Cell division cycle 20-like protein

Overview
NameCell division cycle 20-like protein
Smed IDSMED30021402
Length (bp)1460
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cell division cycle 20-like protein (SMED30021402) t-SNE clustered cells

Violin plots show distribution of expression levels for Cell division cycle 20-like protein (SMED30021402) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cell division cycle 20-like protein (SMED30021402) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cell division cycle 20-like protein (SMED30021402) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021402

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30021402h1SMcG0009584 SmedASXL_013118SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30021402h1SMcG0009584 dd_Smed_v4_10335_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30021402h1SMcG0009584 dd_Smed_v6_10335_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30021402h1SMcG0009584 dd_Smed_v4_10335_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021402h1SMcG0009584 SmWIOct06_007116GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30021402h1SMcG0009584 SMED_14318_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30021402h1SMcG0009584 SMED_14318_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cell division cycle 20-like protein vs. Ensembl Human
Match: CDC20 (cell division cycle 20 [Source:HGNC Symbol;Acc:HGNC:1723])

HSP 1 Score: 145.591 bits (366), Expect = 1.265e-37
Identity = 111/430 (25.81%), Postives = 199/430 (46.28%), Query Frame = 3
Query:  135 GDRIMVHRGVMNFENFEIGLSRKSIDSNSN------YQELSIPNLIEKTMRPSRKRLLKLSIHHESPSSDEKLQQLISQSQTV--KRKFNRHISIHPERVLDAPEV-SLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDN-KKTIHHLKWSLDFHYLAVVAKDSHLSFW--AENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNRNQ--KSSLL 1373
            GDR + HR     E     LS+++   NS       +Q+    NL    +  ++   L     +       +L+ L SQ  T    RK  R+I   P+R+LDAPE+ +  + N++DWS  NV+AVAL ++VYLW A +  + +++         IS + W      K  + LA+G++   + LWD +++ ++R + S    + + V S++  + ILS G   G + H+D+R   +HV       + +  L+W+ D  +LA    D+ ++ W  A       PL  F      +  +AW     ++           ++++N+    CL  +     +  +LWS  Y+E+ I        ++ +     +  + EL GH   +L +  +P G  +A+   DE +RLW CF+   A++ +  +    KSSL+
Sbjct:   76 GDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEY-ISSVAWI-----KEGNYLAVGTSSAEVQLWDVQQQKRLRNMTS----HSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKEL-ISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLI 494          
BLAST of Cell division cycle 20-like protein vs. Ensembl Human
Match: CDC20 (cell division cycle 20 [Source:HGNC Symbol;Acc:HGNC:1723])

HSP 1 Score: 145.591 bits (366), Expect = 1.265e-37
Identity = 111/430 (25.81%), Postives = 199/430 (46.28%), Query Frame = 3
Query:  135 GDRIMVHRGVMNFENFEIGLSRKSIDSNSN------YQELSIPNLIEKTMRPSRKRLLKLSIHHESPSSDEKLQQLISQSQTV--KRKFNRHISIHPERVLDAPEV-SLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDN-KKTIHHLKWSLDFHYLAVVAKDSHLSFW--AENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNRNQ--KSSLL 1373
            GDR + HR     E     LS+++   NS       +Q+    NL    +  ++   L     +       +L+ L SQ  T    RK  R+I   P+R+LDAPE+ +  + N++DWS  NV+AVAL ++VYLW A +  + +++         IS + W      K  + LA+G++   + LWD +++ ++R + S    + + V S++  + ILS G   G + H+D+R   +HV       + +  L+W+ D  +LA    D+ ++ W  A       PL  F      +  +AW     ++           ++++N+    CL  +     +  +LWS  Y+E+ I        ++ +     +  + EL GH   +L +  +P G  +A+   DE +RLW CF+   A++ +  +    KSSL+
Sbjct:   76 GDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEY-ISSVAWI-----KEGNYLAVGTSSAEVQLWDVQQQKRLRNMTS----HSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKEL-ISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLI 494          
BLAST of Cell division cycle 20-like protein vs. Ensembl Human
Match: FZR1 (fizzy and cell division cycle 20 related 1 [Source:HGNC Symbol;Acc:HGNC:24824])

HSP 1 Score: 113.235 bits (282), Expect = 2.457e-26
Identity = 106/418 (25.36%), Postives = 187/418 (44.74%), Query Frame = 3
Query:  174 ENFEIGLSRKSIDSN----SNYQELSIPNLIEKTMRPS---RKRLLKLSIHHESPSSDE-------KLQQLISQSQTV---KRKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIHH-------LKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLK 1343
            +N + GL+  ++  N    +  +++  P   ++ ++PS   +K L   S+  +  S D+        L  + ++SQ +    RK  R IS  P +VLDAPE+    + N++DWS  NV++V LG+ VYLW A   +V  + +       S++ + W      +  +++A+G+  G + +WD+    K+  +      + + V ++A     LS G     +   DIR      P   +++ +         LKWS D   LA    D+ L  W  + L  SP+  + +    +  IAWS     +           ++ +N      L  I TG  +  L WS+   E+ + +   +  +I V    +L  + +L GH   +L +A +P GE I T   DE +R WN F    + K+K
Sbjct:   83 DNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEKKGLFTYSLSTKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLS-VEGDSVTSVGW-----SERGNLVAVGTHKGFVQIWDAAAGKKLSMLEG----HTARVGALAWNAEQLSSGSRDRMILQRDIR-----TPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSL--SPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANEL-VSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVFSKTRSTKVK 482          
BLAST of Cell division cycle 20-like protein vs. Ensembl Human
Match: FZR1 (fizzy and cell division cycle 20 related 1 [Source:HGNC Symbol;Acc:HGNC:24824])

HSP 1 Score: 111.309 bits (277), Expect = 1.207e-25
Identity = 104/409 (25.43%), Postives = 183/409 (44.74%), Query Frame = 3
Query:  174 ENFEIGLSRKSIDSN----SNYQELSIPNLIEKTMRPS---RKRLLKLSIHHESPSSDE-------KLQQLISQSQTV---KRKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIH-------HLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCF 1316
            +N + GL+  ++  N    +  +++  P   ++ ++PS   +K L   S+  +  S D+        L  + ++SQ +    RK  R IS  P +VLDAPE+    + N++DWS  NV++V LG+ VYLW A   +V  + +       S++ + W      +  +++A+G+  G + +WD+    K+  +      + + V ++A     LS G     +   DIR      P   +++ +         LKWS D   LA    D+ L  W  + L  SP+  + +    +  IAWS     +           ++ +N      L  I TG  +  L WS+   E+ + +   +  +I V    +L  + +L GH   +L +A +P GE I T   DE +R WN F
Sbjct:   83 DNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEKKGLFTYSLSTKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLS-VEGDSVTSVGW-----SERGNLVAVGTHKGFVQIWDAAAGKKLSMLEG----HTARVGALAWNAEQLSSGSRDRMILQRDIR-----TPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSL--SPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANEL-VSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVF 473          
BLAST of Cell division cycle 20-like protein vs. Ensembl Human
Match: FZR1 (fizzy and cell division cycle 20 related 1 [Source:HGNC Symbol;Acc:HGNC:24824])

HSP 1 Score: 111.309 bits (277), Expect = 1.207e-25
Identity = 104/409 (25.43%), Postives = 183/409 (44.74%), Query Frame = 3
Query:  174 ENFEIGLSRKSIDSN----SNYQELSIPNLIEKTMRPS---RKRLLKLSIHHESPSSDE-------KLQQLISQSQTV---KRKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIH-------HLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCF 1316
            +N + GL+  ++  N    +  +++  P   ++ ++PS   +K L   S+  +  S D+        L  + ++SQ +    RK  R IS  P +VLDAPE+    + N++DWS  NV++V LG+ VYLW A   +V  + +       S++ + W      +  +++A+G+  G + +WD+    K+  +      + + V ++A     LS G     +   DIR      P   +++ +         LKWS D   LA    D+ L  W  + L  SP+  + +    +  IAWS     +           ++ +N      L  I TG  +  L WS+   E+ + +   +  +I V    +L  + +L GH   +L +A +P GE I T   DE +R WN F
Sbjct:   83 DNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEKKGLFTYSLSTKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLS-VEGDSVTSVGW-----SERGNLVAVGTHKGFVQIWDAAAGKKLSMLEG----HTARVGALAWNAEQLSSGSRDRMILQRDIR-----TPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSL--SPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANEL-VSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVF 473          
BLAST of Cell division cycle 20-like protein vs. Ensembl Celegans
Match: fzr-1 (FiZzy Related family [Source:UniProtKB/TrEMBL;Acc:Q09649])

HSP 1 Score: 114.775 bits (286), Expect = 7.488e-27
Identity = 93/329 (28.27%), Postives = 154/329 (46.81%), Query Frame = 3
Query:  363 VKRKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSL-SISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIHH-----LKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLF---NDKINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFR-IRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCF 1316
              RK  R +  +P +VLDAPE+    + N++DWS QN ++V L + VYLW A   +V ++ + G T+    ++ ++W      K D +LA+G++ G   +WD   + K R++      + S V  +A   + +  G     + H DIR + N   D   K T H      LKWS D   LA    D+ L  W  N   + P+  +   N  +  +AWS     + +         L+ +N      +  + TG  +  + WS+   E  ++S    +F  + +    +LQ + +LVGH   +L +A +P GE I T   DE +R W+ F
Sbjct:  370 TPRKPIRKVPKNPYKVLDAPELQDDFYLNLVDWSSQNQLSVGLAACVYLWSATTSQVIKLCDLGQTNEQDQVTSVQWCD----KGD-LLAVGTSRGVTQIWDVTTQKKTRELTG----HSSRVGCLAWNADTICSGSRDRTIMHRDIRCDDN---DMGRKLTNHRQEVCGLKWSPDKQLLASGGNDNQLLVW--NLRRNEPIQTYTQHNAAVKALAWSPHHHGLLVSGGGTADRCLRFWNTLTAQPMQCVDTGSQVCNVAWSKHSSE--LVSTHGYSFNHVIIWKYPSLQPVTKLVGHQYRVLYLAMSPDGESIVTGAGDETLRFWHVF 682          
BLAST of Cell division cycle 20-like protein vs. Ensembl Celegans
Match: fzy-1 (WD repeat-containing protein fzy-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09373])

HSP 1 Score: 78.1814 bits (191), Expect = 3.112e-15
Identity = 80/350 (22.86%), Postives = 161/350 (46.00%), Query Frame = 3
Query:  342 LISQSQTVKRKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIM-NYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKR-KTK--IRKIYSSDRYNRSEVISVA-IKNNILSVGRSCGKLEHYDIRHNSNHVPDW--DNK--KTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYSS-------PLVLFNDKINDIAW----SHRDVDIFLCCTACEKGELKLYNIS---QRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGE-DEQIRLWNCF 1316
            +I+ + +VK K  RH+     +VLD P ++  ++   +DW   N +AVALG  +YLW+   C ++ +  +  PT+   I+ ++W    +Y     ++LG   G++ ++D  R KT   +R++ +      S   S+A  K  +++ G   G + ++D+R + + V  W  DN   + +  L+WS D +     + D     W    +  S       P+   ++    +      S RD  I         G +KL+++    Q++  L +     +  ++++  Y E+   S+D   F      + N +L  E+    + I+ +  +P  EV+  IG+ +E ++++  F
Sbjct:  147 VINPASSVK-KSTRHVKETATKVLDGPGLTKDLYSRHLDWGCHNWVAVALGHELYLWNTETCVIKNLFEDNAPTNEGLITSVRWSQEGRY-----ISLGYASGAVKIYDPNRPKTTEYVRELRTLRVGGASRCASIAWRKQGVMTCGYKSGDIVNHDVRISQHVVSSWGGDNGHCRDVTALEWSADENMCVSGSSDRTAKIWDGRHVRGSTVIQDPEPMFTIDEHTGQVRTAQFCSFRD-GILATGGGINDGTVKLWDVKRQFQKVRELNVCETGGVGGIVFNRPYSEMLTASDD--GFLRIYRFNANYKLSHEIQASNEPIMDLVGSPFDEVL--IGDMEETLKVFQLF 485          
BLAST of Cell division cycle 20-like protein vs. Ensembl Celegans
Match: wdr-5.2 (WD repeat-containing protein wdr-5.2 [Source:UniProtKB/Swiss-Prot;Acc:Q93847])

HSP 1 Score: 49.6766 bits (117), Expect = 3.058e-6
Identity = 38/160 (23.75%), Postives = 73/160 (45.62%), Query Frame = 3
Query:  834 KKTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFNDKINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCN-ISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWN 1310
            KK+I  +K+S D  Y+   + D  +  W  + +Y   L+     IN+ +WS  D  + + C+  +   +K++++S   C+ T+    N + C  ++     +A  S D     IR+    N   I  + GH   +  +  N  G  +A+   D  +R+W+
Sbjct:  107 KKSISGIKFSPDGRYMGSGSADCSIKIWRMDFVYEKTLMGHRLGINEFSWS-SDSKLIVSCS--DDKLVKVFDVSSGRCVKTLKGHTNYVFCCCFNPSGTLIASGSFDET---IRIWCARNGNTIFSIPGHEDPVSSVCFNRDGAYLASGSYDGIVRIWD 260          
BLAST of Cell division cycle 20-like protein vs. Ensembl Fly
Match: fzy (gene:FBgn0001086 transcript:FBtr0080833)

