELCQPGPCGRNAECYVAGNREECYCRSGYVGDAYQGCREPSRTVCDPNPCGPNANCVVAGDGQTACVCPDGLSGDPTSVIGCHGYECQVDADCPNSKACMGYRCYDPCPGACGQGAHCQVEEHHPVCSCNSGLTGNPGIRCYALDHPKKNPCVPSPCGRNSECKLLNNRAVCSCIPGYLGDPQSGCQPECDINSDCGDTLSCINHKCVDPCAGAICGINAICNVRQHTPVCLCLDGFVGDAFLQCVPIGILKNVSRDPCAPSPCGPHDVCS----VYGDGVALCDPCFG--PNA-----QQNPRCRPECVGNSDCPFDRACLGQRCLDPCPGSCGRNAICNVYEHNPVCACPTGLFGNPYEQCTTKSVVETPPQPSCAKLHCGANAECKRQHSGLACVCRKGYFGDPHIGCRPECVLNSDCPAEKACLNSKCVEACTGVCGVNAVCRVVNHAPVCICAEGYSGDASIACNPFYLPPPERPHPCEPSPCGPNSRCKATPDGYAACSCLPNFKGAPPVCQPECVVSSECAPNQACLNQRCTDPCPGICGGGARCEVLNHNPICSCEANFEGDPFVACSPIQ--DPGRDIPVPKNPCVPSPCGPNSICQIKQNRPVCSCVANYIGSPPYCRPECTLSSECPSDKACINEKCQNPCANVCGHNARCTVIAHSAHCSCDEDYEGDAFIGCSKKITERPGDHIDPCYPNPCAENAVCTPYNNAARCTCIEPYNGDPYSTGCRPECIYSSECPSSLACIKQHCRDPCTAACGANAECTVVNHLPSCSCTRGFEGNPFDGCKRVVVVRPETVCEPNPCGPNSICRSVEGHPTCSCQVGYFGAPPQCRPECVVSSECAQHLSCINQKCMDPCV-GTCGFNAKCQVNNHNPICSCPANYEGNPFEQCMPKPAEPTRNVDPCLP--------SPCGSNSICRNVNNRAECSCAPGMFGAPPNCRPECVINQDCPSNRACI--RQRC---------EDPCIGICGFNAVC------STQNHQPKCSCIESFEGDPY------TACKMREIVVLDPPTDPCYPSPCGANAICRVRNGAGS--------------CSCIQNYFGDPYINCRPECVQNSDCPNNRACINMKCRDPCANACGFNAICRVA-----------HH-----QPVCSCEPHLTGNPLRACVERPSNMYLPLPKDPCRPSPCGLFSTCHVVGERPVCACLPDYMG-------APPNCKPECMTSAECPSDRACINQRCKDPCPGTCGYNARC----RCTNHSPICSCYDGYTGDPFH---------------QCVPER---KPPPIADPIVPPNPCVP-SPCGPNSQCQVSSSGAVCSCVTNYIGRPPGCRPECSINSECPARMACINARC----------ADPCI--GSCGNNALCHVSLHAPVCMCEPGYSGDPFSGCYKIIETPIEVIQPCRPSPCGLNALCEER----------------------NQAAACK-------CLPEYFGDPYV-----------ECRPECVINSDCPRSRACVNQKCVDPCPG--MCGHNALCAVFNHAPNCECLPGYTGNPIVGCHIVPESPRYPDP----IVPENPCQPSPCGLYSN---CRPVNGHAVCS-------CVPSYIGSPPNCRPECMSSSECAQDKSCLNERCKDPCPGTCGNNALCRVVNHNPICSCSPGFSGDPFVRCFPQEKRPPITHDRIDPCVPSPCGPNSECRVSAANEQAVCSCLQHYVGRAPNCRP--ECTSDSECPGNLACINLRCRDPCVGTCGIQTTCLVNNH--RPICRCIDGYAGDPFSECSPKINVPVQVAQPCNPSPCGANAVC-KERNGVGSCSCLPEYNGDPYTECR--PECVLNSDCSKNRACLNNKCRDPCPGVCGVSAECHVINHAPSCSCPSGFTGNPSQFCRE------------IPRLPAPVEPCR-PSPCGPYSQCREVNGHAVCSCVTNYIGTPPACRPECSVSSECAQDRACVNQRCADPCPGTCGNEAICKVTNH---NPICSCPAGY---SGDPFVRCAPWQEEPEQPKSNENPCVPSPCGRNSQCRVVGETGVCSCLPNFVGRAPNCRPECTINTECPANLACINERCQDPCPGSCGFNAFC-SVVNHSPICTCDSG--YTGDPFAGCNPQPPAIPDER-LTPCQPSPCGPNAECRERNGAGSCTCLPEYFGDPYSGCR--PECVVNSDCSRDKSCVNQKCVDPCPGVCGLNAQCRVSNHLPSCSCLAGYTGNPSSACREIPQLPP--PPERDENPCRPSPCGPYSQCREVDGHAV-----CSCLQGFIGSAPNCRP--ECIISSDCAQ-NLNCQ-----NQKCV--------------DPCPGTCGIEARCQVINHYPACSCAPGFTGDPFNRCTKILLEPPPTEKSGNPCIPSPCGPNSKCLDVRGSPACSCLPDYLGRPPNCRP--ECLSSADC--PANLACVNQRCSNPCIGACGLHSVCTVIKHRPACECVPGYTGDPFSGCAIVQQIAPPDETRNPCNPSPCGANAICRERNGAGSCACLPEYFGDPYSGCRP-ECVQNDDC-DRSRAC-------------------INNKCQ-DPCPGACGINAECRVLNHGPNCNCFDGYTGDPHRSCSLIEVVTIRPEPCKPSPCGPYSQCLDTNSHAVCSCLEGYIGAPPSCKPE--CVVSSEC-PQNRACI-----NQKCE--------------DPCRGSCGNNAKCQVVNHNPICTCQP-------GMTGDPISGCEPMPEVKNVENPCVPSPCGPNSVCRQIGNQAACSCNAGYIGRPPTCRPECTNNDECQNHLSCQQERCVDPCPGSCGSNAICQVVQHNAVCSCADGYEGEPLFGCQLIPAVTPTESPSSPCEPSPCGPHAECRERNGAGACYCHDGFEGNPYDAQRGCRRECENNDDCTAVQACSRFKCVDPCNNICGDYAICTVDKHVPTCDCPPGYTGDPFFSCKPVPVTPRPPLNPCNPSPCGPNSNCRAMNNQAVCSCQAGFINQPPNCKPECVVSAECAPEKACVHKKCVDPCQHTCGIRAICTTKNHSPICTCPRTMTGDPFVECTRVAITNDNTTPSPAPASCVPSPCGPNAKCQIVGNSPACSCLPNFIG-APPRCRPE--CVLNSECGPTEACINQKCADPCSGSCGFEAKCHVLNHLPICNCIEGYEGDPFVRCTKKEEDRSPPPPNDPCNPNPCGQNADCFAGECRCQNNYQGNAYEGCRPECTLSADCPRDKACMRNRCVDPCPGICGNNAVCEVM--NHIPVCSCVKGY-EGDPFVNCR---------------------VKPVVEDPIIEACSPSPCGSNSQCRDVN--------GHAVCSCLEGYIGAPPQC--RPECVVSSECSALQACVNKKCVDP 11719          

HSP 12 Score: 176.407 bits (446), Expect = 7.166e-43
Identity = 1007/4269 (23.59%), Postives = 1427/4269 (33.43%), Query Frame = 3
Query: 2079 EISKCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGDGINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFT-CIKSCDKICHKDALCQNSRCI---CKPNFEGDGVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLP------KGNCFPPCANHAICTVEN---TCQCRKNYYGNPLEKCNIDCSKCHTDSDCDKTNGYCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGDGVETCFHCSQCDSNAICDQNNKACI---CKSGFEGN-GINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIP-------------RQNTCECNSGFHGDGIQCKLLPLCTPACHPQASCINGNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQR--CICQPGYEGNGIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCSLCDKNAKCLI--NEEKCECMERFEGDGFTCQDK------------------VD-CSSRCGENAFC----YNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFS-CHPNAKCIK----GRCRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQ---------------------------TCTCKRGYVKDGNNCSIISARCHPE-----------CGVNAQCI----NGKCECLAGLQGNPF--------------------QQCFDC--KRCSQFADCDPWNER--CVCQSGYIGNGFT-------------CTKIINCV-TKCHVNGFCE----NQECKCLPGLIGDGINFCFDCS----------------------TCDINAFCEPFNERCVCS--VGFTGNGKKCSILAPITCK-------------RACHKKAKCVKGKCECLPGLRGDGVQSCF-DCSI---CDNNTVCYPDQEKCVCN-PGYYGDGTTCFLFSQLCTEKCHPNAKCV-----NRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQE--CSCKSEFVGDGKICTLRADICRPTCGENAIC-VNGQCQCQSGLQGNPLKHCFDCRP--CHSFAVCDVENRR--CICQSGFEGDG-RNCKKIKE--------------CSPKCHRNAVCINQNCVCIPEYIGDGIN---FCFNCSSCDRNADC------EP---------------HNNRCTCYQGFTGNGLT-CNAIELK-------CEPS-CGENAKCVN----GKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALC-VNRH---CICLPGFTGDGTRFCF-----------DCSSCPKNSNC--LPEEQKCICQEGYIMNGAKCQP---IVHECRPGCGENAKCVNGKCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKK--CVCKNGYFGNGYMC--------------TPINGC-NLKCNENALCVNQ----KCICLPGFIGDGIKFCFDCSACPANSNCVPE---KKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKC----LKGNCECLPGFVGDGIQVCF----------------NCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGD-------GIKTCFNC--SSCSIEAIC--VPDQEKCICKAGFSGNG-EQC--------VENIEGSSPKCHSNALRVNQQ--CICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGDGIKFCFKC----------------SSCDPNADC--VPEQQKCVCKTGFYGNGNKCDK--------------IESTCEPPCAPGGFCNNSK----------CQCNSGLKGDGVTSCF------------NCSKCDVNAKCFP--SVKKCICVIGYKGDGFR-CYPVIL---ECPK----------------CHYRAQCVI----GKCQCKNGLQGDGINFCMNCSE--------------CDKNAQCFPNFSK--CECRQGYRGDGKNCVKIDECSPKCHQNAVCINSNCH-----------------------CLPMYTGNGVSFCFNCAQC------DANAICKPDE-------------NLCVCAQGFTGNGITCKAIDPSC--NTNCHKDALCFKD-----------------------SCICKSGLSGDGKNYCF---------------DCKRCDQNAICRPTEQRCVCKPEFRGDGF-----QCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGDGFSFCFNCSNCSPNA--DCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYIGNG----FECISITSCTQSSDCIRP------------NEICNVAISQCICE------ANSFLD----PISKLC--INPNCQP-PCHPKAVCV----KGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTD-----------------CSGCDKNAICT---EKQGCICKS-GFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQK----CECLPGLVGNGFIKCTN------------CSECHKKALCHDQRG---CVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCE----NGVCKCILGYVGDGII-CRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRS----ALCVI----GTCKCPPSFKGNGYSGCF-------DCSKCHANADCDESKGC---TCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPV--QCDKNAVCLSNNCV-------------------------CKTGYSGTGL------NCKPNDQCSQNSDCPEPNSRCE-----------MMKDYNRKCVCLPGFQDDNG-KCSPKECQPK-CHMFAICITQTCYCVPGYFGDGIKSCTSCSVCHKNAQC-----LPDRG--CVCKSDFIGDG-----------FNCRPLDECRINEDCRDPN--KMCL-LNPSMKNLQCTCKPLHIL-----------INNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQM-INSKCQPEPCPIN--CHPLAQCKSGKCV---CQGELQ-GDGIRTCFKCSSCHARAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNA------ACFP--------------GVDKGKKCQCKPGFSLENSLCSPIACR---PKCGKNSQCQLGV-CVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHG-LFQGKRCMCRKGFIPKSVFQCIE-------ETCPN----------KCHNFAYCRQK----VCQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCT----CPGPHLIGDGRSCKP--KDQCRIDSDCRDSNAVCTLTYDSLKCQCKLGYIKFNNSLCYPIPCV--------KQCDRNEECLFGQCQ---------------------CKPGFIHNS----------------------NKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFI-NKFGYCIPINCYQP--CHKNAYCNIGVCTCNPDYIGDGITSCKKKNLCLEDSDCPIIGSKCMTK-------SNPYS----------CK----CPSGYEIDNNKCIAK-KCLLPCDPNAVC-VLGECICKVGF-----------TGNGLQCMPT--SKCNPLSGCSD----------------TNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVC--EPSCHPKAACIIGSCICMKPLIGNGITECKLPDECSASVHCKNKNAFCKNSTEGQMKCICKH-GFQLENSKCISKQECRVNVDCPTRKICVNSKCICP 12290
            E + C C P FVG+   CR E     +C  + +CVN  C     +     ++C +   C        +   C C  GYTG+ FT C      I           CI   C PN E   +N    CS         P      CRP    +  SEC + L       +  C   C  +A+C+V N    C C   Y GNP   CN    +                          CN +     C   AQC +G+C C P + GD   +C    +C  N  C ++ +AC+   C     G  G+N L  +N            +  C C + ++GN    C       +   C P             +   C C + + G   QC+   +    C     C   N KC +   G           C  NA C+V N R  C C  G  GN        F SC +L +  E              N C   S C  N++C +  +   C C+  F G    C+ +                  VD C   CG+NA C    ++  C C  GF G+P   C   R        D P          ++    PC+ S C  NAKC +    G C+CL +  G+    C     C  NSDC   Q                            TC C  GY  D  +   I+    PE           CG N+QC      G C CL    G+P                     ++C D     C Q A+C   N    C C SG+ G+ FT                +  CV + C  N  C        C CLP  +G   N   +CS                      +C +N  C   N   +CS   G+ G+        PI  K               C    +C  G C CLP   GD    C  +C +   CD +  C   + KCV   PG  G    C + + +      PN +C+     N   +C+     D V      + C P++ C    Q+  CSC + F+G           CRP C  N+ C +N  C+ Q          C D  P  C   A C V N    C C   + G+   +C++I E              C P      V  + +C C+PEYIG   N    C   S C  N  C      +P               H   C C +G  G+  T C    ++       C PS CG NA+C +    G C+CLP   GNP + C     C   +DC   NK C  +             + C   C  NALC V  H   C C+ G++GD  R C              S C  NS C  + E+  C C   Y+     C+P   I  EC      +  CVN KC          +  C +   C   A C V N    C C+ GY G+ +                TP++ C    C   + C +Q     C CL G+IG             A  NC PE     EC  ++   +NEK   P      C   C   A C       +C C PG+ GD    C                 N S C  NA C      C C P Y G+  +  +  PE I                      S D           CF+    +C+  AIC  +     C C  G++GN   QC        V+  + S    +S    VNQQ  C C+PG+IG       +C++   NS+CL     C+ +K    ND      GR  QC    H+        C CLP F G+    C +                 S C PN++C    E   C C   F G+   C                I   C  PC   G C +S           C C++GL GD  T C               S C  NA+C        C C+  Y G+ +  C P  +   +CP                 C   A+C +      C C  G  GD   +C    E              C  N+QC  +  +  C C   + G   +C      S +C  +  CIN  C                        C P +TG+ ++ C            D    C P                 C C   + G    C+   P C  N  C  +  C  +                       SC C +G +GD    C                    C  NA+C     +C C PE+ GD +     +C LN      +DC  N   VN   +C +   G          +C  NA  D   H++ C C E  TGN F+     C+P   +       N C  +P   G    CL+             +  C CL GY G       EC S + C+Q   CI              N +C     +  CE       N+F+     P+ ++   +   CQP PC P + C     + +C C +   G    CR         +CV   E C    + + +  KC+D              C G+C   A C  S ++ + C C  G  GD    C                    S C  NA+C    E   C C    +IG+  +     EC  NS+C   +     CIRS     KCQ                C   C   A+C        C C PG  GN F +CT              S C   ++C  Q     C C  G+ G+ +      +C+L+SDC   ++ CI                  NS CV   C+ +C   A C+    + VC C    VG+  + C  P + +    C+       +   S+ +C   +G    S    ++N      R+      CV   C   C  +    A+C        C CPP F G+ Y+ C           +C ++ DC   K C    C+   E +   C P+ +C      + PL            CVC  G T +    C +LGC    +C  N  C++  CV                         C  GY G  L       C+ +D+C+ +  C   N RCE            ++++  +C C  GF  +   +C     QP+ C M A C ++    +  + G+    C     C  NA C     LP R   C C   ++G+              C   D+C+  E CR  N    CL  +P  ++ QC  +    +             N   P E  + C  +++C+     C++        CQ P  C   NPC    + C++ +   R +C C  G+      +C    C IN  C     C +  CV     G+++ G+G     +C + + +AVC      C  G  GN  +      CQY+ DC D  A       C P              G     +C+C+PG+     +   I  +   P+C +++ C   + C+ +    P      C+P   C   +  P     C   G         C    +PK +  C         E C N          +C   A C  +     C C  GFQG+    C+   V  P     P+ GC+    CP   +  +     P   D C I        A C +      C+C  GY       C P   V          C  NE C+  QC                      CKPGF  N+                      N+ C+ P  C  ++P +  +    C G  N +A C C  G   + F  C+ + C+    C  N  C    C          ++ C ++N C +++ C  +  + + +        NPY+          C+    CPS     ++KC      L PC P A C VL     +              +G   + MP     C     C D                TN+VC      +   C C+ G+ + +  + C+ I C  +  C    ACI G CI            C + D C  +  C  +      S   Q +C+  + G   E  + I    C  N DCPT K C N +C+ P
