ALMS_motif domain-containing protein

Overview
NameALMS_motif domain-containing protein
Smed IDSMED30021404
Length (bp)4058
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ALMS_motif domain-containing protein (SMED30021404) t-SNE clustered cells

Violin plots show distribution of expression levels for ALMS_motif domain-containing protein (SMED30021404) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ALMS_motif domain-containing protein (SMED30021404) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ALMS_motif domain-containing protein (SMED30021404) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021404

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30021404SMESG000077136.1 SmedASXL_014282SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30021404SMESG000077136.1 dd_Smed_v4_10880_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021404SMESG000077136.1 dd_Smed_v4_10880_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021404SMESG000077136.1 dd_Smed_v4_10880_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30021404SMESG000077136.1 dd_Smed_v4_5064_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30021404SMESG000077136.1 dd_Smed_v4_5064_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021404SMESG000077136.1 dd_Smed_v4_5064_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021404SMESG000077136.1 dd_Smed_v4_5064_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30021404SMESG000077136.1 dd_Smed_v4_5064_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021404SMESG000077136.1 dd_Smed_v4_5064_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30021404SMESG000077136.1 dd_Smed_v4_5064_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30021404SMESG000077136.1 dd_Smed_v4_5064_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30021404SMESG000077136.1 dd_Smed_v6_5064_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30021404SMESG000077136.1 dd_Smed_v4_10880_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021404SMESG000077136.1 dd_Smed_v4_5064_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ALMS_motif domain-containing protein vs. Ensembl Human
Match: C10orf90 (chromosome 10 open reading frame 90 [Source:HGNC Symbol;Acc:HGNC:26563])

HSP 1 Score: 51.6026 bits (122), Expect = 3.647e-6
Identity = 39/160 (24.38%), Postives = 83/160 (51.88%), Query Frame = 1
Query: 3448 LQSAFESKMENFISRSRQRQKRIKLAMEERRYESQMNLERSRLFASNNEDGRPVKRRPVTQPDPLSADRQIRVSAQRKTRNNVIKSSSVNGKKYPISEHLYKPRRRYFSKNEMRFQSAKKYQALPEVQAKYLDERKKARIQNNRMKMHLYGERILQSLLR 3927
            LQ A E +   FISRS++R K+++  +++R+ + + +L + +          P++          ++ +Q  +                    +P+S++L+KP+ R  S+ EM  +S + Y  LPEV+ K  ++RK+  +Q+NR++  ++ +++L  LL+
Sbjct:  115 LQEALEVRKPQFISRSQERLKKLEHMVQQRKAQRKEDLRQKQSLL-------PIR----------TSKKQFTIP-------------------HPLSDNLFKPKERCISEKEMHMRSKRIYDNLPEVKKKKEEQRKRVILQSNRLRAEVFKKQLLDQLLQ 238          
BLAST of ALMS_motif domain-containing protein vs. Ensembl Human
Match: C10orf90 (chromosome 10 open reading frame 90 [Source:HGNC Symbol;Acc:HGNC:26563])

HSP 1 Score: 52.373 bits (124), Expect = 6.266e-6
Identity = 41/160 (25.62%), Postives = 81/160 (50.62%), Query Frame = 1
Query: 3448 LQSAFESKMENFISRSRQRQKRIKLAMEERRYESQMNLERSRLFASNNEDGRPVKRRPVTQPDPLSADRQIRVSAQRKTRNNVIKSSSVNGKKYPISEHLYKPRRRYFSKNEMRFQSAKKYQALPEVQAKYLDERKKARIQNNRMKMHLYGERILQSLLR 3927