HSP 1 Score: 147.517 bits (371), Expect = 1.869e-38
Identity = 115/439 (26.20%), Postives = 205/439 (46.70%), Query Frame = 3
Query:  120 KTQYIGDRIMVHRGVMNFENFEIGLSRKSID---------SNSNYQELSIPNLIEKTMRPSRKRLLK-------------LSIHHESPSSDEKLQQLISQSQTVK-----RKFNRHISIHPERVLDAPE-VSLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDN-KKTIHHLKWSLDFHYLAVVAKDSHLSFWAENR----LYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPD 1328
            KT   GDR + +R   NFE     +++ S D         ++SN  E    N+     +  R++L+              L   +++P++ E     +    ++K     +  +R+I    ER+LDAP+ ++  + N+MDWS  N++AVALGS VYLW+A    +E++  +          L W    Q     ILA+G++ G++ LWD    +K++++   D ++ + V S+A  + ++S G   G + H+D+R   + +       + +  LKWS DF YLA    D+ ++ W+         + PL  FND    +  +AW                  +K +N++    + ++ +   +  LL+S  Y+E+ I +    N ++ +     +    +L GH   +L MA +P G  + + G DE +RLWNCF  PD
Sbjct:   81 KTPGGGDRFIPNRAATNFELAHFLVNKDSGDKSDEENDKATSSNSNE---SNVQASAHKGDRQKLISEVAQVGDSKGGRILCYQNKAPAAPETHNNPLKVVYSIKTPISTKSGSRYIPTTSERILDAPDFINDYYLNLMDWSADNIVAVALGSCVYLWNAQTGNIEQLTEF--EEGDYAGSLSWIQEGQ-----ILAIGNSTGAVELWDC---SKVKRLRVMDGHS-ARVGSLAWNSFLVSSGSRDGTIVHHDVRAREHKLSTLSGHTQEVCGLKWSTDFKYLASGGNDNLVNVWSAASGGVGTATDPLHKFNDHQAAVRALAWCPWQPSTLASGGGTADRCIKFWNVNNGTLMKSVDSKSQVCSLLFSRHYKEL-ISAHGFANNQLTIWKYPTMVKQADLTGHTSRVLQMAMSPDGSTVISAGADETLRLWNCF-APD 503          
BLAST of Cell division cycle 20-like protein vs. Ensembl Fly
Match: fzr (gene:FBgn0262699 transcript:FBtr0070687)

HSP 1 Score: 121.324 bits (303), Expect = 1.677e-29
Identity = 103/388 (26.55%), Postives = 179/388 (46.13%), Query Frame = 3
Query:  255 EKTMRPSRKRLLKLSIHHESPSSDE-------KLQQLISQSQTV---KRKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIH-------HLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNRN 1355
            E    P+ KR L     ++SP+  +        L  + ++SQ +    RK  R IS  P +VLDAPE+    + N++DWS QNV+AV LGS VYLW A   +V  + +  P ++ +++ + W      +  + +A+G+  G + +WD     +I K+      + + V ++A  ++ILS G     +   D R      P   +++ +         LKWS D  YLA    D+ L  W ++ +  +P+  + +    +  IAWS     +           ++ +N      +  + TG  +  L WS+   E+ + +   +  +I V    +L  + +L GH   +L +A +P GE I T   DE +R WN F    A+  K N++
Sbjct:  105 ENAYTPAAKRSL---FKYQSPTKQDYNGECPYSLSPVSAKSQKLLRSPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLAVGLGSCVYLWSACTSQVTRLCDLSPDAN-TVTSVSW-----NERGNTVAVGTHHGYVTVWDVAANKQINKLNG----HSARVGALAWNSDILSSGSRDRWIIQRDTR-----TPQLQSERRLAGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNQHSV--NPVQSYTEHMAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSEL-VSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLALSPDGEAIVTGAGDETLRFWNVFS--KARSQKENKS 469          
BLAST of Cell division cycle 20-like protein vs. Ensembl Fly
Match: fzr (gene:FBgn0262699 transcript:FBtr0070686)

HSP 1 Score: 121.324 bits (303), Expect = 1.677e-29
Identity = 103/388 (26.55%), Postives = 179/388 (46.13%), Query Frame = 3
Query:  255 EKTMRPSRKRLLKLSIHHESPSSDE-------KLQQLISQSQTV---KRKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIH-------HLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNRN 1355
            E    P+ KR L     ++SP+  +        L  + ++SQ +    RK  R IS  P +VLDAPE+    + N++DWS QNV+AV LGS VYLW A   +V  + +  P ++ +++ + W      +  + +A+G+  G + +WD     +I K+      + + V ++A  ++ILS G     +   D R      P   +++ +         LKWS D  YLA    D+ L  W ++ +  +P+  + +    +  IAWS     +           ++ +N      +  + TG  +  L WS+   E+ + +   +  +I V    +L  + +L GH   +L +A +P GE I T   DE +R WN F    A+  K N++
Sbjct:  105 ENAYTPAAKRSL---FKYQSPTKQDYNGECPYSLSPVSAKSQKLLRSPRKATRKISRIPFKVLDAPELQDDFYLNLVDWSSQNVLAVGLGSCVYLWSACTSQVTRLCDLSPDAN-TVTSVSW-----NERGNTVAVGTHHGYVTVWDVAANKQINKLNG----HSARVGALAWNSDILSSGSRDRWIIQRDTR-----TPQLQSERRLAGHRQEVCGLKWSPDNQYLASGGNDNRLYVWNQHSV--NPVQSYTEHMAAVKAIAWSPHHHGLLASGGGTADRCIRFWNTLTGQPMQCVDTGSQVCNLAWSKHSSEL-VSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLALSPDGEAIVTGAGDETLRFWNVFS--KARSQKENKS 469          
BLAST of Cell division cycle 20-like protein vs. Ensembl Fly
Match: fzr2 (gene:FBgn0034937 transcript:FBtr0072146)

HSP 1 Score: 114.775 bits (286), Expect = 2.605e-27
Identity = 79/310 (25.48%), Postives = 150/310 (48.39%), Query Frame = 3
Query:  405 RVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPD--WDNKKTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFNDK---INDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCF 1316
            ++LDAPE+    + N++DWS +N +AV LG +VYLW A++ +V  + ++    +L I+ + W HG   +    +A+G+  G + +WD++ + +I ++      + + V ++A   N L+ G     +   DIR+   H+      +K  +  L+WS    YLA    D+ L  W ++  +  P+  F++    +  + WS     +           L+ +N+     +  I+TG  IS L W+    E+ + +      ++      +L+ +  L GH + +L ++ +P  E I T G DE +R W  F
Sbjct:  135 KILDAPELQDDFYLNLIDWSSKNTLAVGLGCSVYLWSAVSGQVTRLCDFNNEDNL-ITAVSW-HGEGRQ----VAIGTQSGYVTIWDAENQKQINRL----EEHSARVTALAWCGNRLASGSRDRSILQRDIRNPPTHITRCLRGHKLEVCGLQWSPSNRYLASGGSDNRLLVWTDD--WPEPIYAFDEHKAVVKALGWSPHKSGLLASGGGSADRCLRFWNVLTGKLVKCINTGAQISNLAWARDSREL-VTTHGHAQPQVIAWRYPSLKQMARLSGHTQRVLHLSVSPDNESIVTGGADETLRFWTVF 431          
BLAST of Cell division cycle 20-like protein vs. Ensembl Zebrafish
Match: cdc20 (cell division cycle 20 homolog [Source:ZFIN;Acc:ZDB-GENE-040426-2044])

HSP 1 Score: 133.265 bits (334), Expect = 2.028e-33
Identity = 97/343 (28.28%), Postives = 171/343 (49.85%), Query Frame = 3
Query:  333 LQQLISQSQT-VKRKFNRHISIHPERVLDAPEV-SLVHPNVMDWSKQNVIAVALGSAVYLWDA------IACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDN-KKTIHHLKWSLDFHYLAVVAKDSHLSFW-----AENRLYSSPLVLFNDKINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQ 1319
            L+ L SQ  T V  K +R+IS +PER+LDAP++ +  + N+MDW +QNV+AV L + VYLWDA      +  K+E+   Y       I  + W      K  + LA+G++D  + LWD + + ++R +      + + V  ++  ++ILS G   G +  +D+R   +H+  +    + +  L WS D  YLA    D+ +  W     +EN+   + L      +  +AW     +I           ++++N S   C+ ++ T   +S L+++  Y+E+ +      + ++ +    +   + E  GH   IL +A +P G  +A+I  DE IRLW CF+
Sbjct:  150 LKVLYSQVPTPVSVKKSRYISSYPERILDAPDIRNDFYLNLMDWGRQNVLAVGLANQVYLWDAGEGDIVLLKKMEDDNEY-------ICSVSW-----SKDGNFLAIGTSDCKVELWDVQYQKRLRSMDG----HSARVGCLSWNDHILSSGSRSGLIHQHDVRVADHHIFTFGGHTQEVCGLTWSPDGRYLASGGNDNMVYIWPMTTGSENQAIHA-LSEHQGAVKALAWCPWQPNILASGGGTSDRHIRIWNASSGSCISSLDTCSQVSSLVFAPNYKEL-VSGHGFAHDKVVIWKYPSFAKVTEHEGHEARILNLALSPDGSTLASIAADETIRLWKCFE 474          
BLAST of Cell division cycle 20-like protein vs. Ensembl Zebrafish
Match: cdc20 (cell division cycle 20 homolog [Source:ZFIN;Acc:ZDB-GENE-040426-2044])

HSP 1 Score: 133.265 bits (334), Expect = 2.028e-33
Identity = 97/343 (28.28%), Postives = 171/343 (49.85%), Query Frame = 3
Query:  333 LQQLISQSQT-VKRKFNRHISIHPERVLDAPEV-SLVHPNVMDWSKQNVIAVALGSAVYLWDA------IACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDN-KKTIHHLKWSLDFHYLAVVAKDSHLSFW-----AENRLYSSPLVLFNDKINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQ 1319
            L+ L SQ  T V  K +R+IS +PER+LDAP++ +  + N+MDW +QNV+AV L + VYLWDA      +  K+E+   Y       I  + W      K  + LA+G++D  + LWD + + ++R +      + + V  ++  ++ILS G   G +  +D+R   +H+  +    + +  L WS D  YLA    D+ +  W     +EN+   + L      +  +AW     +I           ++++N S   C+ ++ T   +S L+++  Y+E+ +      + ++ +    +   + E  GH   IL +A +P G  +A+I  DE IRLW CF+
Sbjct:  150 LKVLYSQVPTPVSVKKSRYISSYPERILDAPDIRNDFYLNLMDWGRQNVLAVGLANQVYLWDAGEGDIVLLKKMEDDNEY-------ICSVSW-----SKDGNFLAIGTSDCKVELWDVQYQKRLRSMDG----HSARVGCLSWNDHILSSGSRSGLIHQHDVRVADHHIFTFGGHTQEVCGLTWSPDGRYLASGGNDNMVYIWPMTTGSENQAIHA-LSEHQGAVKALAWCPWQPNILASGGGTSDRHIRIWNASSGSCISSLDTCSQVSSLVFAPNYKEL-VSGHGFAHDKVVIWKYPSFAKVTEHEGHEARILNLALSPDGSTLASIAADETIRLWKCFE 474          
BLAST of Cell division cycle 20-like protein vs. Ensembl Zebrafish
Match: fzr1a (fizzy/cell division cycle 20 related 1a [Source:ZFIN;Acc:ZDB-GENE-040426-712])

HSP 1 Score: 112.464 bits (280), Expect = 2.650e-26
Identity = 97/369 (26.29%), Postives = 168/369 (45.53%), Query Frame = 3
Query:  270 PSRKRLLKLSIHHESPSSDE------KLQQLISQSQTV---KRKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIH-------HLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCF 1316
            P R+ L   S+  +  + D+       L  + S+SQ +    RK  R IS  P +VLDAPE+    + N++DWS  NV++V LG+ VYLW A   +V  + +       S++ + W      +  +++A+G+  G + +WD+   T  +K+++ + +  + V ++A   + LS G     +   DIR      P   +++ +         LKWS D   LA    D+ L  W  + +   P+  + +    +  IAWS     +           ++ +N      L  I TG  +  L WS+   E+ + +   +  +I V    +L  + +L GH   +L +A +P GE I T   DE +R WN F
Sbjct:  125 PERRSLFSYSLSAKRSTPDDNSVSPYSLSPVSSKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLS-VEGDSVTSVGW-----SERGNLVAVGTHKGFVQIWDA---TAGKKLFALEGHT-ARVGALAWNADQLSSGSRDRMILQRDIR-----TPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSVL--PMQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTAQPLQCIDTGSQVCNLAWSKHTNEL-VSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVF 475          
BLAST of Cell division cycle 20-like protein vs. Ensembl Zebrafish
Match: fzr1a (fizzy/cell division cycle 20 related 1a [Source:ZFIN;Acc:ZDB-GENE-040426-712])