Sbjct: 13274 EQAVCSCLPLFVGTPPSCRPECTISSECSADRACVNQKC-----VDPCAADTCGNNAICRVRN----HSPICSCISGYTGDAFTRCFLIPPPIIETKDEPLRDPCIPTPCGPNSECRNINGVPACSCLVNFIGQAPN-----CRPECTIN--SECPSQLACINQKCRDPCPGACGQNAVCSVINHTPLCACIDGYIGNPFTNCNPKPPE----------------PPAPPVADDPCNPS----PCGANAQCRNGQCSCIPEYKGDPYVSCR--PECVLNTDCPRD-RACVRNKCIDPCSGTCGVNALCEVNNH----------IPICRCPEQMSGNAFFECRPVPPAKIQNPCQPSPCGPNSQCRVVQQTAVCSCLANYVGSPPQCRPECVTNSDCPADQDC--QNMKCRDPCPG----------TCGFNALCNVVNHRPFCSCPTGMSGNP-------FVSCQQLIIRDE-----------RPQNPC-QPSPCGPNSECRVSGDSPSCSCLPEFVGAPPNCRPECISNSECPTNQACINQKCVDPCPGLCGQNAICRVFSHSAMCLCDGGFTGDPFSQCSPIR--------DSPP---------EVLQ--PCNPSPCGVNAKCEERGGAGSCQCLPDYFGNPYDGCR--PECVLNSDCPSNQACVNQKCRDPCPGTCGQNAECQVVNHLATCNCLVGYTGDPYSICRITVNEPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIGSPPACRPECTSSSECAADKACVNRKCVDPCPNVCGQQAECRVRNHNPICTCLSGFTGDPFTRCYRQPPPPPVVEREPLDPCVPSPCGANSQCREIHGTPSCSCLPQYLGTPPNCRPECSINAECPSHQACINQKCRDPCPGSCGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLPPEDPCNPSPCGSNTQCNNGVCSCLPEYHGDPYTGCRPECVLHTDCDRSRACV--RHKCVDPCPGTCGTNAICEVLNHI------PNCRCLEGMQGNAFIQCSPVPKLDVVQNPCQPSPCGPNSQCRVVNQQAICSCITSFIGS-------PPFCRPECTTNSECPLNLACRNQ---------KCSDPCPGVCGRGAQCHVTNHSPFCRCLERYTGNPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYIGAPPNCRPECVTSSECPTNQACIQQKCRDPCPGLCGQSAECRVLSHTPSCVCPEGMEGDPFTLCKEKRIQELDQLDPCSPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGCR--PECVLNSDCP-SNKACQQQKCQ----------DPCPGTCGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVKEYVNPCQPSPCGPNSQCREVNEQAICSCLPEYVGAPPVCRPECTISSEC----PADKACVNQKC----------VDPCPN--TCGDQAICRVVNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPCVPTPCGPYSQCRSQGDAPACSCLVGYIG-------------APPNCRPECRINAECPSSQ-ACINEKCRDP------CPGSCGYGAICNVINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQC--NNGVCTCIPEYHGDPYSGCR--PECI---------------------TSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLCRPECTS---NSECL-SHLACVNQK---CNDPCPGSCGRNAQCSVVNHNPF------CTCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECPSNLACINQKCRDPCP--GLCGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGANAECIQRNGAGACQCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDPCPGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCR---PECTINAECPSNLACINEKCRDPCPGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCN--NGQCSCLPEYHGDPYTGCRPECVLN------SDCPRNRACVNQ--KCVDPCPG----------HCGLNALCDAVNHIAMCHCPERMTGNAFV----SCQPIRDDPPPPTTPNPC--QPSPCGANAQCLE----------RNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPNCRP--------ECVSHDE-CANTLACMNQ--KCRD-------------PCPGSCGQSAQCTVSLHIPN-CQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYE-GCRPECVGNSECPANQA----CIRS-----KCQ--------------DPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAK-DRACI------------------NSKCV-DACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQ------PSPCRSNGICRVYNGAATCSYPECVINEDCSRDRA------CVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLRQLPEPEPKPECISDGDCTNDKACINQVCRNPCEQSN-ICAPQARCHVQ--LHRPL------------CVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCERPECRSDDECAFHLACR--NERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSK----LACFGGECKNPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTT-ACINK------RCQDP--CAEANPCAGN-AECRVQN--SRPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDPCTHGQVRCGNGA----QCLAQNHQAVC-----ICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEVCSNGNCLDACRLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRI---PNPGCSRNDDCPRDQICRNEICISPCAADDCGI-------GAYCHVQQRKAICRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINP--CLASDPCALNA---ECYGR-NHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNEC----------VSPCGQRNPCAQNAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPDQEACIHAQCRNPCNCGTNAVCQVT--QHRAVCSCQDGF-EGNPYASCRSIGCRVDGECDSGKACINGDCI----------NPCLINDPCGPNAECYVQ------SNRAQCRCLSGYRGNPYERCRVIG---CSSNNDCPTDKTCQNEQCVNP 17118          

HSP 13 Score: 176.022 bits (445), Expect = 8.261e-43
Identity = 691/2809 (24.60%), Postives = 983/2809 (34.99%), Query Frame = 3
Query: 1875 YKCICSPGYSMINNICDKTYSNFKCV-PPCHIDATCYENN---MCICNSGHQGDGXXX-------XXXXXXXXXAEC--YPEISKCKCKPGFVGSGYECREEVNCDIKCHE-----NASCVNGYCKCNRNLIG----DGINSCFDCLKCNTEADCS--PYENRCYCRPGYTGNGFTC---IKSC-DKICHKDALCQNS----RCICKPNFEGDGVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPCANHAICTVENT-----CQCRKNYYGNPLEKC---NIDCS-KCHTDSDCDKTNGYCKCRYGFFGDGFTCNKTCCV---------EKCHEQAQCVDGK----CLCKPGFSGDGVETCFHCSQ------CDSNAIC--DQNNKACICKSGFEGN----GINCLRAINCK------QKCHKQARCLLGK----CICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFH-----GDGIQCK------LLPLCTPACHPQASCINGNCKCNNNLIGDGISSCF--------DCDK------CSMNARCDVSN--QRCICQPGYEGN-----GIKCVKTC-FQSCHKLAVCKEGT----CKCSNGLTGDGVNF---------CFNCSLCDKNAKCLINE----EKCECMERFE--GDGFTCQDKVDCSSR-----CGENAFCYN----GTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCING----KCECLAGLQGNPF--------QQCFDCKRCSQFADCDPWNERCVCQSGYIGNGFTCTKIINCVTK--CHVNGFC---ENQECKCLPGLIGDGINFCFD---CS--TCDINAFC--EPFNERCVCSVGFTGNGKKCS-ILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSICDNNTVCYPDQEK--CVCNPGYYGDGTTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCK-------SEFVGDGKICTLRADICRPTCGENAICVNGQC--QCQSGLQGNPLKHCFDCRPCHSFAVCDVENRRCICQSGFEGDG----RNCKKIKECSPKCHRNAVCI----NQNCVCIPEYIGDGINFCFNCS-------SCDRNADCEPHNNR--CTCYQGFTGNG-LTCNAIELKCEPSCGENAKCVNG----KCECLPGLQGNPLQHC--FNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNN-KCDSNALCVNRHCICLPGFTGDGTRFCFDCS---SCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHEC-RPGCGENAKCVN----GKCECLPGLQGNPMQHCFDCKKCHKFA-DCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVN--QKCICLPGFIGDGIKFCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVG--DGIQVCFNCSTCDKNANCFP--YQERCVCKPRYSG--NGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPD--QEKCICKAG-FSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDC---STCPPNSDCLPQEQRCICK-----KDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDK----CECLPGFIGDGIKFCFKCSSCDPNADCVPEQQKCVCKTGFYGN--GNKCDKIESTCEPPCAPGGFCN--NSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKG-------------DGFRCYPVI-----LECPKCHYRAQCVIGKC--------QCKNG---LQGDGINFCMNCSECDKNAQCF--PNFSKCECRQGYRGDG---KNCVKIDE---CSPKCHQNAVCINSNCHCLPMYTGNGVSFCFNCAQ----------------------------CDANAICKPDE----NLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCF----KDSCICKSGLSGDGKNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDGFQCALN------LKTTCQNDCHPNAVRVNNCCRCKNGFFGDGFSF--------CFNCSNCSPNADCFPHLSKC--QCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRKCHEKATCN--IRSMKCECLPGYIGNGF--------ECISITSCT-----QSSDCIRP---------NEICNVAISQ--CICEANSFLDPI----------------SKLCINPNCQPPCH-PKAVCVKGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDL---------QGQCQKPACNGACHSKAVCVK---------SSNLESRC--------LCLPGFVGDGM--TTCTDCSGCDKNAICTEKQ---GCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIY--PCAKNAVCI----YQKCECLPGLVGNGFIKCT-----NCSECHKKALCHDQRG---CVCSHGYSGDGIQ--CRIEDQCSLNSDCTDPNKICITSTDTVKRC--VCKSSFISSNSGCVPLTCLSKC 9056
            Y+C C PGY              +C   PC  +A C   +    C+C  G+ GD              N C   AEC       +C+C  GFV       +++   +   +      A+ +  Y + +   +     D  N      KC T A C   P   RC C  G+ G G+     I  C D  C ++A+C ++     C CKP++ GD    C D  +C  L +                                 PC  HA+C  ENT     C+C + Y G P  K     +D +  C ++ DC   N  C     F  DGF    + CV         E C   AQC++      C C+ G+ G        C Q      C ++A C  DQN   C+C+ G+  N       C+    C         C + A C        C C  G +G+    C +   C   A         +C +G       G G  C+        P  +  C P  SC + N  C  N I D    C         DC        C  +A+C ++N   +C+C PGY GN     G   +  C    C + A+C        C+C  G +GD             C + + C     C+ +       C C + +E   +   CQD  +CS +     CG NA C N      C+C  G  GNP      C +C+ P        +C C +   +   +     C     C  G   C+S  I  G +YC    +C +    +P+        G   D + C    A+    C   AQC+N      C C  G QG+ +        ++C   + C+    C    E CVC   Y  +     K  +   +  C +N  C   +  +C C  G  GD +  C D   CS   C   A+C  +    +CVC   +TG+  K   I    T K  C     C       L  L G  V  C    +C +N  C  +Q    C C  GY  +G                +  CV+   +C + + GDG             ALC P  +  +CK       + F G G   T +    RP CGE  IC+NG+C  +C+  +             C   A CD  N +CIC+  F G+         +  +CSP C  NA C        C C P   G+    C   S       SC  NA+C    N   C C QGF+GN  + C  ++      CG NA C+N     +C CL G  GNP   C     K C     C   N++  C  GY      C   N C+   C   A+C   +CIC  G+ GD       CS    C  +++CL  E   IC       G   +  V  C +  CG NA CV+      C C  G  GNP      C+       + D       C  GY           GC    N    C+N     +C P  +         C   PA          C CA+ Y  N  + S  ++P L    C  +A C   +  C P  +G    + +C +  TC  N+ C    +Q RC C   + G  N  N  +   +  C N    +      K +  Q     G +   +   C   A+CV +  Q +C C  G F+G+        + S P  +++    +Q C  +        + CFD     +C  N+ CL ++ R +C+     K   + +  C   G        CH  A C        C+C P F+GD      K   C P+  C      C   T   G    N CD         C     C   N K  C+  L+   ++           +KC   V  C   + Y G             DG  C   +     L+  +C     CV G C        +CK     ++   +N C + + C  NA C    + S+C C +G+ G+    + CV++      S +C    +CI + C+ LP       +    C Q                            CD++A C P E      C CA GF G    C  ID      CH  A C        C+C  G  GDG    +    C Q   C         KP+   +   C         L T C  + +  +      C C  GF GD            C +  +C+ +  C    ++C   C     G G  CQ ++ K  C+      + N       +  D   CL  + CH  A CN    S  C+C  G IG+          EC+S   C      Q+S C  P         N  C     Q  C C  NS  DP                  K C++  C  PC  P A     +C   +N +G    C A    +    CVQ Q   +  Q +   I  C  G+   L         +  C +  C G C S + C +         +  LE R          CL    G     + C   + C +NA C  +     C+CK GF GD +      EC  + D                      CS      N  C+ ++C+   PC +NA+C      Q C C PG  G+  ++C        + C   A C + RG   C C  G  GD     CR   +C  N DC  P     T T+ V +C  VC       N+ CVP   +++C