            LQ A E +   FISRS++R K+++  +++R+ + + +L + +                            IR S ++ T              +P+S++L+KP+ R  S+ EM  +S + Y  LPEV+ K  ++RK+  +Q+NR++  ++ +++L  LL+
Sbjct:  572 LQEALEVRKPQFISRSQERLKKLEHMVQQRKAQRKEDLRQKQSLLP------------------------IRTSKKQFT------------IPHPLSDNLFKPKERCISEKEMHMRSKRIYDNLPEVKKKKEEQRKRVILQSNRLRAEVFKKQLLDQLLQ 695          
BLAST of ALMS_motif domain-containing protein vs. Ensembl Zebrafish
Match: alms1 (ALMS1 centrosome and basal body associated protein [Source:ZFIN;Acc:ZDB-GENE-030131-4837])

HSP 1 Score: 66.6254 bits (161), Expect = 2.771e-10
Identity = 51/181 (28.18%), Postives = 81/181 (44.75%), Query Frame = 1
Query: 3400 MYSDENIKDSSHQKSGLQSAFESKMENFISRSRQRQKRIKLAMEERRYESQMNLERSRLFASNNEDGRPVKRRPVTQPDPLSADRQIRVSAQRKTRNNVIKSSSVNGKKYPISEHLYKPRRRYFSKNEMRFQSAKKYQALPEVQAKYLDERKKARIQNNRMKMHLYGERILQSLLRNRGPW 3942
            M +D + K S+  +  LQ A E     F+SRSR+R KR+ L +EERR ++  N ER  LF +     RP++  PV                                           PR+R   + EM  +S +KY  LPEVQ +  +E+++A  ++ R+   L+ +++   +L  R PW
Sbjct: 1968 METDISDKTSALVRLSLQEALELHRPEFVSRSRERMKRLGLLVEERRLQAIFNREREELF-NFPAPSRPLRAAPV-------------------------------------------PRKRVVPRKEMVQRSREKYAKLPEVQKRREEEKRRAEYRSYRLTAQLFNKKVTNRVLGRRAPW 2104          
BLAST of ALMS_motif domain-containing protein vs. TrEMBL
Match: A0A1S3KD55 (uncharacterized protein LOC106180931 OS=Lingula unguis OX=7574 GN=LOC106180931 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 9.108e-16
Identity = 62/178 (34.83%), Postives = 91/178 (51.12%), Query Frame = 1
Query: 3412 ENIKDSSHQKSGLQSAFESKMENFISRSRQRQKRIKLAMEERRYESQMNLERSRLFASNNEDGRPVKRRPVTQPDPLSADRQIRVSAQRKTRNNVIKSSSVNGKKYPISEHLYKPRRRYFSKNEMRFQSAKKYQALPEVQAKYLDERKKARIQNNRMKMHLYGERILQSLLRNRGPWV 3945
            E IK S  +K  LQ AF       ISRSR+RQ+RI LA EER+ + Q N ER  LFA                              QR+           N   +P SE L++P++R  +K+EMR  S K YQ LPEV  K  +++++ + + NR++  L+ E++L  +L+N+GPW+
Sbjct: 2535 EKIKPS--EKLTLQEAFVLFKGEAISRSRERQRRIVLAAEERKVQEQHNRERLHLFAD-----------------------------QRRKH--------ANPNAHPYSEQLHQPKQRVMTKSEMREHSLKIYQKLPEVIQKIEEKKRQEKYKTNRIRAQLFKEKVLNKVLKNKGPWL 2673          
BLAST of ALMS_motif domain-containing protein vs. TrEMBL
Match: R7UQH0 (ALMS_motif domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_229158 PE=4 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 3.022e-15
Identity = 65/243 (26.75%), Postives = 107/243 (44.03%), Query Frame = 1
Query: 3274 RHMKTGDTKVTRGGLSWAVGSNGKDSNNSPHPKNKEENPK---SWMYSDENIKDSSHQK--------------SGLQSAFESKMENFISRSRQRQKRIKLAMEERRYESQMNLERSRLFASNNEDGRPVKRRPVTQPDPLSADRQIRVSAQRKTRNNVIKSSSVNGKKYPISEHLYKPRRRYFSKNEMRFQSAKKYQALPEVQAKYLDERKKARIQNNRMKMHLYGERILQSLLRNRGPWVAA 3951
            RH      +  +  +SW V    +   N P  + + E P    SW+ ++E++K +  Q+              + LQ AFE     FIS SR+RQK + +  EERR +    LER++LF                                       +     N   +PISEHL+KP++R+ ++ EM+  + +KY+ LPEV     D ++  + + NR++  LY ++I    L+  GPW+ A
Sbjct: 1707 RHKAPSRRQKPKPAVSWFVPVVKR---NPPFKERQNETPAKFGSWILTEEDMKPALDQQRPSLPKRELKSKNMTSLQEAFERNKREFISASRERQKHVAIRAEERRVQELHQLERAKLFG-------------------------------------FVPRKQANRDAHPISEHLFKPKQRFMTRQEMKEMTQRKYKKLPEVVRAAEDRKRTEQYRLNRLRAKLYQKKIQNMALKKPGPWLKA 1909          
BLAST of ALMS_motif domain-containing protein vs. TrEMBL
Match: A0A0L8HP93 (ALMS_motif domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22010986mg PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 3.068e-13