HSP 1 Score: 112.464 bits (280), Expect = 2.650e-26
Identity = 97/369 (26.29%), Postives = 168/369 (45.53%), Query Frame = 3
Query:  270 PSRKRLLKLSIHHESPSSDE------KLQQLISQSQTV---KRKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIH-------HLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCF 1316
            P R+ L   S+  +  + D+       L  + S+SQ +    RK  R IS  P +VLDAPE+    + N++DWS  NV++V LG+ VYLW A   +V  + +       S++ + W      +  +++A+G+  G + +WD+   T  +K+++ + +  + V ++A   + LS G     +   DIR      P   +++ +         LKWS D   LA    D+ L  W  + +   P+  + +    +  IAWS     +           ++ +N      L  I TG  +  L WS+   E+ + +   +  +I V    +L  + +L GH   +L +A +P GE I T   DE +R WN F
Sbjct:  125 PERRSLFSYSLSAKRSTPDDNSVSPYSLSPVSSKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLS-VEGDSVTSVGW-----SERGNLVAVGTHKGFVQIWDA---TAGKKLFALEGHT-ARVGALAWNADQLSSGSRDRMILQRDIR-----TPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSVL--PMQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTAQPLQCIDTGSQVCNLAWSKHTNEL-VSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVF 475          
BLAST of Cell division cycle 20-like protein vs. Ensembl Zebrafish
Match: fzr1b (fizzy/cell division cycle 20 related 1b [Source:ZFIN;Acc:ZDB-GENE-131120-69])

HSP 1 Score: 107.842 bits (268), Expect = 9.378e-25
Identity = 88/326 (26.99%), Postives = 146/326 (44.79%), Query Frame = 3
Query:  369 RKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIHH------LKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCF 1316
            RK  R IS  P +VLDAPE+    + N++DWS  N+++V LG+ VYLW A   +V  + +       S++ + W      +   ++A+G+  G + +WD+    K+  +      + + V ++A     LS G     +   D+R      P    ++   H      LKWS D  +LA    D+ L  W  + L   P+  ++D    +  IAWS     +           L+ +N      L +  TG  +  L WS+   E+ + +   +  +I V    +L  + +L GH   +L +A +P GE I T   DE +R WN F
Sbjct:  158 RKPARKISKIPFKVLDAPELQDDFYLNLVDWSAGNLLSVGLGACVYLWSACTSQVTRLCDLS-VDGDSVTSVCW-----NERGSLVAVGTHKGFVQIWDAAGGRKLTSLEG----HSARVGALAWNGEQLSSGSRDRVILQRDVR-----TPPPVERRLQGHRQEVCGLKWSPDHQHLASGGNDNKLLVWNSSSLL--PVQQYSDHLAAVKAIAWSPHQHGLLASGGGTADRCLRFWNTLTGQALQSTDTGSQVCNLAWSKHANEL-VSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAVSPDGEAIVTGAGDETLRFWNVF 465          
BLAST of Cell division cycle 20-like protein vs. Ensembl Xenopus
Match: cdc20 (cell division cycle 20 [Source:NCBI gene;Acc:394542])

HSP 1 Score: 133.65 bits (335), Expect = 2.601e-33
Identity = 117/444 (26.35%), Postives = 202/444 (45.50%), Query Frame = 3
Query:  105 SKLKPKTQYI-----GDRIMVHRGVMNFE--NFEIGLSRKSIDSNSNYQELSIP---NLIEKTMRPSRKRLLKLSIHHESPSSDEKLQQLISQSQTV--KRKFNRHISIHPERVLDAPEV-SLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDW-DNKKTIHHLKWSLDFHYLAVVAKDSHLSFWA---ENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQC-PDAKKLKNNRNQKSSLL 1373
             K  PK Q       GDR + +R  M  +  +F +    +  D++   +E       NL    M  ++   L     +        L+ L SQ  T    +K  R+I   P+RVLDAP++ +  + N++DWS QN +AVAL  +VYLW+     +  ++     S   IS + W      K  + LA+G T  S + W   R + ++++ +   ++ S V +++  N+ILS G   G + H+D+R   +HV     + + +  LKWS D  YLA  A D+ ++ W     +    SP+  F      +  +AW     ++           ++++N+    CL ++ T   +  +LWS  Y+E+ I        ++ +     +  + EL GH   +L +A +P G  +A+   DE +RLW CF+  P  KK K       S++
Sbjct:   70 GKSGPKMQGTPSRAGGDRFIPNRSAMQMDVASFLLCKENEPADTSPTKKEQQKAWAMNLNGFDMEEAKILRLGGRPQNAPEGYQNNLKVLYSQKTTPGSSKKTGRYIPSMPDRVLDAPDIRNDYYLNLIDWSSQNFLAVALNDSVYLWNYATGDIILLLQM-EHSEEYISSVSWI-----KEGNYLAVG-TSNSEVQWRLNRISLLKRLRNMTSHS-SRVGALSWNNHILSSGSRTGHIHHHDVRVAQHHVSTLTGHTQEVCGLKWSPDGRYLASGANDNLVNVWPCVQGDSGEFSPVQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGTCLNSVDTHSQVCSILWSTNYKEL-ISGHGFAQNQLVLWKYPTMTRVTELKGHTARVLNLAISPDGCTVASAAADETLRLWKCFEVDPVTKKEKEKARSSKSII 504          
BLAST of Cell division cycle 20-like protein vs. Ensembl Xenopus
Match: mcoln1 (mucolipin 1 [Source:Xenbase;Acc:XB-GENE-982338])

HSP 1 Score: 112.849 bits (281), Expect = 2.976e-26
Identity = 98/370 (26.49%), Postives = 165/370 (44.59%), Query Frame = 3
Query:  270 PSRKRLLKLSIHHESPSSDE-------KLQQLISQSQTV---KRKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIH-------HLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCF 1316
            P +K L   S+  +  S D+        L  + ++SQ +    RK  R IS  P +VLDAPE+    + N++DWS  NV++V LG+ VYLW A   +V  + +       S++ + W      +  +++A+G+  G + +WD+    K+  +      + + V ++A   + LS G     +   DIR      P   +++ +         LKWS D   LA    D+ L  W  + L  SP+  + +    +  IAWS     +           ++ +N      L  I TG  +  L WS+   E+ + +   +  +I V    +L  + +L GH   +L +A +P GE I T   DE +R WN F
Sbjct:  122 PEKKSLFTYSLSSKRASPDDGNEVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLS-VEGDSVTSVGW-----SERGNLVAVGTHKGFVQIWDASAGKKLSTLEG----HTARVGALAWNADQLSSGSRDRMILQRDIR-----TPPVQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSL--SPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANEL-VSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVF 473          
BLAST of Cell division cycle 20-like protein vs. Ensembl Xenopus
Match: mcoln1 (mucolipin 1 [Source:Xenbase;Acc:XB-GENE-982338])

HSP 1 Score: 112.464 bits (280), Expect = 7.478e-26
Identity = 99/386 (25.65%), Postives = 174/386 (45.08%), Query Frame = 3
Query:  216 NSNYQELSIPNLIEKTMRPS---RKRLLKLSIHHESPSSDE-------KLQQLISQSQTV---KRKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPD--WDNKKTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCF 1316
             +  +++  P   ++ ++PS   +K L   S+  +  S D+        L  + ++SQ +    RK  R IS  P +VLDAPE+    + N++DWS  NV++V LG+ VYLW A   +V  + +       S++ + W      +  +++A+G+  G + +WD+    K+  +      + + V ++A   + LS G     +   DIR            +++ +  LKWS D   LA    D+ L  W  + L  SP+  + +    +  IAWS     +           ++ +N      L  I TG  +  L WS+   E+ + +   +  +I V    +L  + +L GH   +L +A +P GE I T   DE +R WN F
Sbjct:  232 GAGIEKVQDPQTEDRRLQPSTPEKKSLFTYSLSSKRASPDDGNEVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLS-VEGDSVTSVGW-----SERGNLVAVGTHKGFVQIWDASAGKKLSTLEG----HTARVGALAWNADQLSSGSRDRMILQRDIRTPPVQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSL--SPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANEL-VSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVF 604          
BLAST of Cell division cycle 20-like protein vs. Ensembl Xenopus
Match: mcoln1 (mucolipin 1 [Source:Xenbase;Acc:XB-GENE-982338])

HSP 1 Score: 85.8853 bits (211), Expect = 3.374e-17
Identity = 87/364 (23.90%), Postives = 161/364 (44.23%), Query Frame = 3
Query:  216 NSNYQELSIPNLIEKTMRPS---RKRLLKLSIHHESPSSDE-------KLQQLISQSQTV---KRKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPD--WDNKKTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMAT 1250
             +  +++  P   ++ ++PS   +K L   S+  +  S D+        L  + ++SQ +    RK  R IS  P +VLDAPE+    + N++DWS  NV++V LG+ VYLW A   +V  + +       S++ + W      +  +++A+G+  G + +WD+    K+  +      + + V ++A   + LS G     +   DIR            +++ +  LKWS D   LA    D+ L  W  + L  SP+  + +    +  IAWS     +           ++ +N      L  I TG  +  L WS+   E+ + +   +  +I V    +L  + +L GH   +L + +
Sbjct:  232 GAGIEKVQDPQTEDRRLQPSTPEKKSLFTYSLSSKRASPDDGNEVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLS-VEGDSVTSVGW-----SERGNLVAVGTHKGFVQIWDASAGKKLSTLEG----HTARVGALAWNADQLSSGSRDRMILQRDIRTPPVQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSL--SPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANEL-VSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLES 582          
BLAST of Cell division cycle 20-like protein vs. Ensembl Xenopus
Match: vps54 (VPS54 GARP complex subunit [Source:Xenbase;Acc:XB-GENE-1013521])

HSP 1 Score: 75.8702 bits (185), Expect = 1.148e-14
Identity = 64/293 (21.84%), Postives = 133/293 (45.39%), Query Frame = 3
Query:  444 NVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIHHLKWSLDFHYLAVVAKDSHLSFW----AENRLYSSPLVLFN-DKINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLW 1307
            N++DW+ +N++A+ L S  Y++      V + ++    ++  +S + W       S   LA+G++ G + LWD + + ++R +      + S V +++  N+ILS G   G + H+D+R   +H+    +K+ I  LKWS   + LA  + D  L  W     E +L S  L + +   +  + W     D          G +++++ +    + + +T   I  LLW    +E+ +     +  ++ +    +L  + +  GH   +L +A +P    I +   +    +W
Sbjct:    7 NLLDWNSENLVAIGLKSTAYIFSGENRTVTQKIHLSCPATY-VSSVSWI-----SSGTCLAIGTSSGEVQLWDIETQKRLRNMLG----HMSVVGALSWNNHILSSGSRLGHIHHHDVRIAEHHIGTLQHKQGICSLKWSPCGNKLASGSSDGDLKIWPCDPGETKLKSPLLNMPHPTAVKAMNWCPWLSDTLAVGGGMTDGLIRIWDTNSGKNIHSANTNSQICSLLWLPQTKEL-LTGHGPSRNQMTIWQYPSLLKMNDYYGHKGRVLHLALSPDQRRIFSAAANGTANIW 288          
BLAST of Cell division cycle 20-like protein vs. Ensembl Mouse
Match: Cdc20 (cell division cycle 20 [Source:MGI Symbol;Acc:MGI:1859866])

HSP 1 Score: 142.51 bits (358), Expect = 1.148e-36
Identity = 98/359 (27.30%), Postives = 177/359 (49.30%), Query Frame = 3
Query:  330 KLQQLISQSQTV--KRKFNRHISIHPERVLDAPEV-SLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDN-KKTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYS--SPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNRNQ--KSSLL 1373
            +L+ L SQ  T    RK  R+I   P+R+LDAPE+ +  + N++DWS  NV+AVAL ++VYLW+A +  + +++         IS + W      K  + LA+G+++  + LWD +++ ++R + S    + + V S++  + ILS G   G + H+D+R   +HV       + +  L+W+ D  +LA    D+ ++ W      S  +PL  F      +  +AW     +I           ++++N+    CL  +     +  +LWS  Y+E+ I        ++ +     +  + EL GH   +L +  +P G  +A+   DE +RLW CF+   A + +  +    KSSL+
Sbjct:  147 RLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWNAGSGDILQLLQMEQPGDY-ISSVAWI-----KEGNYLAVGTSNAEVQLWDVQQQKRLRNMTS----HSARVSSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNIVNVWPSGPGESGWAPLQTFTQHQGAVKAVAWCPWQSNILATGGGTSDRHIRIWNVCSGACLSAVDVHSQVCSILWSPHYKEL-ISGHGFAQNQLVIWKYPTMAKVAELKGHTARVLGLTMSPDGATVASAAADETLRLWRCFEMDPALRREREKASVAKSSLI 494          
BLAST of Cell division cycle 20-like protein vs. Ensembl Mouse
Match: Fzr1 (fizzy and cell division cycle 20 related 1 [Source:MGI Symbol;Acc:MGI:1926790])