Sbjct:  278 YRCDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDK---------------------------------PCGQHAVC--ENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDC-TNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPR--MACKQPCEDVRCGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGAS--------KCGAGAECVNVPGGGYTCRCPGNTIADPDPSVRCVPIVSC-SANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNLPGSYECRCPQGHNGNPF---IMCEICNTP--------ECQCQSPYKLVGNSCVLSGCSSGQACPSG-AECIS--IAGGVSYC----ACPKGYQTQPD--------GSCVDVDECEERGAQL---CAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGE-CVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLLGCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASN----LACLEGSCVSPCSSL-LCGSNAYCETEQHAGWCRCRVGYVKNG----------------DGDCVS---QCQDVICGDG-------------ALCIPTSEGPTCKCPQGQLGNPFPG-GSCSTDQCSAARP-CGERQICINGRCKERCEGVV-------------CGIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQ-CNERVECPEGYSCQKGQC--KNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSE---IC----FQLGKGLRKCVDACSKIQCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGY-----------GCQASVNGIKECINLCSNVVCGPNEL---------CKINPAG------HAICNCAESYVWNPVVSS-CEKPSL--PDCTSDANCPDAS-ACRPDVLGVLKCVAIC-DAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTL---GCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQ-SVPCVYNHDCPPSQMCNRM-------THTCFDVCDEESCGDNAICLAEDHRAVCQCPPGFKGDPLPEVACTKQGGC--AAGTCHPSAICEVTPEGPVCKCPPLFVGDA-----KSGGCRPDGQCPNGDADCPANTICAGGVCQNPCDNA-------CGSNAECKVINRKPVCSCPLRFQPISDTAKDGCARTISKCLTDV-DCGGALCYNGQCRIACRNSQDCSDGESCLKNVCVVACLDHSQCASGLACVEGHCTIGCRSNKECKQDQSCIENKCLNPCQSANSCGPNALCSIDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCN-LPCTKTASCAVGERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDG----YSQPGCSQPRQCH--------KPDDCANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVGCFKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKGN-CQVRDHKATCACYEGYQLVND------VCEDINECLS-QPCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSV-QNHIG-VCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSI--CSHGICSPLCSTNRDCISEQLCLQGVCQGTCKSNSSCPQFQFCSNNICTKELECRSDSECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDD----------------------CSNDKSCDNHMCK-IACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCDVIDFCRDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDC--PPHAACTKTNGVAKCRDVCAQLQCGPNAECVPKGHVAQC 2840          

HSP 14 Score: 165.622 bits (418), Expect = 1.173e-39
Identity = 808/3305 (24.45%), Postives = 1138/3305 (34.43%), Query Frame = 3
Query: 2703 YCKCRYGFFGDGFTCNKTCCVEKCHEQAQCVDGKCLCKPGFSGDGVETCFHCSQCDSNAICDQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNG-NGVEYCFN---CTSCHLNAKCIPRQN--TCECNSGFHGDGIQCKLL-----PLCTPACHPQASCINGN----CKCNNNLIGDGISSCFDCDK------CSMNARCDVS--NQRCICQPGYEGN-----GIKCVKTCFQS--CHKLAVCK--EGT--CKCSNGLTGDGVNF--CFNC-----SLCDKNAKCLINEE--KCECMERFEGDGFT-CQDKVDCSSR--CGENAFCYN----GTCKCKLGF------QGNPLEHCFDCRVCHY-PAYCDI-PNRKC----ICITENDIFSRTPCSFSCHPNAKCI----KGRCRCLSNLIGDGTTYCFNCSS-----CARNSDCKPEQQT--CTCKRGYVKDG-------NNCSIISARCHPECGVNAQCING----KCECLAGLQGNPFQQCFDCKR------CSQFADCDPWNE----RCVCQSGYIGNGFTCTKIINCVTKCHV---NGFCENQE----CKCLPGLIGDGINF-----CFDCSTCDINAFCEPFNER--CVCSVGFTGNGK----------KCSIL-APITCKRACHKKAKCVKGK----CECLPGLRGDGVQSCFDCSICDNNTVCYPDQEKCVCNPGYYGDGTTCF-----------------LFSQLCTEKCHPNAKC-VNRKCKCNERLVGDGVNFCFNCTSCHPDALCF--PDQQECSCKSEFVGDGKICTLRADI--CRP-TCGENAICVNGQ----CQCQSGLQGNPLKH---------CFDCRPCHSFAVCDVE----NRRCICQSGFEGDGRN--CKKIKECS-----PKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFTGNGL----TCNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWN---KKCVCKNGYMGN-GLTCISVNGCNNK----CDSNALCVNR----HCICLPGFTGD--------GTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHEC-RPGCGENAKCVNG---KCECLPGLQGNPMQHCFDCKKCHKFADCDVWNKKCVCKNGYFGNGYMCTPINGCNLKCNENALCVNQK----CICLPGFIGDGIKF-CFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCLKGNCECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKI--GPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIE--AICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICKKDYFMNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGDGIKFCFKCS-------SCDPNADC--VPEQQKCVCKTGFYGNGN-KCDKIESTCEPPCAPGGFCNNS----KCQCNSGLKGDGVTS--------CFNCSKCDVNAKCFPSVKKCICVIGYKGDGFRCYPVILECPKCHYRAQCVIGKCQCKNGLQGDGINFCMNCS---ECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPKCHQNAVCIN----SNCHCLPMYTGNGVSFCFNCAQ----------------------CDA-------------NAICKPDE---------NLCVCAQGFTGNGITCKAIDPSCNTNCHKDALCFKDSCICKSGLSGDGKNYCF-DCKRCDQNAIC--RPTEQRCVCKPEFRG---DGFQCALNLKTTCQN----------------------------DCHPNAVRVNN----CCRCKNG-FFGDGFSFCFNCSN--CSPNADCFP--------HLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRK--------CHEKATCNI--RSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQPPCHP--------KAVCVKGKCICNRNL--VGDGYQ---CRAPEECNNDADC-------VQFQEVCRKDQ------SSLKKIC--------KCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSN-LESRCLCLPGFVGDGMTTCTDCSGCDKNAICTEKQ---GCICKSGFIGDGR----------QCIVLNECADNSDCTTIR-----GRASECI---RSSEGIQKCQCSQGFKLLNGK-------CEPL-SCIYPCAKNAVCIYQKCECLPGLVGNGFIKCTNCSE-----CHKKALCHDQRG---CVCSHGYSGDGIQ---CRIEDQCSLNSDCTDPNKICITS--TDTVKRCVCKSSFISSNSGCVPLTCLSKCHKYANCENGVCKCILGYVGD----GIICRLPDECKSSLDCK------YENQECVAR-------------LDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALC--VIG--TCKCPPSFKGNGY-SGCFDCSKCHANADCDESKGCTCKPGFEGNGCY--CRPEDKCKFNSDCN----------------DPLKICVQSPDTSRNCVCKPGTTPSTNGKCIIL-GCPVQCDKNAVCLSNN----CVCKTGYSGTG-------LNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCV----CLPGFQDDNGKCSPKECQPKCHMFAICITQTC----------------YCVPGYFGDGI--KSCTSCSVCHKNAQCL-----PDRGCVCKSDFIGDGFN-CRPLDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKE-CTSKCHKNAKCEGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCK----SGKCVCQGELQGD----GIRTCFKCSS-----CHA-----------RAVCSMDGCKCMPGYVGNGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQC-QLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIPKSVFQCIE--ETCPNKCHNFAYCRQKVC 11027
            Y     G+FG        C V +  E  Q  +   LC      DG + CF  +        D+ +K   C +  + +G  C               CL G C CN G  G N V+   N      C + A C       TC C  G+ G+G  C+ +     P     C   A C N      CKC +   GDG   C D D+      C  NA C  +  N  C C  GY GN     G + V  C     C   A+C   EG+  C C  G  GDG +   C +      + C +NA CL  +   +C C + + GD    C+D  +C++   CG  A C N      C+C  GF        + L    + +   Y P   DI P ++     +   + D  ++      C  NAKCI      RC C S   G G  +C N +      C  N+ C     +  CTCK  Y  D        + C+ +       CG +A C N      C+C  G  G P  +   C++      CS   DC    E    +C C  G+   G +C  I  C T   V   +  C N      C+C  G +G          C D   C  +A+C+P      CVC  G+T N            +C ++  P     +C + A C        C C PG  GD    C D   C           +CV  P   G G TC                  + S    E C  N+ C   ++C C E  +G+         +C   A C     Q +C C   + G+  +     DI  CR   C E AIC N      CQC  G  G+P +          C D  PC +   C  +    N  CIC+ G+E +  N  C+ + ECS     P C  NA+C N                              P +  C C QG  GN       CN  E +C+       K V   C          L  C + + C   A+C         C C  GY      +C+ V+ C  +    C   A CVN+     C C  G+ GD          R C     C  N  C+ +  +C+C   Y ++          C R  CG NAKC      +C C  G +G+P+  C D  +C                                +L C   A CVN+K    C+C   + GD  K  C   S  P  S C+       CA +    E  C      +LC S  +   +   G C C  G+V +G            + +C    +  +C     G+G  C+    GP   CP                 QG  G+     F   SCS +  +   P  E+ IC  G      +C E  EG      +   R N +CIC P F+G+            P+  C+P  ++  C                +P C    H      Q +C C PG  G+  + C   S       SC PNA+C  V     C+C  GF GN    C  ++     PC     C N     +C C SG  G+  +S        C + +KC  N       ++  C  GY     +C  +  +   C  RA C  G C C  G  GD  +    CS   +C  +A C  +    +  +G R     C KI     +C  NA+C++    S+C C   + GN  +    C                        C A             N +C P+E          +C CA+ +  N +      PS   +C  DA C  D+  C+  + G  K     D   C  N++C  R  + RC C   F G   D   C    K  C+N                             C P AV V N     C+C  G F GD +     C +  C  N DC P        H     C EE  G+  IC  ++ +  C             C PG  GD    + C K        CH  A C +      C+C P ++G+           +S  C RP+  C    + C         P + +C    CQ PC          K +  K  C C      + D  +    R   +C  D DC        Q +  CR  Q      S LK +C        +C  GL       C +  C   C S   C +  + +E++CL            C   + C  NA+C+  Q    C C  GF G+             C+  N+C     C   +      + + C    R  + + +  C      L G+       C+P       C    +C+  KC+C  G +G  F  C++  E     CH  A C +  G   CVC  G  GDG     C    QC    DC + N  CI    TD     VC    I++N       C S+ H+       +C C  G++GD    G+ C    EC   +DC        E   C+                D    C C  G+Q  ++    +N  +                    CH +A C  + G  +C+CP    G+   +GC D ++C ++ADC  S  C      + + C   C  ++ C  N++C                 DP   CV   + + N  C  G     + KCI     P  C   A C   N    C C+ G +G           C+ + QC+Q S C   +  C  +   NR C+    CL G     G C        C  F  C    C                 C+   +G       C   + C +NA+C+     PD  C+CK  F GD  + CR + EC  ++DC + +K C       N  C    +  LI   C     CT++ H+       +C C  GF GD         C + + C+D                                     C P A+C+    S KC C   L GD    G R+  +C +      HA           R VC+   C      V  G V Q   +  YD    DR A C P       CQ   G    N+ CS   C+P C  +++C    VC     ++P +   +C               N +CV       K+C C +GF   S  +C+     C  +C     CR  +C