Identity = 51/159 (32.08%), Postives = 87/159 (54.72%), Query Frame = 1
Query: 3448 LQSAFESKMENFISRSRQRQKRIKLAMEERRYESQMNLERSRLFASNNEDGRPVKRRPVTQPDPLSADRQIRVSAQRKTRNNVIKSSSVNGKKYPISEHLYKPRRRYFSKNEMRFQSAKKYQALPEVQAKYLDERKKARIQNNRMKMHLYGERILQSLL 3924
            LQ AF++ M N+ISRSR+RQKRI LA +ERRY+ QM +ER+++F +                                      K S+   +  P+ E+LYKP++R FSK EM+  + K Y+ LPEV ++ +++ +K + + N+ K  ++  ++ +++L
Sbjct:  878 LQEAFQNYMPNWISRSRERQKRILLAAQERRYQMQMEMERNKIFQNK-------------------------------------KPSTTASENDPVCENLYKPKKRAFSKQEMKELNWKLYRNLPEVISQKVEQTRKIQYKYNKTKSRVFSMKVQKNIL 999          
BLAST of ALMS_motif domain-containing protein vs. TrEMBL
Match: A0A074Z8P0 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_08620 PE=4 SV=1)

HSP 1 Score: 85.8853 bits (211), Expect = 7.981e-13
Identity = 68/235 (28.94%), Postives = 104/235 (44.26%), Query Frame = 1
Query: 3364 HPKNKEENPKSWMYSDENIKDSSHQKSG--------------LQSAFESKMENFISRSRQRQKRIKLAMEERRYESQMNLERSRLFASNN---EDGRPVKRRPVTQPDPLSADRQIRVSAQR------------KTRNNVIKSSSVNGKKYPI-----SEHLYKPRRRYFSKNEM--------RFQSAKKYQALPEVQAKYLDERKKARIQNNRMKMHLYGERILQSLLRNRGPW 3942
            HP + E    +   + + + DSS   +G              LQ+ F  +M  +ISRSR+RQKRI+LA + RRY + MN ER  LF  N+      RP++R       P S   Q    AQR            +T +      S N  +  I      +     RR   +  E+        R +   +   +P  Q +   E K A ++ NR++M +YGE++L+S+L+ RGPW
Sbjct: 1575 HPSDHESVYHTTTSARQKLHDSSTLVTGTSDERSEESALAQDLQTLFRQRMSRWISRSRERQKRIQLAAKNRRYTAAMNAERVSLFVGNSRIYSPTRPLRR-------PASGQSQEECPAQRCSCSARLCHCPARTLHTRSPCCSANTTRMTIPMQNAKDSQVTSRRPQLTAAEICSAPRDGSRCRGRPRRYLIPREQQRMALEHKMANLRTNRLRMKIYGEKVLRSVLQRRGPW 1802          
BLAST of ALMS_motif domain-containing protein vs. TrEMBL
Match: C3YIM0 (ALMS_motif domain-containing protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_97626 PE=4 SV=1)

HSP 1 Score: 84.7297 bits (208), Expect = 1.847e-12
Identity = 55/160 (34.38%), Postives = 84/160 (52.50%), Query Frame = 1
Query: 3448 LQSAFESKMENFISRSRQRQKRIKLAMEERRYESQMNLERSRLFASNNEDGRPVKRRPVTQPDPLSADRQIRVSAQRKTRNNVIKSSSVNGKKYPISEHLYKPRRRYFSKNEMRFQSAKKYQALPEVQAKYLDERKKARIQNNRMKMHLYGERILQSLLR 3927
            LQ A + +   FIS+SR+R +R++LA EERR+E    +ER RLF      G   +R   T+P PLS                               E+L++P++R  +K EM  +S + Y+ LPEVQ K   ER++A  ++NR+K  L+ +++L SL R
Sbjct: 2729 LQEALKMRNPAFISKSRERVRRMELAAEERRHEEAFEMERMRLF------GEERRRLQATEPAPLS-------------------------------ENLHRPKKRTITKKEMAARSKRMYEKLPEVQRKKAQERRQAAYKSNRIKAQLFKKKVLDSLRR 2851          
BLAST of ALMS_motif domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000052153.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:1011125:1032211:1 gene:ENSAMXG00000041575.1 transcript:ENSAMXT00000052153.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.8322 bits (120), Expect = 8.733e-6
Identity = 23/68 (33.82%), Postives = 45/68 (66.18%), Query Frame = 1
Query: 3721 KKYPISEHLYKPRRRYFSKNEMRFQSAKKYQALPEVQAKYLDERKKARIQNNRMKMHLYGERILQSLL 3924
            K +P+S++L+KP+ R  S  EM+ +S + Y  LPEV  K  +E+++  +Q NR++  ++ +++L  +L
Sbjct:  477 KPHPLSDNLFKPKDRVISGKEMQLRSRRIYNKLPEVTKKKEEEKRRMVLQTNRLRAEVFKKKLLDQIL 544          
BLAST of ALMS_motif domain-containing protein vs. Planmine SMEST
Match: SMESG000077136.1 (SMESG000077136.1)

HSP 1 Score: 2254.94 bits (5842), Expect = 0.000e+0