HSP 1 Score: 111.694 bits (278), Expect = 6.254e-26
Identity = 104/409 (25.43%), Postives = 183/409 (44.74%), Query Frame = 3
Query:  174 ENFEIGLSRKSIDSN----SNYQELSIPNLIEKTMRPS---RKRLLKLSIHHESPSSDE-------KLQQLISQSQTV---KRKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIH-------HLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCF 1316
            +N + GL+  ++  N    +  +++  P   ++ ++PS    K L   S+  +  S D+        L  + ++SQ +    RK  R IS  P +VLDAPE+    + N++DWS  NV++V LG+ VYLW A   +V  + +       S++ + W      +  +++A+G+  G + +WD+    K+  +      + + V ++A   + LS G     +   DIR      P   +++ +         LKWS D   LA    D+ L  W  + L  SP+  + +    +  IAWS     +           ++ +N      L  I TG  +  L WS+   E+ + +   +  +I V    +L  + +L GH   +L +A +P GE I T   DE +R WN F
Sbjct:   83 DNGKDGLAYSALLKNELLGAGIEKVQDPQTEDRRLQPSTPEHKGLFTYSLSSKRSSPDDGNDVSPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLS-VEGDSVTSVGW-----SERGNLVAVGTHKGFVQIWDAAAGKKLSMLEG----HTARVGALAWNADQLSSGSRDRMILQRDIR-----TPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVWNHSSL--SPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQCIDTGSQVCNLAWSKHANEL-VSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVF 473          
BLAST of Cell division cycle 20-like protein vs. Ensembl Mouse
Match: Cdc20b (cell division cycle 20B [Source:MGI Symbol;Acc:MGI:3644472])

HSP 1 Score: 86.6557 bits (213), Expect = 1.197e-17
Identity = 71/295 (24.07%), Postives = 132/295 (44.75%), Query Frame = 3
Query:  444 NVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIHHLKWSLDFHYLAVVAKDSHLSFWAEN---RLYSSPLVLF--NDKINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNC 1313
            N +DWS QN++AVALG++VY+W+       E ++      LS+ C      T  +    LA+G+++G + LWD+  K ++R ++     + S V +++  +  LS G   G++ H+D+R   + V    +K+ +  LKWS D   L+    D  L+ W  +    +   PL +   +  +  + W     ++       + G L + +I+    + T ST   I  L+W    +E+A       N  + +     L       GH   +L ++ +P    + +   D    +W C
Sbjct:  235 NTLDWSSQNLVAVALGTSVYIWNGQNHSWIENID------LSVCCHYVSSVTWMREGSCLAVGTSEGEVQLWDAITKKQLRNLHG----HLSVVGALSWNHCTLSSGSRLGRVHHHDVRVAQHRVGTLYHKEAVCSLKWSPDGRLLSSGCNDGLLTIWPHDPGAGVQGLPLKVIPQSTAVKAMEWCPWQSEVLAVGGGVKDGCLHVLDINTGKNIQTPSTQSQICSLIWLPKTKEIATGQGAPKN-DVALWTCPTLFRSGGFFGHRDRVLHLSLSPDQTRLFSAAADGTACVWKC 518          
BLAST of Cell division cycle 20-like protein vs. Ensembl Mouse
Match: Cdc20b (cell division cycle 20B [Source:MGI Symbol;Acc:MGI:3644472])

HSP 1 Score: 85.5001 bits (210), Expect = 3.166e-17
Identity = 72/297 (24.24%), Postives = 132/297 (44.44%), Query Frame = 3
Query:  444 NVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIHHLKWSLDFHYLAVVAKDSHLSFWAEN---RLYSSPLVLF--NDKINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELV--GHLKSILCMATNPTGEVIATIGEDEQIRLWNC 1313
            N +DWS QN++AVALG++VY+W+       +  ++     LS+ C      T  +    LA+G+++G + LWD+  K ++R ++     + S V +++  +  LS G   G++ H+D+R   + V    +K+ +  LKWS D   L+    D  L+ W  +    +   PL +   +  +  + W     ++       + G L + +I+    + T ST   I  L+W    +E+A       N       D  L     L   GH   +L ++ +P    + +   D    +W C
Sbjct:  235 NTLDWSSQNLVAVALGTSVYIWNG------QNHSWIENIDLSVCCHYVSSVTWMREGSCLAVGTSEGEVQLWDAITKKQLRNLHG----HLSVVGALSWNHCTLSSGSRLGRVHHHDVRVAQHRVGTLYHKEAVCSLKWSPDGRLLSSGCNDGLLTIWPHDPGAGVQGLPLKVIPQSTAVKAMEWCPWQSEVLAVGGGVKDGCLHVLDINTGKNIQTPSTQSQICSLIWLPKTKEIATGQGAPKN-------DVALWTCPTLFRSGHRDRVLHLSLSPDQTRLFSAAADGTACVWKC 514          
BLAST of Cell division cycle 20-like protein vs. Ensembl Mouse
Match: Cdc20b (cell division cycle 20B [Source:MGI Symbol;Acc:MGI:3644472])

HSP 1 Score: 77.0258 bits (188), Expect = 1.263e-14
Identity = 48/161 (29.81%), Postives = 85/161 (52.80%), Query Frame = 3
Query:  444 NVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIHHLKWSLDFHYLAVVAKDSHLSFWAEN 926
            N +DWS QN++AVALG++VY+W+       E ++      LS+ C      T  +    LA+G+++G + LWD+  K ++R ++     + S V +++  +  LS G   G++ H+D+R   + V    +K+ +  LKWS D   L+    D  L+ W  +
Sbjct:  235 NTLDWSSQNLVAVALGTSVYIWNGQNHSWIENID------LSVCCHYVSSVTWMREGSCLAVGTSEGEVQLWDAITKKQLRNLHG----HLSVVGALSWNHCTLSSGSRLGRVHHHDVRVAQHRVGTLYHKEAVCSLKWSPDGRLLSSGCNDGLLTIWPHD 385          
BLAST of Cell division cycle 20-like protein vs. UniProt/SwissProt
Match: sp|Q12834|CDC20_HUMAN (Cell division cycle protein 20 homolog OS=Homo sapiens OX=9606 GN=CDC20 PE=1 SV=2)

HSP 1 Score: 145.591 bits (366), Expect = 6.073e-37
Identity = 111/430 (25.81%), Postives = 199/430 (46.28%), Query Frame = 3
Query:  135 GDRIMVHRGVMNFENFEIGLSRKSIDSNSN------YQELSIPNLIEKTMRPSRKRLLKLSIHHESPSSDEKLQQLISQSQTV--KRKFNRHISIHPERVLDAPEV-SLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDN-KKTIHHLKWSLDFHYLAVVAKDSHLSFW--AENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNRNQ--KSSLL 1373
            GDR + HR     E     LS+++   NS       +Q+    NL    +  ++   L     +       +L+ L SQ  T    RK  R+I   P+R+LDAPE+ +  + N++DWS  NV+AVAL ++VYLW A +  + +++         IS + W      K  + LA+G++   + LWD +++ ++R + S    + + V S++  + ILS G   G + H+D+R   +HV       + +  L+W+ D  +LA    D+ ++ W  A       PL  F      +  +AW     ++           ++++N+    CL  +     +  +LWS  Y+E+ I        ++ +     +  + EL GH   +L +  +P G  +A+   DE +RLW CF+   A++ +  +    KSSL+
Sbjct:   76 GDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEY-ISSVAWI-----KEGNYLAVGTSSAEVQLWDVQQQKRLRNMTS----HSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKEL-ISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLI 494          
BLAST of Cell division cycle 20-like protein vs. UniProt/SwissProt
Match: sp|Q5H7C0|CDC20_PIG (Cell division cycle protein 20 homolog OS=Sus scrofa OX=9823 GN=CDC20 PE=2 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 2.682e-36
Identity = 110/430 (25.58%), Postives = 198/430 (46.05%), Query Frame = 3
Query:  135 GDRIMVHRGVMNFENFEIGLSRKSIDSNSN------YQELSIPNLIEKTMRPSRKRLLKLSIHHESPSSDEKLQQLISQSQTV--KRKFNRHISIHPERVLDAPEV-SLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDN-KKTIHHLKWSLDFHYLAVVAKDSHLSFW--AENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNRNQ--KSSLL 1373
            GDR + HR     E     LS+++   NS       +Q+    NL    +  ++   L     +       +L+ L SQ  T    RK  R+I   P+R+LDAPE+ +  + N++DWS  NV+AVAL ++VYLW A +  + +++         +S + W      K  + LA+G++   + LWD +++ ++R + S    + + V S+   + ILS G   G + H+D+R   +HV       + +  L+W+ D  +LA    D+ ++ W  A       PL  F      +  +AW     ++           ++++N+    CL  +     +  +LWS  Y+E+ I        ++ +     +  + EL GH   +L +  +P G  +A+   DE +RLW CF+   A++ +  +    KSSL+
Sbjct:   76 GDRYIPHRSASQMEVASFLLSKENQPDNSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGDY-VSSVAWI-----KEGNYLAVGTSSAEVQLWDVQQQKRLRNMTS----HSARVGSLCWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKEL-ISGHGFAQNQLVIWKYPTMAKVAELKGHTARVLSLTMSPDGATVASAAADETLRLWRCFELDPARRREREKASAAKSSLI 494          
BLAST of Cell division cycle 20-like protein vs. UniProt/SwissProt
Match: sp|Q62623|CDC20_RAT (Cell division cycle protein 20 homolog OS=Rattus norvegicus OX=10116 GN=Cdc20 PE=1 SV=2)

HSP 1 Score: 142.51 bits (358), Expect = 7.346e-36
Identity = 98/359 (27.30%), Postives = 176/359 (49.03%), Query Frame = 3
Query:  330 KLQQLISQSQTV--KRKFNRHISIHPERVLDAPEV-SLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDN-KKTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYSS--PLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNR--NQKSSLL 1373
            +L+ L SQ  T    RK  R+I   P+R+LDAPE+ +  + N++DWS  NV+AVAL ++VYLW+A +  + +++         IS + W      K  + LA+G+++  + LWD +++ ++R + S    + + V S++  + ILS G   G + H+D+R   +HV       + +  L+W+ D  +LA    D+ ++ W      S   PL  F      +  +AW     +I           ++++N+    CL  +     +  +LWS  Y+E+ I        ++ +     +  + EL GH   +L +  +P G  +A+   DE +RLW CF+   A + +  +    KSSL+
Sbjct:  147 RLKVLYSQKATPGSSRKACRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWNAGSGDILQLLQMEQPGDY-ISSVAWI-----KEGNYLAVGTSNAEVQLWDVQQQKRLRNMTS----HSARVSSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNIVNVWPSGPGESGWVPLQTFTQHQGAVKAVAWCPWQSNILATGGGTSDRHIRIWNVCSGACLSAVDVHSQVCSILWSPHYKEL-ISGHGFAQNQLVIWKYPTMAKVAELKGHTARVLSLTMSPDGATVASAAADETLRLWRCFELDPALRREREKASTSKSSLI 494          
BLAST of Cell division cycle 20-like protein vs. UniProt/SwissProt
Match: sp|Q9JJ66|CDC20_MOUSE (Cell division cycle protein 20 homolog OS=Mus musculus OX=10090 GN=Cdc20 PE=1 SV=2)

HSP 1 Score: 142.51 bits (358), Expect = 8.029e-36
Identity = 98/359 (27.30%), Postives = 177/359 (49.30%), Query Frame = 3
Query:  330 KLQQLISQSQTV--KRKFNRHISIHPERVLDAPEV-SLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDN-KKTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYS--SPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNRNQ--KSSLL 1373
            +L+ L SQ  T    RK  R+I   P+R+LDAPE+ +  + N++DWS  NV+AVAL ++VYLW+A +  + +++         IS + W      K  + LA+G+++  + LWD +++ ++R + S    + + V S++  + ILS G   G + H+D+R   +HV       + +  L+W+ D  +LA    D+ ++ W      S  +PL  F      +  +AW     +I           ++++N+    CL  +     +  +LWS  Y+E+ I        ++ +     +  + EL GH   +L +  +P G  +A+   DE +RLW CF+   A + +  +    KSSL+
Sbjct:  147 RLKVLYSQKATPGSSRKTCRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWNAGSGDILQLLQMEQPGDY-ISSVAWI-----KEGNYLAVGTSNAEVQLWDVQQQKRLRNMTS----HSARVSSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNIVNVWPSGPGESGWAPLQTFTQHQGAVKAVAWCPWQSNILATGGGTSDRHIRIWNVCSGACLSAVDVHSQVCSILWSPHYKEL-ISGHGFAQNQLVIWKYPTMAKVAELKGHTARVLGLTMSPDGATVASAAADETLRLWRCFEMDPALRREREKASVAKSSLI 494          
BLAST of Cell division cycle 20-like protein vs. UniProt/SwissProt
Match: sp|Q3E906|CD205_ARATH (Cell division cycle 20.5, cofactor of APC complex OS=Arabidopsis thaliana OX=3702 GN=CDC20-5 PE=1 SV=3)