Sbjct:   46 YLNLENGYFG--------CQVNESTEYLQLFNLSKLC------DGTQDCFLGA--------DELSKELKCTNDCDKDGTKCTHGA-----------CLNGVCHCNDGYGGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCKDGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYRCDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDGSFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDECNQPDGVAKCGTNAKCINFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDK----PCGQHAVCENTVPGYNCKCPQGYDGKPDPK-VACEQVDVNILCSSNFDCTNNAECIENQCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVR-CGAHAYCKPDQNEAYCVCEDGWTYNPSDVAAGCVDIDECDVMHGPFG---SCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAECVNVP---GGGYTCRCPGNTIADPDPSVRCVPIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQCMLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCKNL-----------------------------PGSYECRCPQGHNGNPFIMCEICNTPECQCQ----SPYKLVGNSCV---------LSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCI-QPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLLGCTDEDECS-------------------------------HLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTP-KSKCLSND---DCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNG------------DGDCVSQCQDVIC-----GDGALCIPTSEGPTCKCP-----------------QGQLGNP----FPGGSCSTDQCSAARPCGERQICING------RCKERCEGVVCGIGATCDRNNGKCICEPNFVGN------------PDLICMPPIEQAKC----------------SPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQCN-------ERVECPEGYSCQKGQCKNLCSQA-SCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCVDACSKI-----QCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNPVVSSCEKPSL-PDCTSDANC-PDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQKHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEESCGDNAICLAEDHRAVCQ------------CPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGPVCKCPPLFVGDA----------KSGGC-RPDGQCPNGDADC---------PANTICAGGVCQNPCDNACGSNAECKVINRKPVCSCPLRFQPISDTAKDGCARTISKCLTDVDCGGALCYNGQCRIACRNSQDCSDGESCLKNVCVVACLDHSQCASGLA------CVEGHCTIGCRSNKECKQDQSCIENKCL----------NPCQSANSCGPNALCSIDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCNLPCTKTASCAVGERCYQQVCRKVCYTSNNCLAGEICNSDRTCQPGCDSDADCPPTELCLTGKCKCATGFIGTPF-GCSDIDECTEQPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCAN-NLACIHGKCTDPCLHTVCG---INAN-------CQSEGHE------ALCSCPAGFLGDPNDTGVGC-FKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINECLSQ-----------------PCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASC------QNSRCRSPCERQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHI-ECADNDDCS-GEKACLDSKCIDPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSIC--SHGICSPLCSTNRDCISEQLCLQGVC--QGTCKSNS---SCPQFQFCSNNICTKELECRSDSECGEDETCLSDAYGRAKCESVCLGRAACGRNAECVARSHAPD--CLCKEGFFGDAKSGCRKI-ECTSDDDCSN-DKSC------DNHMCK---IACLIGQPCGENALCTTEHHQQ------VCHCQPGFSGDPR-----VRCDVIDFCRD-----------------------------------APCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVCAQLQCGPNAECVPKGHVAQCACRSGYDGQPADRVAGCKP---LPSPCQVT-GDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACG-------------QNAECVMQNHL--KQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMC 2963          

HSP 15 Score: 161.77 bits (408), Expect = 1.676e-38
Identity = 990/4212 (23.50%), Postives = 1367/4212 (32.45%), Query Frame = 3
Query: 2085 SKCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGDGINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFT-CIKSCDKI------------CHKDALCQN----SRCICKPNFEGDGVNYC-------FDCSK----------------CHKLAQCHPKT--GNCTCRPPYVGDGVSECETFLPK---------GNCFP-PCANHAICTVEN---TCQCRKNYYGNPLEKCNIDC---SKCHTDSDC---------------------DKTNGYCKCRYGFFGDGFTC---------------NKTCCVEKCHEQAQC--VDG--KCLCKPGFSGDGV---ETCFHCSQCDSNAICDQ---------------------NNKACICKSGFEGNGINCLRAINCKQK-------------CHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECN------SGFHGDGIQCKLLPLCTPACH-PQASCINGNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQ--PGYEGN-------------------------GIKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCF----------------NCSLCDKNAKCLINEEK--CECMERFEGDGFTCQDK----VDCSS---------------RCGENAFCYNGT----CKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFS-CHPNAKCIK----GRCRCLSNLIGDGTTYCFNCSSCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQC--IN--GKCECLAGLQGNPFQQCFDCKR--------------CSQFADCDPWNERCVCQ--SGYIGNGFTCTKIINCVTKCHVNGFCENQEC------------------------KCLPGLIGDGINFCFDCSTCDINAFCEPFNERCV--------------------CSVGFTGNGKKCSILAPITCKRACHKKAKCVKGKC-ECLPGLRGDGVQSCFDCSICDNNTVCYPDQEKCVCNPGYYGDGTT-------CFLFSQLCTEKCHP-----NAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRA--DICRPTCGENAIC-VNGQ---CQCQSGLQGNPLKHCFDCRPCHSFAVCDVENRRCICQSGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGIN---FCFNCSSCDRNADCEP---------------------HNNRCTCYQGFTGNG-LTCNAIELK-------CEPS-CGENAKC-VNG---KCECLPGLQGNP---LQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLTCISVNGCNNKCDSNALC-VNRH---CICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCICQEGYIMNGAKCQPIVHECRPG-CGENAKCVN----GKCECLPGLQGNPMQHC-------FDCKK----------------CHKFADCDVWN--KKCVCKNGYFGNGYMC-----------TPINGCNLK-CNENALC--VNQK--CICLPGFIGDGIKFCFDCSACPANSNCVPE-KKECKCAKDYF-MNEKICSPIKQPVLCTSKCHKNAKCLKGN----CECLPGFVGDGIQVCFN-----------------CSTCDKNANCFPYQ--ERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGS-SPKCHSNALRVNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRC---ICKKDYFMNDTQC---------IHTGRTPQCV--PKCHHYASCVQDKC-----------------------ECLPGFIGDGIKFCFKC------------SSCDPNADC--VPEQQKCVCKTGFYGNGNKCDKIESTCEPPCAPGGFCNNSKCQCN-SGLKGDGVTSCFNCSKCDV-NAKCFPSVKKCICVIGYKGDGFRCYPVILECPKCHYRAQCVIGKC----QCKN--------------GLQGDGINFCMNCSECDKNAQC---------------------FPNFSKCECRQGYRGDG---------KNCVKIDECSPK-CHQNAVCIN----SNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCKAIDPSCNTNCHKDALC----FKDSCICKSGLSGDG---------KNYCFDCKR--CDQNAICRPTEQRCVCK--PEFRGDGFQCA---------------LNLK--TTCQNDCHPNAV-RVNN---CCRCKNGFFGDGFSFCFNCSNC-------SPNADCFPH----LSKCQCKEEFTG----NGFICQRKECKPACS-----EATSLCIKNQCFCR-PGLIGDGYNCLDCRKCHEKATCNI--RSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVAISQCICEANSFLDPISKLCINPNCQP-PCHPKAVCVKGKCICNRNLVGDGYQ-CRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDC-----------SGCDKNAICTE---KQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQK----CECLPGLVGNGFIKCTNCSECHKKALCHDQRGCVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPL-TCLSKCHKYANCENGVCKCI-LGYVGDGIICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCNPKCHRSALCVIGTCKCPPSFKGNGYSGCFDCSKCHANADCDESKGCTCK------PGFEGNGCYCRPEDKCK----FNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPVQCDKNAVCLSNN----CVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICITQT----CYCVPGYFGDGIKSCTSC-----------------SVCHKNAQCLPDRG---CVCKSDFIGDGFNCRPL----DECR-----INEDCRDP-------NKMCLLNPSMKNLQC----------TCKPLHILINNYCLPKEC-TSKCHKNAKCEGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKS----GKCVCQGELQGDGIRTCF---------------KCSSCHARAVC-SMDG---CKCMPGYVGNGIVCQTEDQCQYDSDCRD------------------RNAACFPGVDKGKKCQCKPGFSLENSL-CSPIA-----------CRPK-CGKNSQCQLGVCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGLFQGKRCMCRKGFIP----KSVFQCI----EETCPNKCHNFAYCRQKV----CQCRLGFQGDGVFNCHDCSVCHPNAICSPSLGCTCPGPHLIGDGRSCKPKDQCR---------IDSDCRDSNAVCTLTYDSLKCQC-KLGYIKFNNSLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFI-NKFGYCI---------PINCYQPCHKNAYCNI----GVCTCNPDYIGDGIT-----SCKKKNLCLEDSDCPI------------IGSKCMTKSNPYSCKCPSGYEIDNN--KCIAKKCLLPCDPNAVCVLGEC----ICKV---GFTGNGLQCMPTSKCNPLSGCSD------------TNSVCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVCEPSCHPKAACII-GSCICMKPLIGNGITECKLPDECSASVHCKNKNAFCKNSTEGQMKCICKHGFQLENSKCISKQECRVNVDCPTRKICVNSKCICPEQYTSSPDGKLCE 12329
            + C C   F+G+   CR E + + +C    +C+   C          +N+C    +CN       ++  C C  GYTG+ FT C K  ++I            C  +A+C+       C C P+  GD    C        DC+                 C   A C        CTCR  Y GD    C    P+           C P PC  ++ C   N    C C + Y G P   C  +C   ++C TD  C                        +  C+CR GF GD FT                   C    C   +QC  V G   C C P F G        C   ++C SN  C +                     +   C+C +GF G+  +  R     +              C   A+C  G C C    +G+    C     C LN+ C PR   C  +       G  G+   C ++    P C  P+ +  +   +C+   I   +S+      C  N++C   NQ+ +C   P + G                          G  C  TC    +   V     C C    TG+    C                   S C   ++C    E   C C+E + G    C+ +     DCSS               RCG NA C+  +    C C+ GF G+P   C                 K     EN+I  RTPCS S C PNA C      G C+CL    GD    C     C  +SDC   +    C++   +D          C   CG+NA C  +N    C CL G  G+P++QC                   C   + C   NE+ VC     ++G   +C       ++C  +  C NQ+C                         C+ G  GD    CF      I    EP  + C+                    C V F G    C     I  +  C  +  C+  KC +  PG  G        CS+ ++  +C        C  GY G+  T             +  + C+P     NA+C N +C C     GD         SC P         EC   ++   D + C      D C  TCG NA+C VN     C+C   + GN     F+CRP        ++N    CQ    G    C+ +++        AVC      C+  Y+G        C   S C  + DC+                      H   C+C  G +GN  ++C  + ++       C+PS CG N++C V+G    C CLP   G P      C +   C     C   N+KCV               + C   C  NA+C V  H   C+C  GFTGD    C      P      PE                   ++  C P  CG NAKC      G C+CLP   GNP   C        DC                  C + A+C V N    C C  GY G+ Y               +N C    C  N+ C  VN++  C CLP FIG             +   C PE     +CA D   +N K   P      C + C + A+C   N    C CL GF GD    C+                   S C  N+ C        C C P+Y G   NC    PE                                     CSI A C P  + CI         ++C +   GS       + +     C CL G+IGD  + C          D LP E  C    C  +   N+  C          +TG  P+CV    C    +CV+ KC                        CL G  G+    C               S C PN+ C  V +Q  C C T F G+   C + E T    C     C N KC     G+ G G       ++C V N   F     C C+  Y G+ F     I+E P    R  C+   C    QC+               G   +    C+  SEC  N  C                       +   C C +G  GD          +   ++D CSP  C  NA C +     +C CLP Y GN    C    +C  N+ C  ++    C Q         K  DP C   C ++ALC       SC C SG SGD          K Y   C+   C  N+ CR   ++ +C   PE+ G    C                +N K    C N C   A+ RV N    C C+ G+ GD F  CF            +P   C P      S+C+ + +        G+I     C+P C       ++  CI  +C    PG  G G            A CN+   +  C C PGY G+ F                         SQC         P+    ++  C P PC P A C  G C C     GD Y  CR   EC   ADC + +  C ++        KC D              C G C   A+C   +++   C C  G+ G+    C              S C  N+ C E   +  C C  G+IG    C    EC  NS+C +                          +N KC    C   C +NA C        C CLP   GN F+ C    E  ++ +                   CR    C  NS+C         +      C C   F+ S   C P     S+C     C N  C+    G  G    CR+                    +  + MC C +G                I + +   + C P  C            G C+C   + GN Y GC    +C  N+DC  ++ C  +      PG  G    C   +       F     DP + C Q P+            P     C     P  C  N+ C  +     C C   + GT  +C+P  +C  +++CP            +R C+        N KC    C   C + A C  +     C C PG+ GD +  C                    S C   +QC    G   C C  +++G   NCRP      EC      INE CRDP          C +     +  C          +C+ L            C  S C  NA C  G C CL  + GD     RP               C L SD       C      +N KC  +PCP +C   A C +      C C   + G+   +C                + S C A A C   +G   C C+ GY G    C+ E  C   SDC                     NA C   +     C+C P ++    + C+PI            C+P  CG NSQC             +VNG +                  +C     FQG    CR   +      +   C+     + CP  C   A C   +    CQC +G  GD            P  IC P                  KP+D+ +           S C  +NAVC +  ++  C+C +L YI      C P     +C  N EC              +N+ C+  + C    P  C   LE      N   IC C  G+  N F  C                PC  N+ C I     VC C P + G+ +       C   + C +D  C               G+ C T ++   C CP+   + N   +C   +   P DP   C    C    IC+V     T +  +C+    C+    C               N++C  +   +   C C P +  S      + +   P   PK  CI  G C   K  I      C+ P  C  S  C  + A C       + C+C  G+     +      CR + +C   + CVN +C+ P  +T    G +C 