Identity = 1247/1255 (99.36%), Postives = 1250/1255 (99.60%), Query Frame = 1
Query:  193 MEHLFQENVKEKDFPXXXXXXXXXXXXXXXXXSSSDKNLKFNAEDSNKFTKPYNKNFNFETLNRDLADIEERLRATRLGWNKSGKSVNESNEIDGKDFVRKSWSLLDIEKRPYSNGSSINDLDSNKPFSGEKINCESPALSDGLLKWDYGADIGLNQDDSDDMEPITWPVTAEQAQRDFQASESNGIGRRMKMSLSQGSFLSSPDPEDRHNIIAKISAEYKSNKILHSLKNKNTTASTEIISKANGIYDDLSAKQIMEQXXXXXXXXXXXXXXXXXXHLNDHSRFQETDADKESPMEQPGDINDGIPSQNFPDSRMSKDAQFDEIDSNNELMNVTVKNQQNKLIEDIVSNVQKPNFLEEECISPNSFSNTGRTTTVESTHASSDYGKAPVFTGEIYGSRKDIHFIESGFVMYSKQNRETFIGKTKSLDNKEMRNPRIICGIPPELDTISSRETLQITDEXXXXXXXXAKTNNSNTVNIDEMKDSDNHLSDKDVSQENSLQAKWNQFKAMMKDEEYDNLIEKTNIRSAVQYVSPVNGKSYEHCNXXXXXXXXXXXXXXXXXXPRYDSFATEVFRNPQKESHNNQRNSISKRTGSQEDKNRSNSGIIVENKIYRASNQKYNSNQDLPSRSKPXXXXXXXXXXXXXXXXXXXXXXSQTERRKLRHTAELAKFKKRFGSGALDGETTASELEHDDLSKFKRNLMEKDKRKKQLSHMLTEISKQGXXXXXXXXXXXXXXXXXXXTMLLMNKMSHLLKKKAPDNNSKRDFRKCCVEKPDRRCVEHSNQKERPIKNPKRVIESDDAKLILKHLMLKQKVKWLADCAREESRRRKIHKLQKLMDLYEHGNPIIIPDDLETDTATLMGSNRNSQEDLCSHSDSYSVYESDISDAGEIGPPKAAEGNFHXXXXXXXXXXXXXXQKHRNGSKESFNLPKESSMNNQQQKSYPVSEAWHIPLREPDSQKLKDFNDSNEFCCDSPCSDEINQKYFRQSCANTYSQIPVKPVNXXXXXXXXXXXXXXXXXXXXXHECQKDLRHMKTGDTKVTRGGLSWAVGSNGKDSNNSPHPKNKEENPKSWMYSDENIKDSSHQKSGLQSAFESKMENFISRSRQRQKRIKLAMEERRYESQMNLERSRLFASNNEDGRPVKRRPVTQPDPLSADRQIRVSAQRKTRNNVIKSSSVNGKKYPISEHLYKPRRRYFSKNEMRFQSAKKYQALPEVQAKYLDERKKARIQNNRMKMHLYGERILQSLLRNRGPWVAAQS 3957
            MEHLFQENVKEKDFPESSDDKDIDKEKFISEISSSDKNLKFNAEDSNKFTKPYNKNFNFETLNRDLADIEERLRATRLGWNKSGKSVNESNEIDGKDFVRKSWSLLDIEKRPYSNGSSINDLDSNKPFSGEKINCESPALSDGLLKWDYGADIGLNQDDSDDMEPITWPVTAEQAQRDFQASESNGIGRRMKMSLSQGSFLSSPDPEDRHNIIAKISAEYKSNKILHSLKNKNTTASTEIISKANGIYDDLSAKQIMEQAEEAEKRLRLRLEAVKALHLNDHSRFQETDADKESPMEQPGDINDGIPSQNFPDSRMSKDAQFDEIDSNNELMNVTVK+QQNK+IEDIVSNVQKPNF EEECISPNSFSNTGRTTTVESTHASSDYGKAPVFTGEIYGSRKDIHFIESGFVMYSKQNRETFIGKTKSLDNKEMRNPRIICGIPPELDTISSRETLQITDEKKDDLLLLAKTNNSNTVNIDEMKDSDNHLSDKDVSQENSLQAKWNQFKAMMKDEEYDNLIEKTNIRSAVQYVSPVNGKSYEHCNTNRQASTATTFTTITNISPRYDSFATEVFRNPQKESHNNQRNSISKRTGSQEDKNRSNSGIIVENKIYRA NQKYNSNQDLPSRSKPGKRLTTGSGGGGRDNEDNDDEKSQTERRKLRHTAELAKFKKRFGSGALDGETTASELEHDDLSKFKRNLMEKDKRKKQLSHMLTEISKQGVADDSVQDFSDVSESSSVDTMLLMNKMSHLLKKKAPDNNSKRDFRKCCVEKPDRRCVEHSNQKERPI+NPKRVIESDDAKLILKHLMLKQKVKWLADCAREESRRRKIHKLQKLMDLYEHGNPIIIPDDLETDTATLMGSNRNSQEDLCSHSDSYSVYESDISDAGEIGPPKAAEGNFHSNKNKKYPPKSPIPQKHRNGSKESFNLPKESSMNNQQQKSYPVSEAWHIPLREPDSQKLKDFNDSNEFCCDSPCSDEINQKYFRQSCANTY QIPVKPVNLTARERLKLRRELELARQRNAHECQKDLRHMKT DTKVTRGGLSWAVGSNGKDSNNSPHPKNKEEN KSWMYSDENIKDSSHQKSGLQSAFESKMENFISRSRQRQKRIKLAMEERRYESQMNLERSRLFASNNEDGRPVKRRPVTQPDPLSADRQIRVSAQRKTRNNVIKSSSVNGKKYPISEHLYKPRRRYFSKNEMRFQSAKKYQALPEVQAKYLDERKKARIQNNRMKMHLYGERILQSLLRNRGPWVAAQS
Sbjct:    1 MEHLFQENVKEKDFPESSDDKDIDKEKFISEISSSDKNLKFNAEDSNKFTKPYNKNFNFETLNRDLADIEERLRATRLGWNKSGKSVNESNEIDGKDFVRKSWSLLDIEKRPYSNGSSINDLDSNKPFSGEKINCESPALSDGLLKWDYGADIGLNQDDSDDMEPITWPVTAEQAQRDFQASESNGIGRRMKMSLSQGSFLSSPDPEDRHNIIAKISAEYKSNKILHSLKNKNTTASTEIISKANGIYDDLSAKQIMEQAEEAEKRLRLRLEAVKALHLNDHSRFQETDADKESPMEQPGDINDGIPSQNFPDSRMSKDAQFDEIDSNNELMNVTVKSQQNKIIEDIVSNVQKPNFPEEECISPNSFSNTGRTTTVESTHASSDYGKAPVFTGEIYGSRKDIHFIESGFVMYSKQNRETFIGKTKSLDNKEMRNPRIICGIPPELDTISSRETLQITDEKKDDLLLLAKTNNSNTVNIDEMKDSDNHLSDKDVSQENSLQAKWNQFKAMMKDEEYDNLIEKTNIRSAVQYVSPVNGKSYEHCNTNRQASTATTFTTITNISPRYDSFATEVFRNPQKESHNNQRNSISKRTGSQEDKNRSNSGIIVENKIYRAGNQKYNSNQDLPSRSKPGKRLTTGSGGGGRDNEDNDDEKSQTERRKLRHTAELAKFKKRFGSGALDGETTASELEHDDLSKFKRNLMEKDKRKKQLSHMLTEISKQGVADDSVQDFSDVSESSSVDTMLLMNKMSHLLKKKAPDNNSKRDFRKCCVEKPDRRCVEHSNQKERPIRNPKRVIESDDAKLILKHLMLKQKVKWLADCAREESRRRKIHKLQKLMDLYEHGNPIIIPDDLETDTATLMGSNRNSQEDLCSHSDSYSVYESDISDAGEIGPPKAAEGNFHSNKNKKYPPKSPIPQKHRNGSKESFNLPKESSMNNQQQKSYPVSEAWHIPLREPDSQKLKDFNDSNEFCCDSPCSDEINQKYFRQSCANTYPQIPVKPVNLTARERLKLRRELELARQRNAHECQKDLRHMKTRDTKVTRGGLSWAVGSNGKDSNNSPHPKNKEENRKSWMYSDENIKDSSHQKSGLQSAFESKMENFISRSRQRQKRIKLAMEERRYESQMNLERSRLFASNNEDGRPVKRRPVTQPDPLSADRQIRVSAQRKTRNNVIKSSSVNGKKYPISEHLYKPRRRYFSKNEMRFQSAKKYQALPEVQAKYLDERKKARIQNNRMKMHLYGERILQSLLRNRGPWVAAQS 