HSP 1 Score: 137.887 bits (346), Expect = 2.062e-34
Identity = 116/421 (27.55%), Postives = 194/421 (46.08%), Query Frame = 3
Query:  138 DRIMVHRGVMNFE--NFEIGLSRK-SIDSNSNYQELSIPNLIEKTMRPSRKRLLK--------LSIHHESPSSDEKLQQLISQSQTVKRKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNY----GPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDW-DNKKTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYSSP-----LVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCP 1325
            DR + +R  M+F+  N+ +   RK ++D  ++    +    + + M  +R R+L         LS +H  P             Q +  K  R+I  + ERVLDAP ++   + N++DW   NV+A+ALG  VYLWDA +    +++      GP +S++     W   TQ   D  LA+G  +  + LWD     ++R +      + S V S+A  N+IL+ G   GK+ + D+R  S+ V  +  + + +  LKWS     LA    D+ +  W    + SS      L  F +    +  +AW      +         G++K +N     CL ++ TG  +  LLWS+   E+ + S      ++ +    ++  + EL GH   +L MA +P G  +A+   DE +RLWN F  P
Sbjct:   31 DRFIPNRSAMDFDFANYALTQGRKRNVDEVTSASRKAYMTQLAEAMNQNRTRILAFRNKPKALLSSNHSDPP----------HQQPISVKPRRYIPQNSERVLDAPGIADDFYLNLLDWGSSNVLAIALGDTVYLWDASSGSTYKLVTIDEEEGPVTSIN-----W---TQDGLD--LAIGLDNSEVQLWDCVSNRQVRTLRGG---HESRVGSLAWNNHILTTGGMDGKIVNNDVRIRSSIVETYLGHTEEVCGLKWSESGKKLASGGNDNVVHIWDHRSVASSNPTRQWLHRFEEHTAAVRALAWCPFQASLLATGGGVGDGKIKFWNTHTGACLNSVETGSQVCSLLWSKSEREL-LSSHGFTQNQLTLWKYPSMVKMAELNGHTSRVLFMAQSPDGCTVASAAGDETLRLWNVFGEP 427          
BLAST of Cell division cycle 20-like protein vs. TrEMBL
Match: K7ISD3 (WD_REPEATS_REGION domain-containing protein OS=Nasonia vitripennis OX=7425 GN=fzy PE=4 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 3.740e-44
Identity = 130/450 (28.89%), Postives = 213/450 (47.33%), Query Frame = 3
Query:  102 GSKLKP-------KTQYIGDRIMVHRGVMNFENFEIGLSRKSIDSNSNYQELSIPN------LIEKTMRPSRKRLLK-LSIHHESPSSDEKLQQ----LISQSQTVK--RKFNRHISIHPERVLDAPE-VSLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWD-NKKTIHHLKWSLDFHYLAVVAKDSHLSFW----AENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNRNQKS 1364
            GSK  P       KT   GDR +  R   NFE   +G  ++S D  SN  E S P+      LI + +       ++ LS  +++P+  E  Q     + SQ++T    +  +R+I   P+R+LDAPE V   + N++DWS  N++AVALG+ VYLW+A    +E++       +  +  + W     Y     LA+G+T G+  LWD  +  ++R +      + + V S++  ++I+S G   G++ H+D+R   + V   + + + +  LKWSLD  YLA    D+ L  W     +N  +  P+   N     +  +AW      +           ++ +N +   CL TI T   +  LLWS  Y+E+ +        ++ +     +  + EL GH   +L +A +P G  + + G DE +RLW CFQ PD  K K     KS
Sbjct:   85 GSKKSPSRSTTPAKTPCGGDRFIPARSTTNFE---LGYYKQSTDQESNKSECSSPSKREMQRLIGENLHGGDVNNMRVLSYQNKAPAPPEGYQNPLRVVYSQTKTPASVKSSSRYIPQAPDRILDAPEIVDDYYLNLVDWSSSNILAVALGANVYLWNAGTGTIEQLFEL--EGNDYVCSVAWIQEGLY-----LAVGTTVGNTELWDCGQMKRVRVMSG----HSARVGSLSWNSHIISSGCRAGQIVHHDVRQREHLVATMNAHAQEVCGLKWSLDGKYLASGGNDNMLQIWPCMAGQNYSHVQPIYSLNQHQAAVKALAWCPWQNHVLASGGGTADRTIRFWNCNTGACLNTIDTKSQVCSLLWSTTYKEI-VSGHGYAQNQLTIWKYPAMSKVAELTGHTNRVLHLAMSPDGTTVLSAGADETLRLWKCFQ-PDPHKKKETTEVKS 518          
BLAST of Cell division cycle 20-like protein vs. TrEMBL
Match: A0A1B6E2R7 (WD_REPEATS_REGION domain-containing protein OS=Clastoptera arizonana OX=38151 GN=g.12966 PE=4 SV=1)

HSP 1 Score: 167.162 bits (422), Expect = 1.658e-42
Identity = 126/445 (28.31%), Postives = 213/445 (47.87%), Query Frame = 3
Query:  120 KTQYIGDRIMVHRGVMNFENFEIGLSRKSIDSNSNYQELSIPNLIEKTMRPSRKRLLK----------------LSIHHESPSSDE----KLQQLISQSQT--VKRKFNRHISIHPERVLDAPE-VSLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDN-KKTIHHLKWSLDFHYLAVVAKDSHLSFWAE--NRLYSSPLVLFN-----DKINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNRNQK 1361
            KT   GDR +  R   NFE     +++K        +E  IP      + PS+K + +                L+   ++P+  E     L+ + SQS+T  V +   R+IS  P+R+LDAPE V   + N++DWS  N++AVALG++VYLW+A    +E++M     +S  +  L W      +  ++LA+G+  G I LWD++   ++R +   D +N + V S++  + ILS G   G++ H+D+R   +         + +  LKWS D  YLA    D+ L+ W++   +++S P  ++        +  +AW     +I           ++ +N +   CL +I T   +  LLWS  Y+E+ +      N ++ +    +L    EL GH   +L ++ +P G  + + G DE +RLW CF  PD  K K     K
Sbjct:   47 KTPQGGDRFIPSRCTTNFELGHYKMNQK--------EETDIP------ISPSQKEMQRAMSENLHGCDITKTRILAFQKKAPAPPEGFINPLKVVYSQSKTPLVAKGSTRYISQTPDRILDAPEIVDDYYLNLIDWSPTNILAVALGASVYLWNAATGNIEQLMEL--EASDYVCSLNWI-----QEGNLLAVGTFMGPIQLWDTEHVKRLRIM---DGHN-TRVGSLSWNSYILSSGARSGQIIHHDVRQRDHKTAILSGHTQEVCGLKWSPDGRYLASGGNDNMLNIWSQVPGQMHSQPQPIYTLNSHQAAVKAVAWCPWQNNILASGGGTADRHIRFWNCNTGACLNSIDTKSQVCALLWSTNYKEL-VSGHGYANNQLIIWKYPSLTKTAELTGHTARVLHLSMSPDGSTVLSAGADETLRLWKCF-LPDPTKKKEPTEAK 464          
BLAST of Cell division cycle 20-like protein vs. TrEMBL
Match: M4SIX7 (Cdc20C (Fragment) OS=Brachionus calyciflorus OX=104777 GN=CDC20C PE=4 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 2.228e-42
Identity = 131/432 (30.32%), Postives = 216/432 (50.00%), Query Frame = 3
Query:   96 CLGSKLKPKTQYI-GDRIMVHRGVMNFENFEIGLSRKSIDSNSNYQELSIPNLIEKTMR------PSRKRLLKLSIHHESPSSDEKLQ-QLISQSQTVKRKFNRHISIHPERVLDAPEV-SLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIHH----LKWSLDFHYLAVVAKDSHLSFWAEN--RLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKK 1337
            C  +K K     I  DR +  R   N E     L+ K+I  +S+ +E  I ++ +K +       P R R+L L  H++   +D K    L S   +VK+   R+IS  PER+LDAPE  +  + N++DWS QN +AV+L + +Y+W A + ++ ++      +   I    W    Q    HILA+G++   + LWD   +T +R++ S     +S V S+A  N IL+ G   G + H+D+R   +HV      KT  H    LKWS +  +LA    D+    W  N  +  S PL +F +    +  +AW     ++         G + L+N++    + +  +   ISCLLWS+ Y+E+ I S   +  ++ +    ++  + +L+GH   +L MA +P GE++A+IG DE +RLW CF   +  K
Sbjct:   23 CTSAKKKQTPSGITNDRYIPSRVASNMEIGYHLLNTKNISDDSD-RENQIDHVKKKLINDTCNGLPDRPRILNL--HNKEIENDPKSSLYLNSLVNSVKKVNKRYISPTPERILDAPEFRNDYYLNLIDWSSQNNLAVSLNTDMYIWSAPSGEISQLFAMEEDTRDYICSTSW----QPAKGHILAVGNSKNIVELWDVNTQTCLRQMKSQ----KSRVGSLAWNNYILTSGSRSGDIHHHDVRVAQHHV---GTLKTHDHEVCGLKWSNNGRHLASGGNDNLAVVWDSNYSQDTSQPLHVFREHTAAVKALAWCPWQNNVLATGGGTSDGRIHLWNVNSGELIQSTDSKSQISCLLWSKHYKEL-ISSHGYSTNQLTIWRYPDMTPVADLLGHQNRVLMMAMSPDGEMVASIGADETLRLWRCFAVDEKNK 439          
BLAST of Cell division cycle 20-like protein vs. TrEMBL
Match: A0A1B6CDG8 (WD_REPEATS_REGION domain-containing protein OS=Clastoptera arizonana OX=38151 GN=g.12972 PE=4 SV=1)

HSP 1 Score: 166.777 bits (421), Expect = 2.259e-42
Identity = 126/445 (28.31%), Postives = 213/445 (47.87%), Query Frame = 3
Query:  120 KTQYIGDRIMVHRGVMNFENFEIGLSRKSIDSNSNYQELSIPNLIEKTMRPSRKRLLK----------------LSIHHESPSSDE----KLQQLISQSQT--VKRKFNRHISIHPERVLDAPE-VSLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDN-KKTIHHLKWSLDFHYLAVVAKDSHLSFWAE--NRLYSSPLVLFN-----DKINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNRNQK 1361
            KT   GDR +  R   NFE     +++K        +E  IP      + PS+K + +                L+   ++P+  E     L+ + SQS+T  V +   R+IS  P+R+LDAPE V   + N++DWS  N++AVALG++VYLW+A    +E++M     +S  +  L W      +  ++LA+G+  G I LWD++   ++R +   D +N + V S++  + ILS G   G++ H+D+R   +         + +  LKWS D  YLA    D+ L+ W++   +++S P  ++        +  +AW     +I           ++ +N +   CL +I T   +  LLWS  Y+E+ +      N ++ +    +L    EL GH   +L ++ +P G  + + G DE +RLW CF  PD  K K     K
Sbjct:   47 KTPQGGDRFIPSRCTTNFELGHYKMNQK--------EETDIP------ISPSQKEMQRAMSENLHGCDITKTRILAFQKKAPAPPEGFINPLKVVYSQSKTPLVAKGSTRYISQTPDRILDAPEIVDDYYLNLIDWSPTNILAVALGASVYLWNAATGNIEQLMEL--EASDYVCSLNWI-----QEGNLLAVGTFMGPIQLWDTEHVKRLRIM---DGHN-TRVGSLSWNSYILSSGARSGQIIHHDVRQRDHKTAILSGHTQEVCGLKWSPDGRYLASGGNDNMLNIWSQVPGQMHSQPQPIYTLNSHQAAVKAVAWCPWQNNILASGGGTADRHIRFWNCNTGACLNSIDTKSQVCALLWSTNYKEL-VSGHGYANNQLIIWKYPSLTKTAELTGHTARVLHLSMSPDGSTVLSAGADETLRLWKCF-LPDPTKKKEPTEAK 464          
BLAST of Cell division cycle 20-like protein vs. TrEMBL
Match: A0A291S6V9 (Fizzy-like protein OS=Diachasma muliebre OX=1309577 GN=fzy PE=4 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 2.979e-42
Identity = 126/440 (28.64%), Postives = 205/440 (46.59%), Query Frame = 3
Query:  120 KTQYIGDRIMVHRGVMNFENFEIGLSRKSIDSNSN---YQELSIPN------LIEKTMRPSRKRLLK-LSIHHESPSSDEKLQQ----LISQSQTVK--RKFNRHISIHPERVLDAPE-VSLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPD-WDNKKTIHHLKWSLDFHYLAVVAKDSHLSFW----AENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNRNQKS 1364
            KT   GDR +  R   NF+     L + + DS+ +     E S P+      LI + +       ++ LS  +++P   E  Q     + SQS+T    +  +R+I   P+R+LDAPE V   + N++DWS  NV+AVALG  VYLW+A    +E++       +  +  + W     Y     LA+G T G+  LWD  +  ++R +      + + V S+A   +IL+ G   GKL H+D+R   + V     + + I  LKWS D  YLA    D+ L  W      N+  + P+   N     +  +AW     ++           ++ +N +   CL ++ T   +  LLWS  Y+E+ +        ++ +    N+  + EL GH   +L +A +P G  + + G DE +RLW CFQ    KK K++   KS
Sbjct:   91 KTPSGGDRFIPSRSTTNFDLAYHKLQQHASDSDHDKISTSEASSPSKKEMQRLISENLHGGDINSMRVLSYQNKAPEPPEGYQNPLRVVYSQSKTPASIKTSSRYIPQAPDRILDAPEIVDDYYLNLVDWSSSNVLAVALGGNVYLWNAGTGTIEQLFEL--EGNDYVCSVAWIQEGPY-----LAVGCTSGNTELWDCSQMKRVRIMNG----HAARVGSLAWNAHILTSGCRAGKLGHHDVRQRDHLVSSVHAHAQEICGLKWSTDGKYLASGGNDNMLQIWPAIGGTNQAQTRPIYTMNQHQAAVKALAWCPWQTNVLASGGGTADRTIRFWNCNTGACLNSVDTQSQVCSLLWSPTYKEI-VSGHGYAQNQLTIWKYPNMTKVAELTGHTARVLHLAMSPDGTTVLSAGADETLRLWKCFQQDPTKKKKDHFEPKS 518          
BLAST of Cell division cycle 20-like protein vs. Ensembl Cavefish
Match: cdc20 (cell division cycle 20 [Source:NCBI gene;Acc:103046720])