Sbjct: 12424 AACSCAATFIGTPPSCRPECSINPECPPTKACIRQKCS------DPCVNACGFNARCNVAN----HQPICTCDVGYTGDPFTGCQKEQERIVNEQVTPCEPNPCGSNAVCRERNGIGSCQCLPDHFGDPYQSCRPECVRHSDCASNKACQQQKCRDPCPGTCGSNADCSVTNHLPTCTCRIGYTGDPYRYCHVEPPQLPARVTEPSQPCRPSPCGPNSQCRELNGQAVCSCLELYIGLP-PNCRPECVLSTECPTDKACISQRCQDPCPGTCGINAECRVRNHSPLCQCRQGFTGDSFTRCYPLPPPPPVIERVERDPCLPSPCGLNSQCRNVQGVPSCTCLPDFLGAPPNCRPECTISAECPSNLACIRERCIDPCPGSCGYAAECSVVNHTPICVCPAGFTGDPFSSCRPAPPPEPTQSEYVDPCNPSPCGPNAQCNAGICTCLAEFHGDPYSGCR--PECVLNSDC-PRDKACHSSKCVNPCPGTCGENAICDVINH-IPMCRCPERTAGSAFIRCSPVQIT--VSNPCRPSPCGPNSQCREVNQQAVCSCLPSFIGAPPSCRPECTSNSECAPTQACLNQRCGDPCPGTCGVGANCAVVSHSPFCTCPERFTGNPFIRCQPQIEPPVRDVAPVDPCRPSPCGPYSQCRPVGEAPACSCVETYIGRPPNCRPECVTSSDCSSQLACVNQKCVDPCPGRCGLNAECFVVSHAVQCICQQGFNGDPFVQC-----------------KPEIAYENEI--RTPCSPSPCGPNAVCRDRNGVGSCQCLPQYFGDPYEGCR--PECMLDSDCPSNR---ACQQLRCQDP---------CPGTCGLNANCQVVNHLPTCTCLTGYVGDPYRQCNRLPEPPQNEYVNPCQPTPCGPNSQCRVSNEQAVCSCLPLFVGTPPSCRPECTISSECSADRACVNQKCVDPCAADTCGNNAICRVRNHSPICSCISGYTGDAFTRCFLIPPPIIETKDEPLRDPCIPTPCGPNSECRNINGVPACSCLVNFIGQAPNCRPECTINSE--CPSQLACINQKCRDPCPGACGQNAV----CSVINHTPLC-------ACIDGYIGNPFTNCNPKPPEPPAPPVADDPCNPSPCGANAQCRNGQCSCIPEYKGDPY------VSCRP---------ECVLNTDCPRD-RACVRNKCIDPCSGTCGVNALCEVNNHIPICRCPEQMSGNAF---FECRP---VPPAKIQN---PCQPSPCGPNSQCRVVQQ-------TAVC-----SCLANYVGSPPQCRPECVTNSDCPADQDCQNMKCRDPCPGTCGFNALCNVVNHRPFCSCPTGMSGNPFVSCQQLIIRDERPQNPCQPSPCGPNSECRVSGDSPSCSCLPEFVGAPPNCRPECISNSECPTNQAC--INQKCV---------------DPCPGLCGQNAICRVFSHSAMCLCDGGFTGDPFSQCSPIRDSP------PE-------------------VLQPCNPSPCGVNAKCEERGGAGSCQCLPDYFGNPYDGCRPECVLNSDCPSNQACVNQKCRDPCPGTCGQNAECQVVNHLATCNCLVGYTGDPYSICRITVNEPPERVYVNPCQPSPCGPNSQCREVNEQGVCSCLPEFIG-------------SPPACRPECTSSSECAADKACVNRKCVDP------CPNVCGQQAECRVRNHNPICTCLSGFTGDPFTRCYRQPPPPPVVEREPLDPCVPSPCGANSQCREIHGTPSCSCLPQYLGTPPNCR---PE-------------------------------------CSINAEC-PSHQACI--------NQKCRDPCPGSCGLNTQCSVINHTPICSCLAGYIGDPFSVCNPEPIPEKIRDPLPPEDPCNPSPCGSNTQCNNGVCSCLPEYHGDPYTGCRPECVLHTDCDRSRACVRHKCVDPCPGTCGTNAICEVLNHIPNCRCLEGMQGNAFIQCSPVPKLDVVQNPCQPSPCGPNSQCRVVNQQAICSCITSFIGSPPFC-RPECTTNSECPLNLACRNQKCSDPCPGVCGRG-------AQCHVTNHSPF-----CRCLERYTGNPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYIGAPPNCRPECVTSSECPTNQACIQQKCRDPCPGLCGQSAECRVLSHTPSCVCPEGMEGDPFTLCKEKRIQELDQLDPCSPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGCR--PECVLNSDCPSNK---ACQQQ--------KCQDP-CPGTCGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVKEYVNPCQPSPCGPNSQCREVNEQAICSCLPEYVGAPPVCRPECTISSECPADKACVNQKCVDPCPNTCGDQAICRVVNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPCVPTPCGPYSQCRSQGDAPACSCLVGYIGAPPNCRPECRINAECPSSQACINEKCRDPCPGSCGYG------------AICNVINHTPSCTCPPGYSGDPF-------------------------SQCQPVPPPPPTPVK---LDDPCNPSPCGPNAQCNNGVCTCIPEYHGDPYSGCRP--ECITSADCSR-ELACSRN--------KCFD-------------PCPGTCAPNAICTVLNHV-PMCTCPEGYNGNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLC--RPECTSNSECLS----------------------HLACVNQKCN-DPCPGSCGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQD--------------PCR-PSPCGPNSECR--------AAGETATCTCLGDFVGSPPYCKPECVANSECPSNLACINQKCRDPCPGLCGSSATCRV--------------------VSHTAMCICDAGLTGDP-----FTQCQPIVQDVEIINPCQPSPCGANAECIQRNGAGACQCLTDYFGNPYEGCR--PECVLNSDCPSNRACQQQKCRDPCPGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPP---------APEYVNPCQ----PSPCGANSQCRESQGQAICSCLPEFVGTPPSCRP--ECVISAECP-----------ADRACI--------NQKCQ-DPCPGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPCPGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPE--------------CVLNSD-------CPRNRACVNQKCV-DPCPGHCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLE--CYSSSDCSQVHSCINNKCVDPCPGKCGLNAVCQ-AIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCT------------NVNGQA------------------ECRCLQEFQGTPPNCRPECVSHDECANTLACMNQKCRDPCPGSCGQSAQCTVSLHIPNCQCPVGMTGD------------PFRICLP------------------KPRDEPKPPPTPKNPCYPSPC-GTNAVCRVQGENYVCECSQLEYIGNPYEGCRP-----ECVGNSECP-------------ANQACIR-SKCQDPCPGVCG--LEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDACVGECGFGAVCQTINHSPVCSCPANM-VGNPFVQCEEPRQAEPIDP---CQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNACGINAICRAI--NHKAVCSCPPEFYGSPYAQCLRQL---PEPEPKPECISDGDCTNDKACINQ---VCRNP--CEQSNICAPQ-ARCHVQLHRPL-CVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICR 16100          

HSP 16 Score: 137.887 bits (346), Expect = 2.732e-31
Identity = 915/4002 (22.86%), Postives = 1322/4002 (33.03%), Query Frame = 3
Query: 2088 KCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCKCNRNLIGDGINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKSCDKICHKDALCQNSRCICKPNFEGDGVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSEC--ETFLP----------KGNCFPPC----ANHAICTVEN---TCQCRKNYYGN------PLEKCNI-----DCSKCHTDSDCDKTN--GYCKCRYGFFGDGFTCNKTCCV------------EKCHEQAQCVDGK------------CLCKPGFSGDGVETCFHC--------------SQCDSNAICDQNNKA--CICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICN-KGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGDGI---------QCKLLPLCTPA-CHPQASCIN----GNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVCKE----GTCKCSNGLTGDGVNFCF-----------NCSLCDKNAKCL-INEEK-CECMERFEGDGFTCQDK------------------VD-CSSRCGENAFC----YNGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFSCHPNAKCIKGRCRCLSNLIGDGTTYCFNC-SSCARNSDCKPEQQ---------------------------TCTCKRGYVKD-----------GNNCSIISARCHPE-CGVNAQCINGKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCVCQ--------SGYIGNGFTCTKIINCVTKCH-VNGFCENQECKCLPGLIGDGINFCFDCSTCDINAFCEPFNERCVCS--VGFTGNGKKCSILAPITCKRACHKKAKCVKGKC-ECLPGLRGDGVQSCFDCSICDNNTVCYPDQEKCVCNPGYYGDG-TTCFLFSQLCTEKCHPNAKCVNRKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNGQCQCQ-SGLQGNPLKHCFDCRPCHSFAVCDV--ENRRCICQSGFEGDG--------RNCKKIKECSPK-CHRNAVCINQN----CVCIPEYIGDGINFC-----FNCS------------------SCDRNADCEP--HNNRCTCYQGFTGNGL-------TCNAIEL--KCEPS-CGENAKCVNGK----CECLPGLQGNPL---------------QHCFNCK-------RCDKFADCDVWNKK--CVCKNGYMGNGLTCISVNGCNNKCDSNAL---CV---------------NRHCICLPGFTGDGTRFCFDCS---SCPKNSNCLPEE---------------------QKCICQEGYIMNG-AKCQPIVHE---------CRPG-CGENAKCVNGKCECLPGLQGNPMQHC-------FDCKK----------------CHKFADCDVWN--KKCVCKNGYFGNGYM-CTPINGCNL-----------KCNENALCV----NQKCICLPGFIGDGIK---FCFDCSACPANSNCVPEKKECKCAKDYFMNEKICSPIKQPVLCTSKCHKNAKCL----KGNCECLPGFVGDGIQVCFNCSTCDKNANCFPYQERCVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGEQCVENIEGSSPKCH-SNALRVNQQCICLPGFIGDGKNFCFDCSTCPP-----NSDCLPQEQRCIC---KKDYFMNDTQCIHTGRTPQCV--PKCHHYASCVQDKCE-----------------------CLPGFIGDGIKFCFK------------CSSCDPNADCVPEQQKCVCK--TGFYGN--GNKCDKIESTCEPPCAPGGFCNNSKC-----------------------QCNSGLKGDGVTSCFNCSKCDVNAKCFPSV--KKCICVIGYKGDGFRCYPVILECPKCHYRAQCVIGKCQCKNGLQGDGINFCMNCSECDKNAQCFPNFSKCECRQGYRGDGKNCVKIDECSPK--------CHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDEN--------LCVCAQGFTGNGI-TCKAIDPSCNTNCHKDALCFKDSC-------------ICKSGLSGDGKNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLK---TTCQNDCH---PNAVRVNNC---CRCKNGFFGDGFSFCFNCSNCSPNADCFPHLSKCQCKEEFTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYIGNG-----------FECIS---------------ITSCTQSSDCIRPNE-ICNVAISQCICEANSFLDPISKLCINPNC-QPP-----------CHPKAVCVKGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPAC--NGACHSKAVCVKSSNLESRCLCLPGFV--GDGMTTCTDCSGCDKNAICTEKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQK----CECLPGLVGNGFIKC-----TNCSECHKKALCHDQRGCVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKICITSTDTVKR---CVCKSSFISSNS-GCVPLTC---LSKCHKYANCENGVCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNN------------------QMMIKRSMRAYSGCVPIDCN--PKCHRSALCVIGTCKCPPSFKGNGYSGCFDCSK-----CHANADCDESKGCT--------------------------CKPGFEGNGCY------CRPEDKCKFNSDC-----------NDPLKICVQ--SPDTSRNCVCKPGTTPSTNGKCIILGC--PVQCDKNAVCLSNNCVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVC-----LPGFQDDNGKCSPKECQPKCHMFAICITQTCYCVPGYFGDGIKSCTSCSVCHKNAQC-----LPDRGCVCK------SDFIGDGFNCRP--LDECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCE----GGMCQCLSGFIGDGINCQRPFECGIDNPCK--------DQFSVCQLTS----------DAKRFVCVCVFGFQ-MINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGDGIRTCFKCSSCHARAVCSMDG----CKCMPGYVGNGIV-CQTEDQ--CQYDSDCRDR----NAACFPGVDKGKKCQCKPGFSLENSLCSPIACRPKCGKNSQCQLGVCVCKDGYSPSVNGLSCSP------IDHCQSENDCPDSNHKCVYH--------GLFQGKR-------CMCRKGFIPKSVFQC--IEETCPNKCHNFAYCRQKVCQCRLGFQGDGVFNCHDCSVCHPNAICS--PSLGCTCPGPHLIGDGR------SCKPKDQCRIDSDCRD--------------SNAVCTLTYDSLKCQCKLGYIKFNN----SLCYPIPCVKQCD--RNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEV------CL----GFP----NAKAICVCRKGFINKF-GYCI-----PINCYQ---PCHKNAYCNIGVCTCNPDYIGDGITSCKKKNLCLEDS--DCPI-IGSK------CMTKSNPYSCKCPSGYEIDNNK------------CIAKKCLLPCDPNAVCVLGECICKVGFTGN 11837
             C C P ++G+   CR E + + +C  + +C+N  C+          + C      NT+     +   C C  GY G+ F+       +C+ + + +  R    P    D  N     S C    QC+   G C+C P Y GD  + C  E  L           +  C  PC      +AIC V N    C+C +   GN      P+ K ++       S C  +S C   N    C C   F G    C   C              +KC +    V G+            C C   ++G+   +C                 S C   + C + N++  C C   + G   NC        +C     C+  KC     GL G   E            + +    +C C  G  GD           +   L  C+P+ C   A C +    G+C+C  +  G+    C    +C +N+ C  SN+ C  Q        KC   C  +C + A+C       +C C +G +GD    C              S C  N++C  +NE+  C C+  + G    C+ +                  VD C + CG+ A C    ++  C C+ G+ G+    CF             P   C+          TPC       ++     C CL   IG       NC   C  N++C   Q                            +CTC  GY  D                 +   C+P  CG NAQC NG C C+    G+P+  C     C   ADC   +    C          G       CT ++N V  C    G+  N   +C P      +  C   S C  N+ C   N++ VCS   G+ G    C      T    C     CV  KC +  PG  G   Q    CS+ ++N  C        C P + G+    C    +   +   P   C    C  N      G                  +   C+C  +FVG    C     +    C  N  C+N +C+    GL             C S A C V      CIC +G  GD         ++ + I  C P  C  NA CI +N    C C+ +Y G+    C      N                    SC +NA+C    H   C C+ GF G+            A E    C+PS CG N++C   +    C CLP   G P                + C N K        C   A C V N    C C+ G+ G+ LT            SN +   CV                  C CLP + G       +C+    CP N  C+ E+                       C C  GY  +    C+ +            C+P  CG NA C NG+C CLP   G+P   C        DC +                C   A CD  N    C C     GN ++ C PI                 C  NA C+    N  C CL G+ G        C+  S C    +C+              N K   P      C  KC  NA C     + +CEC+P + G+    C             P   R  C+P   G    C  +  ++ C            +  +  QG   +    C +   C+    C+  + +  C  G  G   QC  ++    P C     +  +   ICLP    + K      + C P     N+ C  Q +  +C   + +Y  N     + G  P+CV   +C    +C++ KC+                       C PG+ G+    C +             S C PN+ C  + +K VC+   GF+GN     C + E T    CA    C NSKC                        C + + G+    C    + +    C PS      IC + Y G     YP  +    C     CV  KC+    L   GIN             C P F      Q  R       ++ E  PK        C  +  CIN  C                   C+ + IC P           LCVC +G+TGN +  C  +    +  C  +  C    C             IC++  +   + +C D  R +    C         +PE R D  +CA +L      C++ C+       RV N    CRC  GF G+    C          D  P   +    +    +   C   ECK  C + T  C              G N +    C    T  +R+M C CLPGY+G               C S               +  C  +S C R  + +     + C C   +  DP +      NC +PP           C P   C+  +C            C     C  +A+C        + Q+S + IC C  G   D Q QC KP C  N  C     C+  + ++    C  G V  G+G      C   +  A+C      IC +G  G+     +   C  N DC                       +    LN  C P+     CA NA+C+ ++    CEC PG  GN  ++C     T   +C + A C  +  C          I  R  D C+    CT P + C       KR   C C    ++  S  CVP+T    +S C   + C N    C  G   D   CRL + C         N +C AR D    C C  GFQ                             +  I R+    S C   DC     CH      I  C+CPP + GN    C   S      C ++ DC  ++ C                           CKPGF GN  +      CR +D+C  +  C           +DP  +  +    +   NC C  G       +C+ L C     C  N  C+SN CV   G           + C+QN+ C          +    + VC     LP   +    C P+  +P C     C ++   C+     D    C+  S CH  AQC     +P R  VC+       D  G      P  L  C  ++DC D  + C+               H    N C        C  NA C+      +C C  GF G+     R   C +D  C         D  + C +             + R  C C+ G++     +C+     I C     C + K  CQ E     +  C   + C  RA C        C+C   ++GN  V C+   Q  CQ D+DC  R    N  C       + CQ +P    E +  SP+            +  +C+C DGY     G  C P      +  C S++DCP ++  C+          GL    R       C CR+GF     F+C  IE +  + C     CR ++C      QG+   +   C      A+C   P  G         G+ R       C+  D+C  D  C +               + +C + +   +C C  G +   N        PI C+   D    + CL G+C      ++  N T      C VN   S +  L V      CL    G P    + +++CV  KGF+    G C+      ++ Y+   PC +     I       D  G  + + ++  +  E     CPI +G +      C  +  P   +C S  +  +N+            C+ K C +    NAV    +C C  G+TGN