1255          
BLAST of ALMS_motif domain-containing protein vs. Planmine SMEST
Match: SMESG000077136.1 (SMESG000077136.1)

HSP 1 Score: 2178.67 bits (5644), Expect = 0.000e+0
Identity = 1216/1255 (96.89%), Postives = 1219/1255 (97.13%), Query Frame = 1
Query:  193 MEHLFQENVKEKDFPXXXXXXXXXXXXXXXXXSSSDKNLKFNAEDSNKFTKPYNKNFNFETLNRDLADIEERLRATRLGWNKSGKSVNESNEIDGKDFVRKSWSLLDIEKRPYSNGSSINDLDSNKPFSGEKINCESPALSDGLLKWDYGADIGLNQDDSDDMEPITWPVTAEQAQRDFQASESNGIGRRMKMSLSQGSFLSSPDPEDRHNIIAKISAEYKSNKILHSLKNKNTTASTEIISKANGIYDDLSAKQIMEQXXXXXXXXXXXXXXXXXXHLNDHSRFQETDADKESPMEQPGDINDGIPSQNFPDSRMSKDAQFDEIDSNNELMNVTVKNQQNKLIEDIVSNVQKPNFLEEECISPNSFSNTGRTTTVESTHASSDYGKAPVFTGEIYGSRKDIHFIESGFVMYSKQNRETFIGKTKSLDNKEMRNPRIICGIPPELDTISSRETLQITDEXXXXXXXXAKTNNSNTVNIDEMKDSDNHLSDKDVSQENSLQAKWNQFKAMMKDEEYDNLIEKTNIRSAVQYVSPVNGKSYEHCNXXXXXXXXXXXXXXXXXXPRYDSFATEVFRNPQKESHNNQRNSISKRTGSQEDKNRSNSGIIVENKIYRASNQKYNSNQDLPSRSKPXXXXXXXXXXXXXXXXXXXXXXSQTERRKLRHTAELAKFKKRFGSGALDGETTASELEHDDLSKFKRNLMEKDKRKKQLSHMLTEISKQGXXXXXXXXXXXXXXXXXXXTMLLMNKMSHLLKKKAPDNNSKRDFRKCCVEKPDRRCVEHSNQKERPIKNPKRVIESDDAKLILKHLMLKQKVKWLADCAREESRRRKIHKLQKLMDLYEHGNPIIIPDDLETDTATLMGSNRNSQEDLCSHSDSYSVYESDISDAGEIGPPKAAEGNFHXXXXXXXXXXXXXXQKHRNGSKESFNLPKESSMNNQQQKSYPVSEAWHIPLREPDSQKLKDFNDSNEFCCDSPCSDEINQKYFRQSCANTYSQIPVKPVNXXXXXXXXXXXXXXXXXXXXXHECQKDLRHMKTGDTKVTRGGLSWAVGSNGKDSNNSPHPKNKEENPKSWMYSDENIKDSSHQKSGLQSAFESKMENFISRSRQRQKRIKLAMEERRYESQMNLERSRLFASNNEDGRPVKRRPVTQPDPLSADRQIRVSAQRKTRNNVIKSSSVNGKKYPISEHLYKPRRRYFSKNEMRFQSAKKYQALPEVQAKYLDERKKARIQNNRMKMHLYGERILQSLLRNRGPWVAAQS 3957
            MEHLFQENVKEKDFPESSDDKDIDKEKFISEISSSDKNLKFNAEDSNKFTKPYNKNFNFETLNRDLADIEERLRATRLGWNKSGKSVNESNEIDGKDFVRKSWSLLDIEKRPYSNGSSINDLDSNKPFSGEKINCESPALSDGLLKWDYGADIGLNQDDSDDMEPITWPVTAEQAQRDFQASESNGIGRRMKMSLSQGSFLSSPDPEDRHNIIAKISAEYKSNKILHSLKNKNTTASTEIISKANGIYDDLSAKQIMEQAEEAEKRLRLRLEAVKALHLNDHSRFQETDADKESPMEQPGDINDGIPSQNFPDSRMSKDAQFDEIDSNNELMNVTVK+QQNK+IEDIVSNVQKPNF EEECISPNSFSNTGRTTTVESTHASSDYGKAPVFTGEIYGSRKDIHFIESGFVMYSKQNRETFIGKTKSLDNKEMRNPRIICGIPPELDTISSRETLQITDEKKDDLLLLAKTNNSNTVNIDEMKDSDNHLSDKDVSQENSLQAKWNQFKAMMKDEEYDNLIEKTNIRSAVQYVSPVNGKSYEHCNTNRQASTATTFTTITNISPRYDSFATEVFRNPQKESHNNQRNSISKRTGSQEDKNRSNSGIIVENKIYRA NQKYNSNQDLPSRSKPGKRLTTGSGGGGRDNEDNDDEKSQTERRKLRHTAELAKFKKRFGSGALDGETTASELEHDDLSKFKRNLMEKDKRKKQLSHMLTEISKQGVADDSVQDFSDVSESSSVDTMLLMNKMSHLLKKKAPDNNSKRDFRKCCVEKPDRRCVEHSNQKERPI+NPKRVIESDDAKLILKHLMLKQKVKWLADCAREESRRRKIHKLQKLMDLYEHGNPIIIPDDLETDTATLMGSNRNSQEDLCSHSDSYSVYESDISDAGEIGPPKAAEGNFHSNKNKKYPPKSPIPQKHRNGSKESFNLPKESSMNNQQQKSYPVSEAWHIPLREPDSQKLKDFNDSNEFCCDSPCSDEINQKYFRQSCANTY QIPVKPVNLTARERLKLRRELELARQRNAHECQKDLRHMKT DTKVTRGGLSWAVGSNGKDSNNSPHPKNKEEN KSWMYSDENIKDSSHQKSGLQSAFESKMENFISRSRQRQKRIKLAMEERRYESQMNLERSRLFASNNEDGRPVKRRPVTQPDPL                               SEHLYKPRRRYFSKNEMRFQSAKKYQALPEVQAKYLDERKKARIQNNRMKMHLYGERILQSLLRNRGPWVAAQS