HSP 1 Score: 145.976 bits (367), Expect = 4.649e-38
Identity = 101/351 (28.77%), Postives = 177/351 (50.43%), Query Frame = 3
Query:  333 LQQLISQSQT-VKRKFNRHISIHPERVLDAPEV-SLVHPNVMDWSKQNVIAVALGSAVYLWDA------IACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDW-DNKKTIHHLKWSLDFHYLAVVAKDSHLSFWA--ENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLK 1343
            L+ L SQ+ T    K  R+IS HPER+LDAPE+ +  + N+MDW +QN +AVAL   VYLWDA      +  K+EE   Y       I  + W      +  + LA+G++D  + LWD + + ++R +      +R+ V  ++  ++ILS G   G +  +D+R   +H+     + + +  L WS D  YLA    D+ ++ W+  ++    +P+  F +    +  +AW      I           ++++N++   C+    T   +S L++S  Y+E+ +     ++ ++ +    +L  + EL GH   +L +A +P G  +A++  DE IRLW CF+    KK K
Sbjct:  150 LKVLYSQTPTPASMKKTRYISTHPERILDAPELRNDFYLNLMDWGRQNYLAVALAEHVYLWDASQGDIVLLKKMEEENGY-------ICSVSW-----SRDGNFLAVGTSDCKVELWDVQYQKRLRSMDG----HRARVGCLSWNDHILSSGSRSGLIHQHDVRVADHHLSTLRGHAQEVCGLTWSPDGRYLASGGNDNTVNIWSGVQSSALQNPVHSFTEHEGAVKALAWCPWQPSILATGGGTSDRHIRIWNVNSGSCISAWDTQSQVSSLVFSPNYKEL-VSGHGFSHDKVFIWKYPSLSKVTELQGHEGRVLNLALSPDGSTVASLSADETIRLWKCFEKDPTKKAK 483          
BLAST of Cell division cycle 20-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000052515.1 (fizzy-related protein homolog [Source:NCBI gene;Acc:103047033])

HSP 1 Score: 109.768 bits (273), Expect = 1.631e-25
Identity = 90/326 (27.61%), Postives = 147/326 (45.09%), Query Frame = 3
Query:  369 RKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIHH------LKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCF 1316
            RK  R IS  P +VLDAPE+    + N++DWS  NV++V LG+ VYLW A   +V  + +       S++ + W      +  +++A+G+  G + +WD+    K+  +      + + V ++A   + LS G     +   DIR      P    +K + H      LKWS D   LA    D+ L  W  N    SP+  + +    +  IAWS     +           ++ +N      L +  TG  +  L WS+   E+ + +   +  +I V    +L  + +L GH   +L +A +P GE I T   DE +R WN F
Sbjct:  159 RKPMRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLS-VEGDSVTSVGW-----SERGNLVAVGTHKGFVQIWDAAAGKKLSVLEG----HTARVGALAWNVDQLSSGSRDRLILQRDIR----APPQQSERKLLGHRQEVCGLKWSTDHQLLASGGNDNKLLVW--NHSSVSPMQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQSTDTGSQVCNLAWSKHTNEL-VSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVF 467          
BLAST of Cell division cycle 20-like protein vs. Ensembl Cavefish
Match: fzr1a (fizzy and cell division cycle 20 related 1 [Source:NCBI gene;Acc:103039491])

HSP 1 Score: 108.997 bits (271), Expect = 3.391e-25
Identity = 100/362 (27.62%), Postives = 162/362 (44.75%), Query Frame = 3
Query:  273 SRKRLLKLSIHHESPSSDEKLQQLISQSQTV---KRKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIH-------HLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCF 1316
            S KR +    ++ SP S   L  + S+SQ +    RK  R IS  P +VLDAPE+    + N++DWS  NV++V LG+ VYLW A   +V  + +       S++ + W      + +H+ A+G+  G + +WD+    K+  +      + + V ++A   + LS G     +   DIR      P   +++ +         LKWS D   LA    D+ L  W  N     P+  + +    +  IAWS     +           ++ +N      L  I TG  +  L WS+   E+ + +   +  +I V    +L  I +L GH   +L +A +P GE I T   DE +R WN F
Sbjct:  135 STKRTMPDDGNNVSPYS---LSPVSSKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLGTCVYLWSACTSQVTRLCDLS-VEGDSVTSVGWSE----RGNHV-AVGTHKGFVQIWDAAAGKKLFALEG----HTARVGALAWNADQLSSGSRDRMILQRDIR-----TPPLQSERRLQGHRQEVCGLKWSTDHQLLASGGNDNKLLVW--NHSSVQPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTAQPLQCIDTGSQVCNLAWSKHTNEL-VSTHGYSQNQILVWKYPSLTQIAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVF 475          
BLAST of Cell division cycle 20-like protein vs. Ensembl Cavefish
Match: fzr1b (fizzy-related protein homolog [Source:NCBI gene;Acc:103024543])

HSP 1 Score: 108.227 bits (269), Expect = 6.143e-25
Identity = 88/325 (27.08%), Postives = 146/325 (44.92%), Query Frame = 3
Query:  369 RKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIHH-----LKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCF 1316
            RK  R IS  P +VLDAPE+    + N++DWS  N+++V LG+ VYLW A   +V  + +       S++ + W      +   ++A+G+  G + +WD+    K+  +      + + V ++A     LS G     +   D+R      P  + K   H      LKWS D  +LA    D+ L  W  + L   P+  +++    +  IAWS     +           L+ +N      L +  TG  +  L WS+   E+ + +   +  +I V    +L  + +L GH   +L +A +P GE I T   DE +R WN F
Sbjct:  156 RKPARKISKIPFKVLDAPELQDDFYLNLVDWSAGNLLSVGLGACVYLWSACTSQVTRLCDLS-VDGDSVTSVCW-----NERGSLVAVGTHKGFVQIWDAAGGRKLTSLEG----HSARVGALAWNGEQLSSGSRDRVILQRDVRT----PPPMERKLQGHRQEVCGLKWSPDHQHLASGGNDNKLLVWNSSSL--QPVQQYSEHLAAVKAIAWSPHQHGLLASGGGTADRCLRFWNTLTGQALQSTDTGSQVCNLAWSKHANEL-VSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAVSPDGEAIVTGAGDETLRFWNVF 463          
BLAST of Cell division cycle 20-like protein vs. Ensembl Cavefish
Match: fzr1b (fizzy-related protein homolog [Source:NCBI gene;Acc:103024543])

HSP 1 Score: 82.4185 bits (202), Expect = 1.900e-16
Identity = 77/304 (25.33%), Postives = 133/304 (43.75%), Query Frame = 3
Query:  369 RKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIHH-----LKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATN 1253
            RK  R IS  P +VLDAPE+    + N++DWS  N+++V LG+ VYLW A   +V  + +       S++ + W      +   ++A+G+  G + +WD+    K+  +      + + V ++A     LS G     +   D+R      P  + K   H      LKWS D  +LA    D+ L  W  + L   P+  +++    +  IAWS     +           L+ +N      L +  TG  +  L WS+   E+ + +   +  +I V    +L  + +L GH   +L +  N
Sbjct:  156 RKPARKISKIPFKVLDAPELQDDFYLNLVDWSAGNLLSVGLGACVYLWSACTSQVTRLCDLS-VDGDSVTSVCW-----NERGSLVAVGTHKGFVQIWDAAGGRKLTSLEG----HSARVGALAWNGEQLSSGSRDRVILQRDVR----TPPPMERKLQGHRQEVCGLKWSPDHQHLASGGNDNKLLVWNSSSL--QPVQQYSEHLAAVKAIAWSPHQHGLLASGGGTADRCLRFWNTLTGQALQSTDTGSQVCNLAWSKHANEL-VSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLVRN 442          
BLAST of Cell division cycle 20-like protein vs. Ensembl Sea Lamprey
Match: cdc20 (cell division cycle 20 homolog [Source:ZFIN;Acc:ZDB-GENE-040426-2044])

HSP 1 Score: 138.658 bits (348), Expect = 4.802e-36
Identity = 93/334 (27.84%), Postives = 160/334 (47.90%), Query Frame = 3
Query:  372 KFNRHISIHPERVLDAPEV-SLVHPNVMDWSKQNVIAVALGS-AVYLWDAIACKVEEIMNY-GPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDN-KKTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNR 1352
            K  RHI   PERVLDAP V +  + N +DWS  NV+ VALG    YLWDA    V + M   G     S+S +           +I+A+G++  ++ +WD +R   +R +    + +   V S++   ++LS G   G++ H+D+R   +HV       + +  L WS     LA  + D++L  WA     S+PL         +  +AW      +           ++L+NI+  IC   +     +  +LWS  ++E+ + +      ++ +     +  I EL+GH + +L +  +P G  + ++G DE +RLW CFQ  +++K K  +
Sbjct:  166 KKKRHIPTQPERVLDAPAVRNDFYLNPLDWSVDNVVCVALGQFGTYLWDAETGNVTQHMKMEGQDYPSSVSWVP-------TGGNIIAIGTSFKTVQIWDVERNKCLRNM----QGHSGRVSSLSWNGHLLSSGSRSGQIHHHDVRMVQHHVATLSGHSQEVCGLAWSPGGRLLASGSNDNNLLVWANGTTSSAPLHSLQQHTAAVKALAWCPWQASLLASGGGTNDHHIRLWNINTGICFNAVDAKSQVCSVLWSSEHKEL-LSAHGYAKNQLTLWAYPAMVPIAELLGHTERVLQVVASPDGSSVMSVGADESLRLWRCFQGDESRKKKKQQ 487          
BLAST of Cell division cycle 20-like protein vs. Ensembl Sea Lamprey
Match: fzr1a (fizzy/cell division cycle 20 related 1a [Source:ZFIN;Acc:ZDB-GENE-040426-712])

HSP 1 Score: 95.5153 bits (236), Expect = 2.175e-21
Identity = 98/384 (25.52%), Postives = 169/384 (44.01%), Query Frame = 3
Query:  270 PSRKRLLKLSIHHESPSSDE-------KLQQLISQSQTV---KRKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSA-VYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHN--SNHVPDWDNKKTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNRNQKSSL 1370
            P ++ L   SI  +  S DE        L  + ++SQ +    RK  R IS  P +VLDAPE+    + N++DWS  NV++V L    VYL+  +  +V  + +       S++ + W      + +H+ A+G+  G + +WD+    KI  +        +   ++A   + LS G     +   D+R    +       +++ +  LKWS D  +LA    D+ L  W  + L  SP+  + +    +  IAWS     +           ++ +N      L  + TG  +  L WS+   E+ + +   +  +I V    +L  + +L GH   +L +A +P GE I T   DE +R WN F      K ++ +  KS L
Sbjct:  127 PMKRNLFHYSISTKRSSPDEDHDISPYSLSPVSNKSQKLLRSPRKPTRKISKIPFKVLDAPELQDDFYLNLVDWSSLNVLSVGLYVCRVYLFLCVCAQVTRLCDLS-VDGDSVTSVSWSE----RGNHV-AVGTHKGLVQIWDAAAGKKINTL-EGHTARVAGAGALAWNADQLSSGSRDRMIVQRDVRAPPVTTERRLQGHRQEVCGLKWSPDHQHLASGGNDNKLFVWNGSSL--SPVQQYTEHLAAVKAIAWSPHQHGLLASGGGTADRCIRFWNTLTGQPLQYVDTGSQVCNLAWSKHANEL-VSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAMSPDGEAIVTGAGDETLRFWNVF-----SKTRSTKESKSVL 495          
BLAST of Cell division cycle 20-like protein vs. Ensembl Sea Lamprey
Match: wdr48a (WD repeat domain 48a [Source:ZFIN;Acc:ZDB-GENE-061110-55])