Sbjct: 14023 SCSCLPQYLGTPPNCRPECSINAECPSHQACINQKCR----------DPCPGSCGLNTQCSVINHTPICSCLAGYIGDPFS-------VCNPEPIPEKIR---DPLPPEDPCNP----SPCGSNTQCN--NGVCSCLPEYHGDPYTGCRPECVLHTDCDRSRACVRHKCVDPCPGTCGTNAICEVLNHIPNCRCLEGMQGNAFIQCSPVPKLDVVQNPCQPSPCGPNSQCRVVNQQAICSCITSFIGSPPFCRPECTTNSECPLNLACRNQKCSDPCPGVCGRGAQCHVTNHSPFCRCLERYTGNPFVSCQQIIEPPVPPPRQTCLPSPCGPYSQCREVNESPSCTCLPEYIGAPPNCRPECVTSSECPTNQACIQQKCRDPCPGLCGQSAE-----------CRVLSHTPSCVCPEGMEGDPFTLCKEKRIQELDQLDPCSPSPCGINARCTSRQDAGSCQCLPDYFGNPYEGCRP--ECVLNSDCP-SNKACQQQ--------KCQDPCPGTCGQNALCNVLNHIPSCSCISGYSGDPYRSCVPEPVKEYVNPCQPSPCGPNSQCREVNEQAICSCLPEYVGAPPVCRPECTISSECPADKACVNQKCVDPCPNTCGDQAICRVVNHSPICSCRAGYTGDAFFRCFPKPPVPPTPVQKTPVDPCV---------PTPCGPYSQCRSQGDAPACSCLVGYIGAPP----NCRPECRINAECPSSQACINEKCRDPCPGSCGYGAICNVINHTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCNNGVCTCIPEYHGDPYSGCR--PECITSADC---SRELACSRNKCFDPCPGTCAPNAICT-VLNHVPMCTCPEGYNGNAFVQCKPTPPPALVQPCQP-SPCGPNSQCREVNQQAVCSCVPGYIGTPPLCRPEC--TSNSECLSHLACVNQKCNDPCPGSCGRNAQ----CSVVNHNPFC-------TCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAG------------------ETATCTCLGDFVGSPPYCKPEC-VANSECPSNLACINQKCRDPCPGL-------------CGSSATCRVVSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGANAECIQRNGAGACQCLTDYFGNPYEGCRPECVLNSDCPSNRACQQQKCRDPCPGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLPVPPPQPPKSNDIRDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPCPGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCRPECVLNSDCPRNRACVNQKCVDPCPGHCGLNALCDAVNHIAMCHCPERMTGNAFVSCQPIRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLECYSSSDCSQVHSCI--------------NNKCVDP------CPGKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPR-----VPEPVRDPCQPSPCGPNSQCTNVNGQAEC------------RCLQEFQGTPPNCRPECVSHDECANTLACMNQKCRDPCP-GSCGQSAQCTVSLH--IPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNP----YEGCRPECVGNSECPANQACIRSKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGC-RPECTLSSDCAKDRACINSKCVDACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRV-YNGAATCSYPECVINEDCSRDRACVSQKCR-DPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCLR-------QLPEPEPKPECISDGDCTNDKACINQVCR----------------NPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCYLLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAICRADFNHRARCHCLDGYRGNPLVRCE--------RPECRSDD-ECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAVRC----------DLVPTQPEGCTMDAECPSKLACFGGECKNPC-DVTHPC--------------GANAI----CEVVDTLPLRTMMCSCLPGYVGEADIGCHKEPPRDQGCTSHDQCQDTEACRGGNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFT------NCYEPPEIKTGCTHDSECQPTTACINKRC---------QDPCAEANPCAGNAEC--------RVQNS-RPICFCPAGWGGDPQVQCYKPECKINADCPYDKTCLNENCVDP---CTHGQVRCGNGA----QCLAQNHQAVC------ICPTGTQGNPFISCITGHCQYNEDCAD--------------------HEACDRLNRVCRPVCDQETCALNAICVGRRHQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCPSKLAC----------INERCADPCATPHVCT-PQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPITVPKVISGCQHNSECANTEV-CSNGNCLDA--CRL-ERCGV-------NAQCTAR-DHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADDCGIGAYCHVQQRKAI--CRCPPGYTGNPQERCLPPSDVILVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPFVRCLRLECHSDYDCASNLACVSNECVSPCGQ---------RNPCAQNAIC----------QALQHRAVCRCPDQLP-LGNPYAYCEPRPVEPVCRDDGDCPSKL-ACIDDKCQD---PCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPD-QEACI---------------HAQCRNPC-------NCGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACINGDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRV----IGCSSNNDCPTDK-TCQNE---QCVNPCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACINEQCVDPCVVLEPCQ-RPAI-CEVTPTSPV------------RTMLCICPDGYVSRGKG-GCKPTPGIKEVGGCISDSDCP-TDKSCLNSVCRDPCNCGLNAECRIKDHKPVCTCRQGFEGNPEFECSKIECSINSDCPGTHVCRNQLCI--PACQGEQCGSNAQCLAIEHRAVCECIPGHG---------GNARIACTPLGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPI-CISDADCPSQKACLRGEC------VNPCNAT----QPCGVNAFCSVRDTLPVRTMICECLEGYTGNPAVQCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRI-------DESGHCVCALERGMVIDERGRCTCPIDLGYRLTPRGECQPEEPP---ECTSNDQCADNRFCNLDTKTCEDPCLTKVCGVNAFCNAVNHRAQCQCITGYTGN 17618          

HSP 17 Score: 123.635 bits (309), Expect = 5.311e-27
Identity = 759/3336 (22.75%), Postives = 1092/3336 (32.73%), Query Frame = 3
Query: 2079 EISKCKCKPGFVGSGYECREEVNCDIKCHENASCVNGYCK------CNRNLIGDGINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIKSC---------------DKICHKDALCQNSRCICKPNFEGDGVNYCFDCSKCHKLAQCHPKTGNCTCRPPYVGDGVSECETFLPKGNCFPPC----ANHAICTVEN---TCQCRKNYYGNPLEKCNI----------DCSKCHTDSDCDKTN--GYCKCRYGFFGDGFTCNKTC--------------------CVEKCHEQAQCV----DGKCLCKPGFSGDGVETCFHCSQCDSNAICDQN-------NKACICKSGFEGNGINCL-----RAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNCTSCHLNAKCIPRQNTCECNSGFHGDGI-QCK-------LLPLCTPA-CHPQASCIN----GNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNGIKCVKTCFQSCHKLAVC----KEGTCKCSNGLTGDGVNFCFNC--------------SLCDKNAKCLINEEK--CECMERFEGDGFTCQ-----------DKV--------DCSSRCGENAFCY----NGTCKCKLGFQGNPLEHCFDCRVCHYPAYCDIPNRKCICITENDIFSRTPCSFS-CHPNAKC--IKG--RCRCLSNLIGDGTT---YCFNCSSCARNSDCKPEQ---------------------QTCTCKRGYVKDG-NNCSIISAR---------CHPE-CGVNAQCINGKCECLAGLQGNPFQQCFDCKRCSQFADCDPWNERCVCQ------SGYIGNGFTCTKIINCVTKCH-VNGFCENQECKCLPGLIGDGINFCFDC-----STCDINAFCEPFNERCVCS--VGFTGNGKKCSILAPITCKRACHKKAKCVKGKCECLPGLRGDGVQSCFDCSICDNNTVCYPDQEK--CVCNPGYYGDG------TTCFLFSQLCTEKCHP-----NAKCVN----RKCKCNERLVGDGVNFCFNCTSCHPDALCFPDQQECSCKSEFVGDGKICTLRADICRPTCGENAICVNG----QCQCQSGLQGNPLKHCFD-----------------CRPCHSFAVCDVENRRCICQ--------SGFEGDGRNCKKIKECSPK---------------CHRNAVCINQN----CVCIPEYIGDGINFCFN------------CSSCDRNADCEPHNNR--CTCYQGFTGNGLTCN-AIELKCEPSCGENAKCVNGKC-----------------------ECLPGLQGNPLQHCFNCKRCDKFADCD-----------VWNKKCVCK------NGYMGNGLTCISV---NGCNNKCDSNALC--VNRH--CICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQ---KCICQEGYIMNGAKCQPIVHECRPGCGENAKCVNGK----------CECLPGLQGNPMQHCFDCKKCHKFADCDV----WNKKCVCKNGYF--GNGYMCTPINGCNLKCNENALCVNQKCICLPGFIGDGI----------------------KFCFDCSACPANSNCVPE--KKECKCAKDYFMNEKI-CSPIK-QPVLCT--SKCHKNAKCLKGNCECLPGFVGDGIQVCFNCSTCDKNANC-----FPYQER-CVCKPRYSGNGENCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNCSSCSIEAICVPDQEKCICKAGFSGNGE---QCVENIE-----GSSPKCHSNALRVNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRCICK-KDYFMNDTQCIHTGRTPQCV-PKCHHYASCVQDKCECLPGFIGDGIKFCFKCSSCDPNADCVPE--QQKCVCKTGFYGNG------------------NKCDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKKCICVIGYKGDG-FRC-YPVILECPKCHYRAQCVIGKCQCKNGLQGD---GINFCMNCSECDKNAQCFPNFSKCECRQGYRGD-GKNCVKIDECSPK----CHQNAVCINSNCHCLPMYTGNGVSFCFNCAQCDANAICKPDENL--CVCAQGFTGNG-ITC--------KAIDPSC--NTNCHKDALCFKDSCI--CKSGLSGDGKNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGDGFSFCFNCS-----NCSPNADCFP--HLSKCQCKEEFTGNGFI------------------CQRKECKPACSEATSLCIKNQCF---------CRPGLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYI-GNGFECIS---ITSCTQSSDCIRPNEICNVAISQCICE-------ANSF-------LDPI--------SKL-CINPNCQ------PPCHPKAVCVKGKCICNRNLVGDGYQCRAPEE--------------CNNDADCVQFQEVCRKDQ---------------SSLKKICKCKDGLVRDLQGQCQKPAC--NGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAIC---TEKQGCICKSGFIGDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIY--PCAKNAVCIYQK----CECLPGLVGNGFIKCTNCSE--CHKKALCHDQRGCVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKICITSTDTVKR--CVCKSSFIS-SNSGCVPLTCL---------SKCHKYANCENGVCKCILGYVGDGIICRLPDECKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPIDCN-----PKCH--RSALCVIGTCKCPPSFKGNGYSGCFDCSKCHANADC---DESKGCTCKPGFEGNG------CYCRPEDKCK-----FNSDCNDP---LKICVQSP-----DTSRNCVCKPGTTPSTNGKCIILGCPV-----QCDKNAVCLSNNCVCKTGYSGTGLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDNGKCSPKECQPKCHMFAICITQ---------TCYCVPGYFGDGIKSCTSCS-------------VCH-KNAQCLPDRG-CVCKSDF---IGDGFNCRPLD--ECRINEDCRDPNKMCLLNPSMKNLQCTCKPLHILINNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGD 10271