Sbjct:    1 MEHLFQENVKEKDFPESSDDKDIDKEKFISEISSSDKNLKFNAEDSNKFTKPYNKNFNFETLNRDLADIEERLRATRLGWNKSGKSVNESNEIDGKDFVRKSWSLLDIEKRPYSNGSSINDLDSNKPFSGEKINCESPALSDGLLKWDYGADIGLNQDDSDDMEPITWPVTAEQAQRDFQASESNGIGRRMKMSLSQGSFLSSPDPEDRHNIIAKISAEYKSNKILHSLKNKNTTASTEIISKANGIYDDLSAKQIMEQAEEAEKRLRLRLEAVKALHLNDHSRFQETDADKESPMEQPGDINDGIPSQNFPDSRMSKDAQFDEIDSNNELMNVTVKSQQNKIIEDIVSNVQKPNFPEEECISPNSFSNTGRTTTVESTHASSDYGKAPVFTGEIYGSRKDIHFIESGFVMYSKQNRETFIGKTKSLDNKEMRNPRIICGIPPELDTISSRETLQITDEKKDDLLLLAKTNNSNTVNIDEMKDSDNHLSDKDVSQENSLQAKWNQFKAMMKDEEYDNLIEKTNIRSAVQYVSPVNGKSYEHCNTNRQASTATTFTTITNISPRYDSFATEVFRNPQKESHNNQRNSISKRTGSQEDKNRSNSGIIVENKIYRAGNQKYNSNQDLPSRSKPGKRLTTGSGGGGRDNEDNDDEKSQTERRKLRHTAELAKFKKRFGSGALDGETTASELEHDDLSKFKRNLMEKDKRKKQLSHMLTEISKQGVADDSVQDFSDVSESSSVDTMLLMNKMSHLLKKKAPDNNSKRDFRKCCVEKPDRRCVEHSNQKERPIRNPKRVIESDDAKLILKHLMLKQKVKWLADCAREESRRRKIHKLQKLMDLYEHGNPIIIPDDLETDTATLMGSNRNSQEDLCSHSDSYSVYESDISDAGEIGPPKAAEGNFHSNKNKKYPPKSPIPQKHRNGSKESFNLPKESSMNNQQQKSYPVSEAWHIPLREPDSQKLKDFNDSNEFCCDSPCSDEINQKYFRQSCANTYPQIPVKPVNLTARERLKLRRELELARQRNAHECQKDLRHMKTRDTKVTRGGLSWAVGSNGKDSNNSPHPKNKEENRKSWMYSDENIKDSSHQKSGLQSAFESKMENFISRSRQRQKRIKLAMEERRYESQMNLERSRLFASNNEDGRPVKRRPVTQPDPL-------------------------------SEHLYKPRRRYFSKNEMRFQSAKKYQALPEVQAKYLDERKKARIQNNRMKMHLYGERILQSLLRNRGPWVAAQS 1224          
The following BLAST results are available for this feature:
BLAST of ALMS_motif domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
C10orf903.647e-624.38chromosome 10 open reading frame 90 [Source:HGNC S... [more]
C10orf906.266e-625.63chromosome 10 open reading frame 90 [Source:HGNC S... [more]
back to top
BLAST of ALMS_motif domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ALMS_motif domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ALMS_motif domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
alms12.771e-1028.18ALMS1 centrosome and basal body associated protein... [more]
back to top
BLAST of ALMS_motif domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ALMS_motif domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ALMS_motif domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ALMS_motif domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3KD559.108e-1634.83uncharacterized protein LOC106180931 OS=Lingula un... [more]
R7UQH03.022e-1526.75ALMS_motif domain-containing protein OS=Capitella ... [more]
A0A0L8HP933.068e-1332.08ALMS_motif domain-containing protein OS=Octopus bi... [more]
A0A074Z8P07.981e-1328.94Uncharacterized protein OS=Opisthorchis viverrini ... [more]
C3YIM01.847e-1234.38ALMS_motif domain-containing protein OS=Branchiost... [more]
back to top
BLAST of ALMS_motif domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000052153.18.733e-633.82pep primary_assembly:Astyanax_mexicanus-2.0:9:1011... [more]
back to top
BLAST of ALMS_motif domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ALMS_motif domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ALMS_motif domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ALMS_motif domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ALMS_motif domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000077136.10.000e+099.36SMESG000077136.1[more]
SMESG000077136.10.000e+096.89SMESG000077136.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021404 ID=SMED30021404|Name=ALMS_motif domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4058bp
ATTTATCAAAATTTGACATTTACTGAACTTATTCTTTATTGAATATAAAT
TTTTAATTGGATAAATCTGTTTCTTGTATTTTAGAATTTTTAAATGGAAG