HSP 1 Score: 48.1358 bits (113), Expect = 4.131e-6
Identity = 43/194 (22.16%), Postives = 83/194 (42.78%), Query Frame = 3
Query:  831 NKKTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFNDKINDIAWSHRDVDIFLCC------TACEKGELKLYNISQRICLLTISTGCN-ISCLLWSEIYEEVAIISEDRN------NFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNRNQKSSLL 1373
            N+  ++ L+     + L    +DS +  W  ++    P +   +   D  W +   D+ LCC      +A     +K++N  +  C+ T+ T  + +  L +++  E+VA    DR       N    +   +N      L G+  SI  +A N  G +I +   ++ +R+W+   C    KLK + +   +LL
Sbjct:   29 NRSGVNALQLDHSLNRLFTAGRDSIVRIWNVSQHKQDPFIASMEHHTD--WVN---DVVLCCNGRTLISASSDTTVKVWNAHKGFCMSTLRTHKDYVKALAYAKDKEQVASAGLDRQIFLWDVNTLTALTASNNTVTTSSLSGNKDSIYSLAMNQMGTIIVSGSTEKVLRVWDPRTCAKLMKLKGHTDNVKALL 217          
BLAST of Cell division cycle 20-like protein vs. Ensembl Sea Lamprey
Match: wdr48a (WD repeat domain 48a [Source:ZFIN;Acc:ZDB-GENE-061110-55])

HSP 1 Score: 47.7506 bits (112), Expect = 4.391e-6
Identity = 43/194 (22.16%), Postives = 83/194 (42.78%), Query Frame = 3
Query:  831 NKKTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFNDKINDIAWSHRDVDIFLCC------TACEKGELKLYNISQRICLLTISTGCN-ISCLLWSEIYEEVAIISEDRN------NFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNRNQKSSLL 1373
            N+  ++ L+     + L    +DS +  W  ++    P +   +   D  W +   D+ LCC      +A     +K++N  +  C+ T+ T  + +  L +++  E+VA    DR       N    +   +N      L G+  SI  +A N  G +I +   ++ +R+W+   C    KLK + +   +LL
Sbjct:   29 NRSGVNALQLDHSLNRLFTAGRDSIVRIWNVSQHKQDPFIASMEHHTD--WVN---DVVLCCNGRTLISASSDTTVKVWNAHKGFCMSTLRTHKDYVKALAYAKDKEQVASAGLDRQIFLWDVNTLTALTASNNTVTTSSLSGNKDSIYSLAMNQMGTIIVSGSTEKVLRVWDPRTCAKLMKLKGHTDNVKALL 217          
BLAST of Cell division cycle 20-like protein vs. Ensembl Yeast
Match: CDH1 (Activator of anaphase-promoting complex/cyclosome (APC/C); antagonist of the spindle assembly checkpoint; directs ubiquitination of cyclins resulting in mitotic exit; targets the APC/C to specific substrates including: Cdc20p, Ase1p, Cin8p, Fin1p and Clb5p; partially active in metaphase, and fully active in anaphase; cell-cycle regulated [Source:SGD;Acc:S000002971])

HSP 1 Score: 89.3521 bits (220), Expect = 1.585e-19
Identity = 84/356 (23.60%), Postives = 163/356 (45.79%), Query Frame = 3
Query:  312 SPSSDEKLQQLISQSQTVKRKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPD------WDNKKTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNN 1349
            SP   +  Q L+S  +       R I+  P RVLDAP ++   + +++DWS  +V+AVALG +++L D     V  + +    +    + L W     +     LA+G  +G + ++D  ++  IR +  S   +R  V  ++  N++L+ G    ++ H D+R     +PD        + + +  LKW++  + LA    D+ +  +       SP++ F++    +  +AWS     +           LK++N++  I +  I +G  I  ++WS+   E+ + S   + + + +   +++  I  L GH   +L +  +  G  + +   DE +R W  F  P AK   N+
Sbjct:  227 SPVRPDSKQLLLSPGKQF-----RQIAKVPYRVLDAPSLADDFYYSLIDWSSTDVLAVALGKSIFLTDNNTGDVVHLCD----TENEYTSLSWIGAGSH-----LAVGQANGLVEIYDVMKRKCIRTL--SGHIDR--VACLSWNNHVLTSGSRDHRILHRDVR-----MPDPFFETIESHTQEVCGLKWNVADNKLASGGNDNVVHVYEGTS--KSPILTFDEHKAAVKAMAWSPHKRGVLATGGGTADRRLKIWNVNTSIKMSDIDSGSQICNMVWSKNTNEL-VTSHGYSKYNLTLWDCNSMDPIAILKGHSFRVLHLTLSNDGTTVVSGAGDETLRYWKLFDKPKAKVQPNS 556          
BLAST of Cell division cycle 20-like protein vs. Ensembl Yeast
Match: CDC20 (Activator of anaphase-promoting complex/cyclosome (APC/C); APC/C is required for metaphase/anaphase transition; directs ubiquitination of mitotic cyclins, Pds1p, and other anaphase inhibitors; cell-cycle regulated; potential Cdc28p substrate; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000003084])

HSP 1 Score: 89.3521 bits (220), Expect = 1.918e-19
Identity = 78/329 (23.71%), Postives = 148/329 (44.98%), Query Frame = 3
Query:  381 RHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDW-DNKKTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFNDK-----INDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSE---------IYEEVAIISEDRNNFRIRVLHDDNLQLIIELV-GHLKSILCMATNPTGEVIATIGEDEQIRLWNCF 1316
            R I+ +PER+LDAP      + N++ WSK+NV+A+AL +A+YLW+A    V  + ++  T+  S+        T    D  +++G  DG+  +WD +  + IR + S        + S++  + +++ G   G+++  D+R   + V  W ++   +  L +  D   LA    D+ +  W       + L  F+ K     +  ++W     +I           +  +N      + +I+TG  +S L W +         + +E+     +  N  I V + +    + E+V  H   I C   +P G  +AT+G DE ++ +  F
Sbjct:  243 RKINTNPERILDAPGFQDDFYLNLLSWSKKNVLAIALDTALYLWNATTGDVSLLTDFENTTICSV--------TWSDDDCHISIGKEDGNTEIWDVETMSLIRTMRSGLGV---RIGSLSWLDTLIATGSRSGEIQINDVRIKQHIVSTWAEHTGEVCGLSYKSDGLQLASGGNDNTVMIWDTR----TSLPQFSKKTHTAAVKALSWCPYSPNILASGGGQTDKHIHFWNSITGARVGSINTGSQVSSLHWGQSHTSTNGGMMNKEIVATGGNPENA-ISVYNYETKFKVAEVVHAHEARICCSQLSPDGTTLATVGGDENLKFYKIF 555          
BLAST of Cell division cycle 20-like protein vs. Ensembl Nematostella
Match: EDO33700 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRF1])

HSP 1 Score: 159.073 bits (401), Expect = 3.453e-43
Identity = 130/440 (29.55%), Postives = 206/440 (46.82%), Query Frame = 3
Query:  117 PKTQYIGDRIMVHRGVMNFENFEIGLSRKSIDSNSNYQELSIPNLIEKTM----RPSRKRLLKLSIHHESPSSDEK----LQQLISQSQTV---KRKFNRHISIHPERVLDAPE-VSLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWD-NKKTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYS--SPLVLF-----NDKINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQC-PDAKKLKNNRNQKSSLL 1373
            PKT    DR +  R  MNFE     L  K      N          +K+M      S      L+  +++P+  E     L+ L SQS+T    K+K  RH+   PER+LDAP+ +   + N++DWS  N +AVAL   VYLW+A +  + ++       S  +  + W     Y     LALG++DG++ LWD + + +IR +      + S + +++  + I+S G   GK+ H+D+R   +HV   D + + +  LKWS D  YLA    D+ L+ W  N   S  S   LF        +  + W     ++          ++K +N S   CL +I T   +  +LWS+ Y+E+ I S      ++ V    ++  + EL GH   +L MA +P G+ + +   DE +RLW CF   P  KK K      SS++
Sbjct:   72 PKTPS-EDRFIASRSSMNFEANYFKLVAKGPQDEENEAVSPTKQDFQKSMADNLNGSEINARILAYKNKAPTPREGYMNDLRVLYSQSKTTSVSKKKNWRHVPQVPERILDAPDLIDDYYLNLLDWSCNNHLAVALSGFVYLWNASSGDIVQLCKMDSPDSY-VGSVSWIAEGNY-----LALGTSDGAVELWDVESQKRIRNMTG----HPSRIGALSWNSFIVSSGCRSGKIHHHDVRAAEHHVATLDKHTQEVCGLKWSPDGKYLASGGNDNLLNIWDANISASGISTNSLFCLSQHQAAVKALDWCPFQRNVLASGGGTADRQIKFWNASTGSCLNSIDTKSQVCSILWSKEYKEL-ISSHGYAQNQLIVWKYPSMTKMTELTGHSCRVLHMAMSPDGQTVVSAAADETLRLWKCFTTDPTKKKAKTASFSSSSII 499          
BLAST of Cell division cycle 20-like protein vs. Ensembl Nematostella
Match: EDO45134 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTR8])

HSP 1 Score: 123.635 bits (309), Expect = 1.260e-30
Identity = 105/391 (26.85%), Postives = 185/391 (47.31%), Query Frame = 3
Query:  198 RKSIDSNSNYQELSIPNLIEKTMRPSRKRLLKLSIHHESPSSDEKLQQLISQSQTV---KRKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVG-----------RSCGKLEHYDIRHNSNHVPDWDNKKTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCF 1316
            RK + SNSNY    + N+ +  +R S+K         E  SS   L  +  +SQ +    RK  R IS  P +VLDAPE+    + N++DWS QN+++V LG+ VYLW A   +V ++ +   +   S++ + W      + + ++++G+  G + +WD+  +   +K+ + D ++ + V ++A   ++LS G           RS  +LE   + H          ++ +  LKWS D  +LA    D+ L  W  N   S+P+  +++    +  I+WS     +           ++ +N      L  + TG  +  L WS+   E+ + +   +  +I V    +L  + +L GH   +L +A +P GE I T   DE +R WN F
Sbjct:  122 RKVLSSNSNY----VHNVFQYQVRRSKK---------EESSSAYSLSPVSKKSQRLLRSPRKSTRKISKIPFKVLDAPELQDDFYLNLVDWSAQNILSVGLGTCVYLWSACTSQVTKLCDLS-SDGDSVTSVSW-----SERNGLVSVGTYKGLVQIWDASAQ---KKLLTMDGHS-ARVGALAWNGDMLSSGSRDRLILQRDTRSPTQLERRLVGH----------RQEVCGLKWSPDHQHLASGGNDNKLLVW--NLSGSTPIQQYSEHTAAVKAISWSPHQHGLLASGGGTADRRIRFWNTLTGQPLQCVDTGSQVCNLAWSKHSNEL-VSTHGYSQNQILVWKYPSLTQVAKLTGHSFRVLYLAVSPDGEAIVTGAGDETLRFWNVF 476          
BLAST of Cell division cycle 20-like protein vs. Ensembl Nematostella
Match: EDO31404 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SY11])

HSP 1 Score: 117.087 bits (292), Expect = 3.372e-28
Identity = 90/382 (23.56%), Postives = 170/382 (44.50%), Query Frame = 3
Query:  312 SPSSDEKLQQLI------SQSQTVKRKFNRHISIHPERVLDAPEVSLVHPNVMD-WSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDN-KKTIHHLKWSLDFHYLAVVAKDSHLSFW------AENRLYSSP------LVLFNDKINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQC-PDAKKLKNNRNQKSSLLEDLERFR 1394
            +P++ E  Q  +      S+    K + +RHI   P+R+LDAPE+   +   +  W   N++++AL  AVY+W+A +  ++ +          +S + W    ++     LA+G+ DG++ +  S+  +K  +       + + V S++    +LS G   G + H+D+R  ++ +    N  + +  LKWS D   LA    D+ ++ W        +    SP      L      +  I+W     ++           ++ +N S    L ++ T   +  +LWS  Y+E+ I     +  ++ +    ++  + +L GH   +LCMA +P G+ +A+   DE +RLW CF   P  KK      +  + L    R R
Sbjct:  153 APAAKEGYQNDLHVLYCQSKPSGPKARSSRHIPQAPDRILDAPELLDDYYLNLLDWGNNNLLSLALAGAVYIWNAESSDIKHLFQM--DEGEYVSSVAWVQ--EHSMTQYLAVGTHDGNVQVRISQSGSKCVRCMGG---HAARVGSLSWNCFLLSSGSRSGAIHHHDVRVANHKIGTLLNHSQEVCGLKWSPDGKLLASGGNDNVVNIWPYPSTVGSSAGEPSPVEPLFSLTHHQAAVKAISWCPWQPNVLATGGGTADRHIRFWNGSTGATLNSVDTKSQVCSILWSNEYKEI-ISGHGFSQHQLTIWKYPSMARVADLTGHTSRVLCMAMSPDGQYVASAAADETLRLWKCFATQPKQKKTHRGGEEPVNRLLSCMRVR 526          
BLAST of Cell division cycle 20-like protein vs. Ensembl Nematostella
Match: EDO33006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STH2])