            +   C C  G++G+   CR E   + +C  + +C+N  C+      C    I + IN                +   C C PGY+G+ F+  +                    C  +A C N  C C P + GD                  P +G   CRP  +       E    +  CF PC    A +AICTV N    C C + Y GN   +C              S C  +S C + N    C C  G+ G    C   C                    C   C   AQC     +  C C P F+G+    C    +     I  Q+            C++  E     CL         CK +C   + C       N+         C +  +C +    +     C C++G  GD   QC+       ++  C P+ C   A CI     G C+C  +  G+    C    +C +N+ C  SN+ C  Q        KC   C  SC + A C        C C  G  GD   +C                 S C  N++C  ++ +  C C+  F G   +C+           D+          C   CG NA C+    +  C C+ GF G+ L  C                        NDI  R PC  S C P ++C  + G   C CL N +G        C   + C  N  C  E+                      +C+C  GY  D   +C ++            C P  CG NA C NG+C CL    G+P+  C     C   +DC P N  CV Q       G+ G    C   +N +  CH       N    C P  I D             S C  NA C   N   +CS   G+ G    C +         C +   C+  KC          V  C     C  N VC   Q +  C C P Y G+              +   + C P     N++C N     +C+C +   G   N       C P+ +   +     C +      + C    D C  +CG++A C        CQC  G+ G+P + C                     PC + AVC V+    +C+        + +EG    C    EC                  C   A+C   N    C C P Y G+    C               S C  N+ C   N +  C C  GF GN L      E      C ++  C+N KC                        C   + GNP   C   ++ +    C            V+N    C       N        C+S    + C N C  NA+C  +N    C C P F G     C            LPE +   +CI  +G   N   C  I   CR  C ++  C              C C  G  GN +Q+C+    C    +C       N++CV   G+   G G +C          N  A     +C CL G+ G+ +                      + C D   C   + C  E  + +C+C   +  N  + C  +  QP  CT  ++C     C  G C+            C     C  NA C      P +   C C P Y G  +    IG     P      +    +  +  +G  G+ +  C + S C+  A C+  Q + IC       G+    C E  E         +C      +N++C          ++ C + + C  N++C  Q  R IC     +  D Q        QC  P+C   A C  DK       +        +C +    A C+ +  Q  C+C TG  GN                     CD++   C P       C+   C  N+   G                       +C C  GY+G+   +C  PV    P+C   A C   K  C N    D     + C     C            C+C      D  +NCV I    PK    C  N+ C N+         GN +  C    +C  NA C   ++   C C +GF GN  I C        +  +P C  N +C +D +C  + CI  C +   G G  YC   +R    AICR       C P + G+            Q  C P +  +     CK+         C N       NC PNA+C    H   C CK  F+GN                     C  +EC   C  +    +  +C+         C  GL GD +               +R ++ EC   Y   +   C+S   ++ C Q + C + N IC     + +C         N +       ++P+        SKL CI+  CQ       PCHP A C     +  R +V +  +   P+               C +D DC   QE C   Q               +  + +C C+DG   +    C+   C  +G C S   C+                GD +  C     C  NA C   + +  C C SG+ G+  +   +  C+ N+DC T +               CQ  Q             C+Y  PCA  A C  Q     C C    +GN ++ C    +  C     C  ++ C+          QC   D C +   C  P    +T T  V+   C+C   ++S    GC P   +         S C    +C N VC+               D C   L     N EC  + D   +CTC+ GF+   E                    C  I+C+     P  H  R+ LC+       P+ +G          +C +NA C   +    C C PG  GN         CR +D+C       N  CNDP     +C Q            C C PGT P  NG       P+      C     CL   CV           C     C  N+ C    S  + +      C CL G+  +           +C   ++C+ +          C C PG   D  + CT C              VC  +    + +RG C C  D    +     C+P +  EC  N+ C D N+ C L+        TC+       + CL K C      NA      CQC++G+ G+
Sbjct: 14656 DAPACSCLVGYIGAPPNCRPECRINAECPSSQACINEKCRDPCPGSCGYGAICNVIN----------------HTPSCTCPPGYSGDPFSQCQPVPPPPPTPVKLDDPCNPSPCGPNAQCNNGVCTCIPEYHGD------------------PYSG---CRPECITSADCSRELACSRNKCFDPCPGTCAPNAICTVLNHVPMCTCPEGYNGNAFVQCKPTPPPALVQPCQPSPCGPNSQCREVNQQAVCSCVPGYIGTPPLCRPECTSNSECLSHLACVNQKCNDPCPGSCGRNAQCSVVNHNPFCTCLPRFTGNPFVGCQQIIEPPRQDIVPQDPCRPSPCGPNSECRAAGETATCTCLGDFVGSPPYCKPECVANSECPSNLACINQKCRDPCPGLCGSSATCRV----VSHTAMCICDAGLTGDPFTQCQPIVQDVEIINPCQPSPCGANAECIQRNGAGACQCLTDYFGNPYEGCRP--ECVLNSDCP-SNRACQQQ--------KCRDPCPGSCGQNAECNVVNHTPMCNCFAGFIGDPYRYCSQPPEPPAPEYVNPCQPSPCGANSQCRESQGQAICSCLPEFVGTPPSCRPECVISAECPADRACINQKCQDPCPGACGLNAQCHVRNHSPLCSCQPGFTGDALTRCLP-------------VPPPQPPKSNDI--RDPCVPSPCGPYSQCRVVNGGASCSCLPNYVGAAPNCRPECTINAECPSNLACINEKCRDPCPGACGFAAQCSVINHTPSCSCPAGYTGDPFTSCRVLPPPPPPKTPSDPCQPSPCGANALCNNGQCSCLPEYHGDPYTGCR--PECVLNSDC-PRNRACVNQKCVDPCPGHCGLNALC-DAVNHIAMCHCPERMTGNAFVSCQP--IRDDPPPPTTPNPCQPSPCGANAQCLERNGNAICSCLAGYFGQPPNCRLEC--YSSSDCSQVHSCINNKC----------VDPCP--GKCGLNAVCQAIQHRAHCECIPRYTGNAFVQCNPIPVPRVPEPVRDPCQPSPCGPNSQCTNVNGQAECRCLQEFQGTPPN-------CRPECVSHDE-----CANTLACMNQKC---RDPCPGSCGQSAQCTVSLHIPNCQCPVGMTGDPFRICLPKPRDEPKPPPTPKNPCYPSPCGTNAVCRVQGENYVCECSQLEYIGNPYEGCRPECVGNSECPANQACIRSKCQDPCPGVCGLEAICTMNNHIPICSCPPGYTGNAFAQCTRQVTPPPPSDPCYPSPCGPNSICRIQNEKAVCECLPGFFGNPLAQGCRPECTLSSDCAKDRACINSKCVDACVGECGFGAVCQTINHSPVCSCPANMVGNPFVQCEEPRQAEPIDPCQPSPCRSNGICRVYNGAATCSYPECVINEDCSRDRACVSQKCRDPCLNACGINAICRAINHKAVCSCPPEFYGSPYAQCL---------RQLPEPEPKPECI-SDGDCTNDKAC--INQVCRNPCEQSNICAPQARCHVQLHRPLCVCNEGYTGNALQNCY-LLGCRSDGECAANEACVNQQCVDPCGFTQCGTGAIC------RADFNHRA-----RCHCLDGYRGNPLVRCERPECRSDDECAFHLACRNERCEDPCNCGIGAQCRVENHRAQCRCPAGFSGNPAVRCDLVPTQPEGCTMDAECPSKLACFGGECK----------NPCDVTHPCGANAICEVVDTLPLRTMMCSCLPGYVGEAD----IGCHKEPPRDQGCTSHDQCQDTEACRG--GNCVNPCLDASPCARSAQCLAQQHRAICSCPERTQGDPFTNCYEPPEIKTGCTHDSECQPTTACINKRC----------QDPCAEANPCAGNAECRVQNSRPICFCPAGWGGDPQV-------QCYKPECKINADCPYDKTCLNENCVDPCTHGQVRCGN---GAQCLAQNHQAVCICPTGTQGNPFISCITGHCQYNEDCADHEACDRLNRVCRP------VCDQETCALNAICVGRR------------------HQPQCECRPGYQGNPHVQCDIPVKTPKPQCIQDADCP-SKLACINERCADPCATPHVCTPQQTCTVLDTLPKRAMACKCPGDTVTDISRNCVPIT--VPKVISGCQHNSECANTEV----CSNGNCLDAC-RLERCGVNAQCTARDHYAQCNCPKGFQGNPRIECYTTEVDVPRIPNPGCSRNDDCPRDQICRNEICISPCAADDCGIGA-YCHVQQR---KAICR-------CPPGYTGNP-----------QERCLPPSDVI--LVGCKSSTDCPSNEACINTQCASPCNCGPNAECTVKNHHPICYCKPGFSGNAQFGCAPIGCRSDDECSGDKQCVNRECINPCLASDPCALNAECYGRNHRANCRCPVGLEGDPF---------------VRCLRLECHSDYDCASNLACVSNECVSPCGQRNPCAQ-NAICQALQHRAVCRCPDQLPLGNPYAYCEPRPVEPVCRDDGDCPSKLACIDDKCQDPCSVLSPCHPTAQCSVLNSVPVRTMVCECAEYEVPDASGACRKMMPPRLPGCESDQDCPD-QEACIHAQCRNPCNCGTNAVCQVTQHRAVCSCQDGFEGNPYASCRSIGCRVDGECDSGKACIN---------------GDCINPCLINDPCGPNAECYVQSNRAQCRCLSGYRGNPYERCRVIGCSSNNDCPTDK--------------TCQNEQCVN---------PCVYHNPCAPRAECRAQNHLAVCRCPVDFLGNPYVDCRPPPQPICQLDTDCPGRQACI--------NEQCV--DPCVVLEPCQRPAICEVTPTSPVRTMLCICPDGYVSRGKGGCKPTPGIKEVGGCISDSDCPTDKSCLNSVCR---------------DPCNCGL-----NAECRIK-DHKPVCTCRQGFEGNPEFE------------------CSKIECSINSDCPGTHVCRNQLCI-------PACQGE---------QCGSNAQCLAIEHRAVCECIPGHGGNARIACTPLGCRSDDECPTDKACVNGKCNDPCTTTALCAQDELCKVYHHRPQCACPPGTVPGKNGCESERHIPICISDADCPSQKACLRGECVNP---------CNATQPCGVNAFC----SVRDTLPVRTMICECLEGYTGNPAV--------QCDKRSLCVIEKGFVRDVDGQCVCPPGTALDIYEYCTPCREEQGFRIDESGHCVCALERGMVIDERGRCTCPIDLGYRLTPRGECQPEEPPECTSNDQCAD-NRFCNLDTK------TCE-------DPCLTKVCGVNAFCNAVNHRAQCQCITGYTGN 17618          

HSP 18 Score: 122.479 bits (306), Expect = 1.246e-26
Identity = 701/2879 (24.35%), Postives = 1002/2879 (34.80%), Query Frame = 3
Query: 1860 MSSAPYKCICSPGYSMINNICDKTYSNFKC-VPPCHIDATCYENN---MCICNSGHQGD--------------GXXXXXXXXXXXXAECYPEISKCKCKPGFVGSGY--ECREEVNCDIKCHENASCVNGYCKCNRNLIGD---------GINSCFDCLKCNTEADCSPYENRCYCRPGYTGNGFTCIK---SCDKICHKDALCQN-----SRCICKPNFEGDGVNYCFDCSKCHKL--------AQCHPKTGNCTCRPP--YVGDGVSE-CETFLPKGNCFPPCANHAICTVENTCQCRKNYYGNPLE--KCNIDCSK--CHTDSDCDKTN-GYCKCRYGFFGD---GFTCNKTCCVEKCHEQAQCVDGK----CLCKPGFSGDG------VETCFHCSQCDSNAICDQNNKACICKSGFEGNGINCLRAINCKQKCHKQARCLLGKCICNKGLNGNGVEYCFNC---TSCHLNAKCIPRQN--TCECNSGFHGD---GIQCKLLPLCTPA--CHPQASCINGNCKCNNNLIGDGISSCFDCDKCSMNARCDVSNQRCICQPGYEGNG----------IKCVKTCFQSCHKLAVCKEGTCKCSNGLTGDGVNFCFNCS-------LCDKNAKC--LINEEKCECMERFEGDGFT-CQDKVDCSSR-CGENAFCYNGT----CKCKLGFQGNPLEHC--FDCRVCHYPAYCDIPNRKCICITENDIFSRTPC-----SFSCHPNAKCIKGRCRCLSNLIGDGTTYCFNCS---SCARNSDCKPEQQTCTCKRGYVKDGNNCSIISARCHPECGVNAQCIN----GKCECLAGLQGNPFQQCFDCK----------RCSQFADCD----------------------------------PWNERCVCQSGYIGNGFTCTKIINCVTKCHVNGFCENQECKCLPGLIG--DGINFCFDCSTCDINAFC--EPFNERCVCSVGFTGNGKKCSILAPITCKRACHKKAKCVKGK-CECLPGLRGDGVQSCFDCSICDNNTVCYPD--QEKCVCNPG-YYGDGTTCF--------------LFSQLCT------------EKCHPNAKCVNRK----CKCNERLVGDGVNFCFNCT--------SCHPDALC--FPDQQECSCKSEFVGDGKICTLRADICRPT----CGENAICVNGQCQCQSGLQGNPLKHCFDCRPCHSFAVCDVENRRCICQ--------SGFEGDGRNCKKIKECSPKCHRNAVCINQNCVCIPEYIGDGINFCFNCSSCDRNADCEPHNNRCTCYQGFT-GNGLTCNAIELKCEPSCGENAKCVNGKCECLPGLQGNPLQHCFNCKRCDKFADCDVWNKKCVCKNGYMGNGLT---CISVNG---CNNKCDSNALCVNRHCICLPGFTGDGTRFCFDCSSCPKNSNCLPEEQKCI--------CQEGYIMNGAKCQPIVHECRPGCGENAK------CVNGKCECLPGLQGNP-----MQHCFDCKKCHKFADCD--VWNKKCVCKNGYFGNGYM---CTPINGCNLK--CNENALCVNQKCI------------------------CLPGFIGD----GIKFCF--------DCS---ACPANSN-CVP----------------EKKECKCAKDYFMNEKICSPIKQPVLCTSK-CHKNAKC--LKG--NCECLPGFVGDGIQV-------CFNCSTCDKNANCFPYQERCVCKPRYS-GNGENCVKIGPESI--CPNXXXXXXXXXXXXXXXLQGFSGDGIKTCFNC---------SSCSIEAICVPDQE--KCICKAGFSGNG----------EQCVENIEGS-------SPKCHSNALRVNQQCICLPGFIGDGKNFCFDCSTCPPNSDCLPQEQRC---ICKKDYF-MNDTQCIHTGRTPQCVPKCHHYASCVQDKCECLPGFIGDGIKFCFKCSSCDPNADCVPEQQK--CVCKTGFYGNGNK-CDKIESTCEPPCAPGGFCNNSKCQCNSGLKGDGVTSCFNCSKCDVNAKCFPSVKK--CICVIGYKGDG-FRCYPVILEC--PKCHYRAQCVIG----KCQCKNGLQGDGINF-CMNCSECDKNAQCFP--------------------------------NFSKCECRQGYRGDGKNCVKIDECSP---------KCHQNAVCINSNCHCLPMYTGNGVSF-------CFN-CAQ---CDANAICKPDENL--CVCAQGFTGNGI-TCKAIDPSCNTNCHKDALCFKDSCICKSGLSGDGKNYCFDCKRCDQNAICRPTEQRCVCKPEFRGDGFQCALNLKTTCQNDCHPNAVRVNNCCRCKNGFFGDG-FSFCFNCSNCSPNADCFP--HLSKCQCKEEFT-----------------------GNGFICQRKECKPACSEATSLCIKNQC---FCRP----------GLIGDGYNCL-------------------------DCRKCHEKATCNIRSMKCECL--PGYIGNGFEC--ISITSCTQSSDCIRPNEICNVAISQCIC--EANSFLDPISKLCINPNCQPPCHPKAVCVKGKCICNRNLVGDGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQCQKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTC--------TDCSGCDKNAI-----CTEKQGCICKSGFIGDGRQCIV---LNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNGKCEPLSCIYPCAKNAVCIYQKCECLPGLVGNGFIKCTNCSECHKKALC---HDQRGCVCSHGYSGDGIQCRIEDQCSLNSDCTDPNKIC 8960
            +++   +C+C+PGY+  + +        +C   PC   A C       +C C  G  GD                            + Y   S C C+ G+  +    +C++   C ++  + A  +N  CK   NL G            N    C  CNT          C C+  Y   G +C+    S  + C   A C +     S C C   ++      C D  +C +         AQC  K G+ +C  P  Y GD  +  C     K      CA +  C     C C   Y+ +P +  KC   C +  C  ++ C  ++   C C  GF GD   G T    C    C   A CV+ K    C+C   ++GD        E+    S+C SN  C  +N AC+     EG+ ++   ++ C    + +     G C C  G   NG   C +      C   A CIP     TC+C  G  G+   G  C     C+ A  C  +  CING CK       +G+        C + A CD +N +CIC+P + GN            KC   C ++ H      +  C C+ G  G+    C   S        C  NA+C  + N   C C + F G+ +  CQD  +C+++ CG NA C N      C C  G  GNP   C   + + C     C   N +  C  E     +  C       SC P A C  G C C    IGD       CS    C  ++DC   +      +G  K  + CS I      +CG NA C++      C C  G  GNP      C+          +C    DC                                     +  C C   Y+ N    +     +  C  +  C +    C P ++G    +  C D  TC  N+ C       RC C  GF GN    +   P   K  C   A+C + + C      +  G +   D   C    VC  +  Q +C C PG + GD    F                SQ+C             E C  NA C+       C+C     GD +     CT        +CHP A+C   P+   C C   FVGD K    R D   P     C  N IC  G CQ       NP  +      C S A C V NR+ +C         S    DG  C +      KC  +  C    C     Y G     C N   C     C  +     C       +GL C  +E  C   C  N +C   +  C+     NP Q   +C   +     D  + +C C  G+ GN      C+ V      +N+C S  +C+   C  LP         C   +SC     C   +Q C         C  G I N  +       C+PGC  +A       C+ GKC+C  G  G P     +  C + + CH  A C+      +CVC  G  G+GY    C+    C+    C  N  C++ KC                         C  GF+GD    G+  CF        DC+   AC A +N C+                  K  C C + Y +   +C  I +   C S+ CH  A C  L G  +C+C  G +GD +Q        C + + C  +A+C   + R  C+ + + G   NC     ++I  CP         +    +C       G K C +          ++C   A C        C C+AG +G+           +Q  +  +GS       SP C +N   +++Q +CL G             TC  NS C PQ Q C   IC K+    +D++C   G    C+   +  A     KCE            C   ++C  NA+CV       C+CK GF+G+    C KIE T +  C+    C+N  C+           +C     C  NA C     +  C C  G+ GD   RC  VI  C    C   A+C       KC C  GL GD  N  C +  EC+ N  C P                                + ++C CR GY  DG+   ++  C P          C  N  C +S C    +      +F       CFN C Q   C  NA C    +L  C C +GFTG+    C  +  +C+  C     C    C+            C +   C  N  C   +  C+       D F   + L   C   CH     V++ C        D   + C   + C PNA C    H + C C E                          GNG  C    C+P C++        +C    C+P          G +  G NC+                         D   C   A C     + +CL   G  GN      +   +C ++ DC + N++C     Q  C  + N   D   + C+   C+  C+    C +G+ IC   +   G  CR    C  D  CV  +  C+    +  +  +C D LV +   QCQ PA                          F+GDG+T C         DC  CD+N       C+  + C C       G+QC      N+C     CT                           +   CE  +CI  C  N  C   +  C+ G   +    C N   C + ALC     +  C C  GY G+  +  ++ +C +++DC D NK C