ATGTAATTTCAGATGAAAATTACAGAATTAATTCCAAAACCAATTCTTCA
GAATTTATTAAACGAATTGATACTTATTTAGAAAAAGGTTCAATGGAGCA
TTTATTTCAGGAAAATGTTAAGGAAAAAGATTTCCCAGAATCTAGTGATG
ACAAAGATATTGACAAAGAAAAATTTATAAGTGAAATTAGTTCATCAGAT
AAAAATTTGAAATTCAATGCTGAAGACAGTAACAAATTTACAAAGCCGTA
TAATAAAAATTTCAATTTTGAAACTCTTAATCGTGACCTGGCAGACATCG
AAGAACGACTAAGGGCAACAAGACTTGGGTGGAATAAAAGTGGAAAATCA
GTAAATGAGTCTAACGAGATTGATGGGAAAGATTTTGTACGGAAGTCTTG
GTCATTACTTGATATTGAAAAACGACCATATTCAAACGGAAGCAGTATTA
ATGACCTTGACAGCAATAAACCTTTTAGTGGTGAGAAAATCAACTGTGAA
AGTCCAGCATTAAGTGATGGATTATTAAAATGGGATTATGGAGCAGATAT
TGGATTGAATCAAGATGATAGTGATGACATGGAACCCATTACATGGCCTG
TTACGGCAGAACAAGCTCAAAGAGATTTTCAAGCCAGTGAATCTAATGGA
ATAGGAAGAAGAATGAAAATGTCTCTCAGTCAAGGATCATTTCTATCCAG
TCCAGATCCAGAAGACAGACATAATATTATTGCAAAAATTTCGGCTGAAT
ATAAATCAAATAAAATTTTACATTCATTGAAAAATAAAAACACTACCGCT
TCAACGGAAATAATTTCCAAAGCAAATGGAATTTATGATGATTTATCTGC
CAAACAGATCATGGAACAAGCAGAAGAGGCTGAGAAACGACTTAGGTTGA
GACTCGAGGCTGTGAAAGCTCTTCATCTAAACGACCATAGCAGATTTCAA
GAAACAGATGCTGACAAGGAATCACCGATGGAACAGCCTGGCGATATTAA
TGATGGAATTCCATCACAGAATTTCCCTGACTCGCGAATGTCAAAAGATG
CACAATTTGATGAAATTGATTCTAATAATGAACTGATGAACGTTACAGTT
AAAAATCAGCAAAACAAACTTATCGAAGATATTGTCTCAAATGTACAGAA
ACCGAATTTCCTCGAGGAAGAATGCATATCGCCGAACTCATTTAGCAACA
CCGGACGAACAACGACAGTAGAGAGTACTCACGCATCTTCCGATTACGGA
AAGGCTCCCGTATTTACTGGTGAAATCTATGGATCAAGAAAAGATATACA
TTTCATTGAAAGTGGCTTTGTGATGTATTCAAAACAAAACCGGGAAACTT
TTATTGGGAAAACTAAATCACTCGATAATAAAGAAATGAGAAATCCCCGA
ATTATTTGTGGAATTCCTCCGGAATTGGACACGATATCTAGTAGAGAAAC
TCTTCAGATTACTGATGAGAAAAAAGACGATTTGTTACTCTTGGCAAAAA
CGAATAACAGTAATACTGTAAATATCGATGAAATGAAAGATTCGGATAAT
CATTTATCAGATAAGGACGTCAGTCAAGAAAACAGTTTGCAAGCTAAATG
GAATCAATTTAAGGCCATGATGAAAGATGAAGAATATGATAATTTGATTG
AGAAAACAAATATACGGTCAGCTGTGCAATACGTTTCTCCTGTTAATGGA
AAATCATATGAACATTGCAACACGAATCGCCAAGCTTCCACAGCGACGAC
ATTCACCACTATTACGAACATATCCCCGCGTTATGACTCTTTTGCGACAG
AAGTATTCCGAAATCCCCAGAAGGAATCTCATAACAATCAACGAAATTCC
ATTAGTAAAAGAACCGGTTCACAGGAAGATAAAAATAGGTCAAACAGTGG
AATTATAGTTGAAAACAAAATCTATCGAGCAAGCAATCAAAAATATAACT
CAAATCAAGATTTACCATCTCGGTCGAAACCGGGGAAACGTTTAACTACC
GGTAGTGGTGGTGGTGGAAGAGACAATGAAGATAATGATGATGAAAAAAG
TCAAACAGAACGAAGAAAATTGAGGCACACGGCAGAACTAGCAAAATTTA
AGAAGCGCTTCGGAAGTGGAGCATTAGATGGTGAAACAACAGCTTCAGAG
CTAGAGCATGACGATTTATCTAAATTCAAGCGAAATCTAATGGAAAAAGA
CAAAAGAAAGAAACAATTGTCTCATATGTTAACTGAAATCAGTAAACAAG
GAGTTGCCGATGATAGCGTACAGGATTTCTCTGACGTTTCGGAATCTTCA
AGTGTAGACACAATGTTACTGATGAATAAAATGTCTCATTTGTTGAAGAA
AAAAGCTCCTGACAACAACTCTAAAAGAGATTTTAGAAAATGTTGTGTCG
AGAAACCAGATAGGAGATGTGTAGAGCATTCTAATCAGAAAGAAAGACCG
ATCAAGAATCCTAAGCGAGTCATTGAATCAGATGATGCCAAATTGATATT
GAAACATTTGATGTTGAAACAAAAAGTTAAATGGCTAGCAGATTGTGCTA
GAGAAGAATCTAGACGACGGAAAATCCATAAACTCCAGAAATTGATGGAC
TTGTATGAGCATGGAAATCCAATTATCATACCAGACGACCTCGAAACCGA
CACTGCGACATTGATGGGATCCAACAGAAATTCTCAGGAGGATCTTTGTT
CACATTCAGATTCTTATTCTGTTTACGAAAGTGACATTTCCGATGCTGGT
GAGATTGGCCCTCCTAAAGCAGCCGAAGGAAATTTTCATTCAAATAAAAA
TAAAAAATATCCCCCTAAATCACCTATACCTCAAAAACACAGAAATGGCT
CAAAAGAAAGTTTTAATCTACCGAAGGAATCATCTATGAACAACCAACAA
CAAAAATCATATCCAGTGAGTGAAGCTTGGCATATACCCCTCCGTGAACC
TGACTCCCAAAAACTAAAGGATTTCAATGATTCAAATGAATTTTGTTGTG
ATTCACCATGTTCCGATGAAATAAATCAAAAGTATTTTCGTCAATCTTGT
GCTAATACTTATTCGCAAATTCCTGTGAAACCTGTTAACTTGACTGCTAG
AGAAAGGCTTAAATTACGTCGAGAATTGGAGTTGGCTCGTCAGAGAAATG
CTCATGAATGTCAGAAAGATTTACGACATATGAAAACTGGAGATACAAAA
GTAACAAGAGGTGGTTTGTCATGGGCCGTTGGATCTAATGGCAAAGACAG