Sbjct:  804 LANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRGKPACGLNALCK---NLPGSYECRCPQGHNGNPFIMCEICNTP--------ECQCQSPYKLVGNSCVLSGCSSGQACPSGAECISIAGGVSYCACPKGYQTQPDGSCVDVDECEERGAQLCAFGAQCVNKPGSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPGECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFKGDPLLGCTDEDECSHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDC-ASNLACL-----EGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDVICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCSTD-QCSAARPCGERQICINGRCK----ERCEGV-------VCGIGATCDRNNGKCICEPNFVGNPDLICMPPIEQAKCSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGPNAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANKPCGLNAACLNRAGGFECLCLSGHAGNPYSSCQPIESKFCQDANKCQC-NERVEC-PEGYSCQKGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCVDACSKI------QCGPNALCVSEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDAS-ACRPDVLGVLKCVAIC-DAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGCQPAQ-KHHCRNHAECQESEACIKDESTQTLGCRPACDTVKCGPRAVCVTNNHQAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFDVCDEESCGDNAICLAEDHRAVCQCPPGFKGDPLPE-VACTKQGGCAAGTCHPSAICEVTPEGPVCKCPPLFVGDAKSGGCRPDGQCPNGDADCPANTICAGGVCQ-------NPCDNA-----CGSNAECKVINRKPVCSCPLRFQPISDTAKDG--CARTIS---KCLTDVDCGGALC-----YNGQCRIACRNSQDCSDGESCLKNVCVVACLDHSQCASGLAC--VEGHCTIGCRSNKECKQDQ-SCIENKCLNPCQSANSCGP-NALCSIDQHHSQCSCPEGFEGNPTPEQGCVRVPAPCLASNQCPSGHMCIGNQCN-LP---------CTKTASCAVGERCY--QQVCRKVCYTSNNCLAGEICNSDR------TCQPGCDSDADCPPTELCLTGKCKCATGFIGTPFGCSDIDECTE-QPCHASARCENLPGTYRCVCPEGTVGDGYSQPGCSQPRQCHKPDDCANNLACIHGKCTDPCLHTVCGINANCQSEGHEALCSCPAGFLGDPNDTGVG-CFKVECIDHVDCAGDRACDAETNRCIKPCDLTSCGKGNCQVRDHKATCACYEGYQLVNDVCEDINE---CLSQPCHSTAFCNNLPGSYSCQCPEGLIGDPLQAGCRDPNECLSDADCPASASCQNSRCRSPCERQNACGLNANCQAQAHQAICTCPLNSRGDPTIECVHIECADNDDCSGEKACLDSKCIDPCSLPNACGALARCSVQNHIGVCSCEAGSTGDAKLGCVQLQYCQQDGQCAQGSICSHGICSPLCSTNRDCISEQ-LCLQGVCQ---------GTCKSNSSC-PQFQFCSNNICTKELECRSDSEC---GEDETCLSDAYGRA-----KCE----------SVCLGRAACGRNAECVARSHAPDCLCKEGFFGDAKSGCRKIECTSDDDCSNDKSCDNHMCK----------IACLIGQPCGENALCTTEHHQQVCHCQPGFSGDPRVRCD-VIDFCRDAPCGPGARCRNARGSYKCTCPPGLVGDPYNEGCRSSVECETNEDCPPHAACTKTNGVAKCRDVCAQLQCGPNAECVPKGHVAQCACRSGY--DGQPADRVAGCKPLPSPCQVTGDCPTNTYCSDSVCKPACVLDTECGAFEVCQGGQCFNPCLQPQACGQNAECVMQNHLKQCHCPEGFTGDSAKECVRVPVACDGECGPGYTCRDSMCL----------PVCHNDLECASNEKC--LKGSCMLTCRVDNDCFLGHVCLHNKCVYGCH-----VDDDCSASESCRNDKCVNPCLE-NPCGPNAACSVSNHRASCSCLESMVPNPTPQVGCVRSPPLECRENRDCGNGLACFESVCRPLCADDAGCLTNERCQQGVCKPLCRHDNECGHGELCLGLNCVPGCRSDQGCPPELSCVGQQCVDPCADPTACGTNAHCQTIDHRKQCLCPEGLDGNANVACKVPRIACGRNEDC-QSNQLCYAGSCQGKCRNDQNCLAD---ERCMRGTCRTVCNTDEACAQGQ-ICENRMCQTG--CRTDLSCATDEACVNKK--CQNPCRTPGQCGQCADCLVVNHGVQCQCPA-------------------------AFMGDGLTGCQLPPERCHPDCE-CDENGAYCAPKCSRTEDCAC-------GQQCARGKCRNKCGPKRQCT---------------------------VGQLCERGACIAGCKSNGDCAADQ-SCVNGKCSD---PCANEKACGRNALCTVSEHRMLCYCPDGYEGEPSKECVQFECRVDTDC-DSNKRC 3458          

HSP 19 Score: 118.242 bits (295), Expect = 2.249e-25
Identity = 516/2113 (24.42%), Postives = 728/2113 (34.45%), Query Frame = 3
Query: 7788 FTGNGFICQRKECKPACSEATSLCIKNQCFCRPGLIGDGY---NCLD-------CRKCHEKATCN--IRSMKCECLPGYIGNGFECISITSCTQ---SSDCIRPNEICNV-AISQCICEANSFLDPISKLCINPN-CQPP--CHPKAVCVKGK----CICNRNLVG---------DGYQCRAPEECNNDADCVQFQEVCRKDQSSLKKICKCKDGLVRDLQGQC----QKPACNGACHSKAVCVKSSNLESRCLCLPGFVGDGMTTCTDCSGCDKNAICTEKQGCI---------CKSGFI-----------------------------------GDGRQCIVLNECADNSDCTTIRGRASECIRSSEGIQKCQCSQGFKLLNG-KCEPLS--CIYPCAKNAVCIYQK----CECLPGLVGNGFIKCTNCSECH-------KKALCHDQ---RGCVCSHGYSGDG------IQCRIEDQCSLNSDCTDPNKICITSTDTVKRCVCKSSFISSNSGCVPL----TCLSKCHKYANCENGV----CKCILGYVGDG--IICRLPDE---CKSSLDCKYENQECVARLDSSLMCTCKSGFQWKSEKSSLVNNQMMIKRSMRAYSGCVPID-CNP------KCHRSALCVIG----TCKCPPSFKGNGYSGCFDCSKCHANAD-CDESKGCTCKPGFEGNGCYCRPEDKCKFNSDCNDPLKICVQSPDTSRNCVCKPGTTPSTNGKCIILGCPV--QCDKNAVC-LSNNCVCKTGYSGT-------GLNCKPNDQCSQNSDCPEPNSRCEMMKDYNRKCVCLPGFQDDN---GKCSP-KECQP-KCHMFAICITQT----CYCVPGYFGDGIKS---------CTSCSVCHKNAQCLPDR-----GCVCKSDFIGDGFN--CRPLDECRINEDCRDPNKMCLLNPSMKNL----QCTCKPLH----ILINNYCLPKECTSKCHKNAKCEGGMCQCLSGFIGDGINCQRPFECGIDNPCKDQFSVCQLTSDAKRFVCVCVFGFQMINSKCQPEPCPINCHPLAQCKSGKCVCQGELQGDGIRTCFKCSSCHARAVCSMDGCKCMPGYVG---NGIVCQTEDQCQYDSDCRDRNAACFPGVDKGKKCQCKPGFSLE---NSLCSPIACRPKCGKNSQCQLG---VCVCKDGYSPSVNGLSCSPIDHCQSENDCPDSNHKCVYHGL----FQGKRCMCRKGFI--------------PKSV----------FQCIEETCPNKCHNF-----AYCRQK----VCQCRLGF----QGDGVFNCHDCSVCHPNAICSP-SLGCTCPGPH-LIGD---GRSCKPKDQCRIDSDCRDSNAVCTLTYDSLKCQ---CKLGYIKFNNSLCYPIPCVKQCDRNEECLFGQCQCKPGFIHNSNKTCVEPNDCDVNNPASCKSPLEVCLGFPNAKAICVCRKGFINKFGYCIPINCYQPCHKNAYCNIGV----CTCNPDYIGDGITSC--KKKNLCLEDSDCPIIGSKCMTKSNPYSCKCPSGYE-------IDNNKCIAKKCLLPCDPNAVCVLG----ECICKVGFTGNGLQCMPTSKCNPLSG--CSDTNS-VCIQVPPTNYYDCMCKPGYIKSSNLSICKPIVCEPSCHPKAACIIGSCICMKPLIGNG---ITECKLPDECSASVHCKNK------------------------NAFCKNSTEGQMKCICKHGF-----------------QLENSKCISKQECR-------------------VNVDCPTRKICV-----NSKCICPEQYTSSPDGKLCELPMIMVVPSKLDVPETK---------------------DVEVLCFFENGIGNVNYLSWRRISPLMTMNFIRQPASVKLIIQKATVGDSGIYQCCIDSNSSPLNCKFASVNIFTKKCSP---CSLNQHCDPVTSNCICD----AGFQFDSNGICQRRNCLY-----FPEICDQVTMICDKGNCVCKSELYMDNKVCVPKDQCKTNEDCDPNAICKTDKRCHCGVLFNG-PGKFCAPIKLGCEVTKDCDPNGECFAIGISPTRLCQCKPGYVGDGKT--CKPAG 13067
            F G   + +  +C   C +  + C    C        DGY   NC+D        R C   A C   + S  C C PGY GNGF C  I  C     ++ C+   E CN+ A   C C+ + +      LC + + C+ P  C P A+C        C C    VG         D  +C  P  C   A C   +   R         C C  G   D + +     Q       C   A C+ +     RCLC  G+ GD M  C D   C  N  C     C+         C SGF+                                   G G  C+ ++EC +  D     G  ++CI +  G  +C C  GF+      CE ++     PC +NA+C        C C P   G+ F  C +  EC        + A+C +      C C  GY G         Q  +   CS N DCT+ N  CI +     +C C   F    S CV +    T    C  +A C N      C+C  GYVG    + C+ P E   C +   CK +  E          C C+ G+ +                     +GCV ID C+        C ++A C       TC CPP F G+ +S C D  +C   A  C     C   PG    G  CR    C  N+         +  PD S  CV              I+ C     C  N++C  +  C+C     G         LNC  + QC              M+ +   +C+C PG+  ++   G C+   EC+   C   AIC        C C  G  GD  +          C+  + C     C+ D       C+C+  +  +  N  C+ +DEC +          C LN   KNL    +C C   H     ++   C   EC  +C    K  G  C  LSG    G  C    EC              ++       C C  G+Q      QP+              G CV   E +  G + C   + C  +       C C  GY G   NG+    + +C  D +C        PG     +C C P + L+   N+ C     R  CG N++C       C+C+ G+          P+  C  E++C  S+  C Y         G +C+C K +               PKS             C+E +C + C +      AYC  +     C+CR+G+     GD V  C D  +C   A+C P S G TC  P   +G+   G SC   DQC     C +   +C       +C+   C +G                 CDRN     G+C C+P F+ N +  C+ P +                     AK                    C   C +NA+C  G+    C CNP   G+    C  + KN+C  +S  P   ++C    N  SC CP G+         D ++C  K C L    NA C+      EC+C  G  GN     P S C P+    C D N   C +          C  GY  S     CK +  + SC P+A C  G+CIC    IG+    +  C +  +C     C +                         NA C  S + +  CIC  GF                   E  KC S Q+C                     NV C   ++C      ++ C C E Y  +P    CE P +    S  + P+                           +C      G  + L+    +P        QPA        A   +S    C  D ++  L C+ A     T KC P   C  N H     + C C     AG  +D    CQ   C+Y       ++C+++T  C     VC  E   DN +C+ +D           A+C+      C   F G P    A  K G      C P+  C      P  +C+C P +VGD K+  C+P G
Sbjct:   81 FLGADELSKELKCTNDCDKDGTKCTHGACLNGVCHCNDGYGGCNCVDKDENECKQRPCDVFAHCTNTLGSFTCTCFPGYRGNGFHCEDIDECQDPAIAARCVENAECCNLPAHFLCKCK-DGYEGDGEVLCTDVDECRNPENCGPNALCTNTPGNYTCSCPDGYVGNNPYREGCQDVDECSYPNVCGPGAICTNLEGSYR---------CDCPPGYDGDGRSESGCVDQDECARTPCGRNADCLNTDG-SFRCLCPDGYSGDPMNGCEDVDECATNNPCGLGAECVNLGGSFQCRCPSGFVLEHDPHADQLPQPLNTQQLGYGPGATDIAPYQRTSGAGLACLDIDEC-NQPDGVAKCGTNAKCI-NFPGSYRCLCPSGFQGQGYLHCENINECQDNPCGENAICTDTVGSFVCTCKPDYTGDPFRGCVDIDECTALDKPCGQHAVCENTVPGYNCKCPQGYDGKPDPKVACEQVDVNILCSSNFDCTN-NAECIEN-----QCFCLDGFEPIGSSCVDIDECRTHAEVCGPHAQCLNTPGSYGCECEAGYVGSPPRMACKQPCEDVRCGAHAYCKPDQNE--------AYCVCEDGWTYNPSD---------------VAAGCVDIDECDVMHGPFGSCGQNATCTNSAGGFTCACPPGFSGDPHSKCVDVDECRTGASKCGAGAECVNVPG---GGYTCR----CPGNT---------IADPDPSVRCV-------------PIVSCSANEDCPGNSICDATKRCLCPEPNIGNDCRHPCEALNCGAHAQC--------------MLANGQAQCLCAPGYTGNSALAGGCNDIDECRANPCAEKAICSNTAGGYLCQCPGGSSGDPYREGCITSKTVGCSDANPCATGETCVQDSYTGNSVCICRQGYERNSENGQCQDVDECSVQRG----KPACGLNALCKNLPGSYECRCPQGHNGNPFIMCEICNTPEC--QCQSPYKLVGNSC-VLSG-CSSGQACPSGAEC--------------ISIAGGVSYCACPKGYQT-----QPD--------------GSCVDVDECEERGAQLCAFGAQCVNKP--GSYSCHCPEGYQGDAYNGLCALAQRKCAADRECAANEKCIQPG-----ECVCPPPYFLDPQDNNKCKSPCERFPCGINAKCTPSDPPQCMCEAGFK-------GDPLLGCTDEDEC--SHLPCAYGAYCVNKKGGYQCVCPKDYTGDPYKSGCIFESGTPKSKCLSNDDCASNLACLEGSCVSPCSSLLCGSNAYCETEQHAGWCRCRVGYVKNGDGDCVSQCQDV-ICGDGALCIPTSEGPTCKCPQGQLGNPFPGGSCS-TDQCSAARPCGERQ-ICINGRCKERCEGVVCGIGAT---------------CDRNN----GKCICEPNFVGNPDLICMPPIE--------------------QAK--------------------CSPGCGENAHCEYGLGQSRCACNPGTFGNPYEGCGAQSKNVCQPNSCGP--NAECRAVGNHISCLCPQGFSGNPYIGCQDVDECANKPCGL----NAACLNRAGGFECLCLSGHAGN-----PYSSCQPIESKFCQDANKCQCNE-------RVECPEGY--SCQKGQCKNLCSQASCGPRAICDAGNCICPMGYIGDPHDQVHGCSIRGQCGNDADCLHSEICFQLGKGLRKCVDACSKIQCGPNALCV-SEDHRSSCICSDGFFGNPSNLQVGCQPERTVPEEEDKCKSDQDCSRGYGCQASVNGIKECINLCSNVVCGPNELCKINPAGHAICNCAESYVWNPVVSSCEKPSLPDCTSDANCPDASACRPDVLGVLKCVAICDAFTCPANSVCVARQHQGRCDCLNGFVGNPNDRNGC--QPAQKHHCRNHAECQES--EACIKDESTQTLGCRPA---CDTVKCGPRAVCVTNNH----QAQCQCPPGPFAGDPYDPFNGCQSVPCVYNHDCPPSQMCNRMTHTCFD---VCDEESCGDNAICLAEDH---------RAVCQ------CPPGFKGDPLPEVACTKQGGCAAGTCHPSAICEVTPEGP--VCKCPPLFVGDAKSGGCRPDG 1937          

HSP 20 Score: 102.449 bits (254), Expect = 1.243e-20
Identity = 682/2825 (24.14%), Postives = 982/2825 (34.76%), Query Frame = 3
Query: 6027 NCECLPGFVGDG-----IQVCFN---CSTCDKNANC--FPYQERCVCKPRYSGNGE----------NCVKIGPESICPNXXXXXXXXXXXXXXXLQGFSGDGI--KTCFNCSSCSIEAICVPD--------QEKCICKAGFSGNGEQ---CVENIEGSSPKCHSNALRVNQ----QCICLPGFIGDGKNFCFDCSTCPPNSDC--------LPQEQRCICKKDYFMNDTQCIHTGRTPQCV--------PKCHHYASCVQDKCECLPGFIGDGIKFCFKCSSCDPNADCV--PEQQKCVCKTGFYGNGN-KCDKIESTCEPPCAPGGFCNNSK----CQCNSGLKGDGVTSCFNCSKCDV-------NAKCFPSVK--KCICVIGYKGDG---FRCYPVILECP-----KCHYRAQCVIGKCQCKNGLQGDG-----INFCMNCSE-CDKNAQCF--PNFSKCECRQGYRG----------------------------------DG---------KNCVKIDECSP------KCHQNAVCINS----NCHCLPMYTGNGVSFCFNCAQCDANAICKPDENLCVCAQGFTGNGITCK-----AIDP------------SCNTNCHKDALC-FKDSCICKSGLSGDGKNYCFDCKRCDQNAICRPT--EQRCVCKPEFRGD-GFQCALNLKTTCQ-NDCHPNAVRVNNC----CRCKNGFFGDGF------SFCFNCSNCSPNA-------DCFPHLSKCQCKEEFTGNGF--------ICQRKECKPACSEATSLCIKN-----QCFCRPGLIGDGYNCLDCRKCHEKATCNIRSMKCECLPGYIGNGFECISITSCTQSSDCIRPNEICNVA--ISQCICEANSFLDPISKLCINPNCQPP----CHPKAVCVKG----KCICNRNLVGDGY---------QCRAPEECNNDAD