CAATAATTCGCCACATCCTAAAAATAAAGAGGAAAATCCTAAATCTTGGA
TGTATAGTGATGAAAATATAAAAGACAGTTCTCATCAAAAATCTGGTTTA
CAATCTGCCTTTGAGAGCAAAATGGAAAATTTTATTTCTAGATCTCGTCA
AAGGCAAAAACGTATTAAACTTGCAATGGAAGAAAGACGGTATGAATCTC
AAATGAATTTAGAAAGATCTAGACTTTTTGCGTCTAATAATGAAGATGGA
AGACCGGTTAAAAGGAGGCCAGTCACTCAACCAGATCCTCTAAGTGCTGA
CAGGCAAATTAGGGTTTCCGCCCAACGAAAAACGAGAAACAATGTCATTA
AGTCCTCGTCAGTAAATGGAAAGAAATATCCAATTTCAGAGCATCTTTAC
AAACCGAGACGCCGTTACTTCTCCAAAAATGAGATGAGATTTCAATCTGC
AAAGAAATATCAGGCTCTTCCTGAAGTTCAGGCAAAATATCTCGATGAAC
GAAAGAAAGCTCGAATTCAAAATAATCGAATGAAAATGCATCTTTATGGA
GAAAGAATACTGCAGTCTCTGTTGCGTAACCGTGGCCCATGGGTAGCTGC
TCAAAGCTAAATATTTATGAGAAAATATTTATAAATTGTGATTAATAAAT
AACTGTTCAGTATATAATTAAACTTGTGATTCATATTGTAGTTTGTTTGA
TAAATATA
back to top

protein sequence of SMED30021404-orf-1

>SMED30021404-orf-1 ID=SMED30021404-orf-1|Name=SMED30021404-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1289bp
MEDVISDENYRINSKTNSSEFIKRIDTYLEKGSMEHLFQENVKEKDFPES
SDDKDIDKEKFISEISSSDKNLKFNAEDSNKFTKPYNKNFNFETLNRDLA
DIEERLRATRLGWNKSGKSVNESNEIDGKDFVRKSWSLLDIEKRPYSNGS
SINDLDSNKPFSGEKINCESPALSDGLLKWDYGADIGLNQDDSDDMEPIT
WPVTAEQAQRDFQASESNGIGRRMKMSLSQGSFLSSPDPEDRHNIIAKIS
AEYKSNKILHSLKNKNTTASTEIISKANGIYDDLSAKQIMEQAEEAEKRL
RLRLEAVKALHLNDHSRFQETDADKESPMEQPGDINDGIPSQNFPDSRMS
KDAQFDEIDSNNELMNVTVKNQQNKLIEDIVSNVQKPNFLEEECISPNSF
SNTGRTTTVESTHASSDYGKAPVFTGEIYGSRKDIHFIESGFVMYSKQNR
ETFIGKTKSLDNKEMRNPRIICGIPPELDTISSRETLQITDEKKDDLLLL
AKTNNSNTVNIDEMKDSDNHLSDKDVSQENSLQAKWNQFKAMMKDEEYDN
LIEKTNIRSAVQYVSPVNGKSYEHCNTNRQASTATTFTTITNISPRYDSF
ATEVFRNPQKESHNNQRNSISKRTGSQEDKNRSNSGIIVENKIYRASNQK
YNSNQDLPSRSKPGKRLTTGSGGGGRDNEDNDDEKSQTERRKLRHTAELA
KFKKRFGSGALDGETTASELEHDDLSKFKRNLMEKDKRKKQLSHMLTEIS
KQGVADDSVQDFSDVSESSSVDTMLLMNKMSHLLKKKAPDNNSKRDFRKC
CVEKPDRRCVEHSNQKERPIKNPKRVIESDDAKLILKHLMLKQKVKWLAD
CAREESRRRKIHKLQKLMDLYEHGNPIIIPDDLETDTATLMGSNRNSQED
LCSHSDSYSVYESDISDAGEIGPPKAAEGNFHSNKNKKYPPKSPIPQKHR
NGSKESFNLPKESSMNNQQQKSYPVSEAWHIPLREPDSQKLKDFNDSNEF
CCDSPCSDEINQKYFRQSCANTYSQIPVKPVNLTARERLKLRRELELARQ
RNAHECQKDLRHMKTGDTKVTRGGLSWAVGSNGKDSNNSPHPKNKEENPK
SWMYSDENIKDSSHQKSGLQSAFESKMENFISRSRQRQKRIKLAMEERRY
ESQMNLERSRLFASNNEDGRPVKRRPVTQPDPLSADRQIRVSAQRKTRNN
VIKSSSVNGKKYPISEHLYKPRRRYFSKNEMRFQSAKKYQALPEVQAKYL
DERKKARIQNNRMKMHLYGERILQSLLRNRGPWVAAQS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0016197endosomal transport
GO:0051492regulation of stress fiber assembly
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR029299ALMS_motif
Vocabulary: cellular component
TermDefinition
GO:0005813centrosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1031..1051
NoneNo IPR availableCOILSCoilCoilcoord: 290..310
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 929..952
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 646..666
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 315..331
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1070..1098
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 676..694
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 315..350
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 605..694
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 605..622
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1161..1185
NoneNo IPR availablePANTHERPTHR21553:SF26ALSTROM SYNDROME PROTEIN 1coord: 1101..1279
NoneNo IPR availablePANTHERPTHR21553ALMS1-RELATEDcoord: 1101..1279
IPR029299ALMS motifPFAMPF15309ALMS_motifcoord: 1116..1278
e-value: 7.8E-24
score: 84.7