HSP 1 Score: 60.8474 bits (146), Expect = 1.511e-11
Identity = 37/119 (31.09%), Postives = 65/119 (54.62%), Query Frame = 3
Query:  444 NVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIR 800
            N++DWS  N +AVAL   VYLW+A +  + ++       S  +  + W     Y     LALG++DG++ LWD + + +IR +      + S + +++  + I+S G   GK+ H+D+R
Sbjct:    2 NLLDWSCNNHLAVALSGFVYLWNASSGDIVQLCKLDSPDSY-VGSVSWIAEGNY-----LALGTSDGAVELWDVESQKRIRNMTG----HPSRIGALSWNSFIVSSGCRSGKIHHHDVR 110          
BLAST of Cell division cycle 20-like protein vs. Ensembl Nematostella
Match: EDO32308 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVE1])

HSP 1 Score: 52.7582 bits (125), Expect = 4.883e-9
Identity = 26/81 (32.10%), Postives = 44/81 (54.32%), Query Frame = 3
Query: 1098 ISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQC-PDAKK 1337
            +  +LWS  Y+E+ I     +  ++ +    ++  + +L GH   +LCMA +P G+ +A+   DE +RLW CF   P  KK
Sbjct:    1 VCSILWSNEYKEI-ISGHGLSQHQLTIWKYTSMAHVADLTGHTSRVLCMAMSPDGQYVASAAADETLRLWKCFATQPKQKK 80          
BLAST of Cell division cycle 20-like protein vs. Ensembl Medaka
Match: cdc20 (cell division cycle 20 [Source:NCBI gene;Acc:100301582])

HSP 1 Score: 126.331 bits (316), Expect = 4.900e-31
Identity = 103/424 (24.29%), Postives = 191/424 (45.05%), Query Frame = 3
Query:  102 GSKLKPKTQYIGDRIMVHRGV--MNFENFEIGLSRKSIDSNSNYQELSIPNLIEKTMRPSRKRLLKLSIHHESP-----SSDEKLQQLISQSQT-VKRKFNRHISIHPERVLDAPEV-SLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWD-NKKTIHHLKWSLDFHYLAVVAKDSHLSFW--------AENRLYSSPLVLFNDKINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQ 1319
            G   K  ++  GDR +  R    M+  NF +    + +D+N+    L        ++        K+      P          L+ L SQ  T    K  R+IS  P+R+LDAP++ +  + N++DW   N++AVAL ++VYLWDA    +  +M         I  L W     Y     LA+G++D  + LWD + + ++R + S    + + V S++  ++ILS G   G + H+D+R   +H+     + + +  L+WS D  YLA    D+ +  W          +  + +        +  +AW     +I           ++++N++   C+ ++ T   +S L+++  Y+E+ + +    +  + +    +   + EL GH   +L +  +P G  IA++  DE IRLW  F+
Sbjct:   64 GKSKKTPSKIGGDRFIPTRNSKQMDVANFLLTKENEPLDANTAGSTLESQKAWSVSLNGYNIEDAKILHFGGKPLNAPEGYQNNLKVLYSQGSTPASTKKTRYISSTPDRILDAPDLRNDFYLNLLDWGSHNILAVALHNSVYLWDATKGDIILLMRMEREEDY-ICSLSWTKDGSY-----LAVGTSDCKVQLWDVENQKRLRSMSS----HTARVGSLSWNDHILSSGSRSGHIHHHDVRVADHHIFTLTTHTQEVCGLQWSPDGRYLASGGNDNLVCVWPRVHEGSAGNDTQFVNCWSEHQGAVKALAWCPWQSNILASGGGTSDRHIRIWNVNSGSCISSLDTQSQVSSLVFAPNYKEL-VSAHGYAHNNVVIWKYPSFSKVAELNGHEDRVLSVILSPDGSTIASVAGDETIRLWKSFE 476          
BLAST of Cell division cycle 20-like protein vs. Ensembl Medaka
Match: cdc20 (cell division cycle 20 [Source:NCBI gene;Acc:100301582])

HSP 1 Score: 126.331 bits (316), Expect = 4.900e-31
Identity = 103/424 (24.29%), Postives = 191/424 (45.05%), Query Frame = 3
Query:  102 GSKLKPKTQYIGDRIMVHRGV--MNFENFEIGLSRKSIDSNSNYQELSIPNLIEKTMRPSRKRLLKLSIHHESP-----SSDEKLQQLISQSQT-VKRKFNRHISIHPERVLDAPEV-SLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWD-NKKTIHHLKWSLDFHYLAVVAKDSHLSFW--------AENRLYSSPLVLFNDKINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQ 1319
            G   K  ++  GDR +  R    M+  NF +    + +D+N+    L        ++        K+      P          L+ L SQ  T    K  R+IS  P+R+LDAP++ +  + N++DW   N++AVAL ++VYLWDA    +  +M         I  L W     Y     LA+G++D  + LWD + + ++R + S    + + V S++  ++ILS G   G + H+D+R   +H+     + + +  L+WS D  YLA    D+ +  W          +  + +        +  +AW     +I           ++++N++   C+ ++ T   +S L+++  Y+E+ + +    +  + +    +   + EL GH   +L +  +P G  IA++  DE IRLW  F+
Sbjct:   64 GKSKKTPSKIGGDRFIPTRNSKQMDVANFLLTKENEPLDANTAGSTLESQKAWSVSLNGYNIEDAKILHFGGKPLNAPEGYQNNLKVLYSQGSTPASTKKTRYISSTPDRILDAPDLRNDFYLNLLDWGSHNILAVALHNSVYLWDATKGDIILLMRMEREEDY-ICSLSWTKDGSY-----LAVGTSDCKVQLWDVENQKRLRSMSS----HTARVGSLSWNDHILSSGSRSGHIHHHDVRVADHHIFTLTTHTQEVCGLQWSPDGRYLASGGNDNLVCVWPRVHEGSAGNDTQFVNCWSEHQGAVKALAWCPWQSNILASGGGTSDRHIRIWNVNSGSCISSLDTQSQVSSLVFAPNYKEL-VSAHGYAHNNVVIWKYPSFSKVAELNGHEDRVLSVILSPDGSTIASVAGDETIRLWKSFE 476          
BLAST of Cell division cycle 20-like protein vs. Ensembl Medaka
Match: ENSORLT00000045059.1 (cell division cycle 20B [Source:NCBI gene;Acc:105354689])

HSP 1 Score: 110.923 bits (276), Expect = 6.209e-26
Identity = 89/327 (27.22%), Postives = 161/327 (49.24%), Query Frame = 3
Query:  384 HISIHPERV--LDAPEV-SLVHPNVMDWSKQNVIAVALGSAVYLWD----AIACKVEEIMNY-GPTS-SLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIHHLKWSLDFHYLAVVAKDSHLSFWAEN----RLYSSPLVLFND--KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISE---DRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWN 1310
            H+S H + V  L AP + +  + +++D +++ +IA+ALGS+VYLW+    A+   +E  +   GP+S +LSISCL W      +   IL++G+  G I LWD+ R   +R    S + + S V +++ K ++LS G   G++ H D R  +  V   D K+ I  L+WS    ++A  + +  L  WA +    +     +V       +  + W      +       + GEL++++     CL ++ST   I CL W+   ++ ++I+      N+          L  + +L GH   +L +A N  G  I + G D+++ +W+
Sbjct:  159 HLSQHGQVVMMLGAPSLRNDYYSDLLDCNRRGIIALALGSSVYLWNSETRALVGLLEPCLAPDGPSSETLSISCLCW-----SRDGRILSIGNRRGEIQLWDADRMQTVR----SQQSHLSAVAALSWKQDVLSSGSVLGRVHHTDARAPAQLVGAADLKEEICSLQWSPGQEWMASGSTNGLLHIWANDIGGIKKSCQTVVTMKQPSAVKAMGWCPWQRGVIATGGGWKDGELRMWDAQLGTCLNSVSTNSQICCLRWAG--KKRSLITSHGLPHNSVSSWTWKFPYLTQLYQLAGHSGRVLHLAVNSDGTCIFSAGADQRLHIWD 474          
BLAST of Cell division cycle 20-like protein vs. Ensembl Medaka
Match: fzr1b (fizzy-related protein homolog [Source:NCBI gene;Acc:101174862])

HSP 1 Score: 110.153 bits (274), Expect = 1.355e-25
Identity = 90/340 (26.47%), Postives = 151/340 (44.41%), Query Frame = 3
Query:  369 RKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIHH------LKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNRNQ 1358
            RK  R IS  P +VLDAPE+    + N++DWS  N+++V LG+ VYLW A   +V  + +       S++ + W      +   ++++G+  G + +WD+    K+  +      + + V ++A     LS G     +   D+R      P    ++   H      LKWS D  +LA    D+ L  W  + L   P+  ++D    +  IAWS     +           L+ +N      L +  TG  +  L WS+   E+ + +   +  +I V    +L  + +L GH   +L +A +P GE I T   DE +R WN F      K++  R Q
Sbjct:  160 RKPARKISKIPFKVLDAPELQDDFYLNLVDWSAGNLLSVGLGACVYLWSACTSQVTRLCDLS-VDGDSVTSVCW-----NERGSLVSVGTHKGYVQIWDAAGGRKLTSLEG----HSARVGALAWNGEQLSSGSRDRVILQRDVR-----TPPSAERRLQGHRQEVCGLKWSPDHQHLASGGNDNKLLVWNSSSLL--PVQQYSDHLAAVKAIAWSPHQHGLLASGGGTADRCLRFWNTLTGQALQSTDTGSQVCNLAWSKHANEL-VSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAVSPDGEAIVTGAGDETLRFWNVFSKTRCTKVRLKRQQ 481          
BLAST of Cell division cycle 20-like protein vs. Ensembl Medaka
Match: fzr1b (fizzy-related protein homolog [Source:NCBI gene;Acc:101174862])

HSP 1 Score: 107.457 bits (267), Expect = 1.310e-24
Identity = 87/326 (26.69%), Postives = 146/326 (44.79%), Query Frame = 3
Query:  369 RKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIHH------LKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCF 1316
            RK  R IS  P +VLDAPE+    + N++DWS  N+++V LG+ VYLW A   +V  + +       S++ + W      +   ++++G+  G + +WD+    K+  +      + + V ++A     LS G     +   D+R      P    ++   H      LKWS D  +LA    D+ L  W  + L   P+  ++D    +  IAWS     +           L+ +N      L +  TG  +  L WS+   E+ + +   +  +I V    +L  + +L GH   +L +A +P GE I T   DE +R WN F
Sbjct:  165 RKPARKISKIPFKVLDAPELQDDFYLNLVDWSAGNLLSVGLGACVYLWSACTSQVTRLCDLS-VDGDSVTSVCW-----NERGSLVSVGTHKGYVQIWDAAGGRKLTSLEG----HSARVGALAWNGEQLSSGSRDRVILQRDVR-----TPPSAERRLQGHRQEVCGLKWSPDHQHLASGGNDNKLLVWNSSSLL--PVQQYSDHLAAVKAIAWSPHQHGLLASGGGTADRCLRFWNTLTGQALQSTDTGSQVCNLAWSKHANEL-VSTHGYSQNQILVWKYPSLTQVAKLTGHSYRVLYLAVSPDGEAIVTGAGDETLRFWNVF 472          
BLAST of Cell division cycle 20-like protein vs. Planmine SMEST
Match: SMESG000051492.1 (SMESG000051492.1)

HSP 1 Score: 900.582 bits (2326), Expect = 0.000e+0
Identity = 459/459 (100.00%), Postives = 459/459 (100.00%), Query Frame = 3
Query:   18 KIEKTIXXXXXXXXXXXXXXXXXXXYCLGSKLKPKTQYIGDRIMVHRGVMNFENFEIGLSRKSIDSNSNYQELSIPNLIEKTMRPSRKRLLKLSIHHESPSSDEKLQQLISQSQTVKRKFNRHISIHPERVLDAPEVSLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFNDKINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNRNQKSSLLEDLERFR 1394
            KIEKTILKTPSLKRRRSLKSIRSAKYCLGSKLKPKTQYIGDRIMVHRGVMNFENFEIGLSRKSIDSNSNYQELSIPNLIEKTMRPSRKRLLKLSIHHESPSSDEKLQQLISQSQTVKRKFNRHISIHPERVLDAPEVSLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFNDKINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNRNQKSSLLEDLERFR
Sbjct:   13 KIEKTILKTPSLKRRRSLKSIRSAKYCLGSKLKPKTQYIGDRIMVHRGVMNFENFEIGLSRKSIDSNSNYQELSIPNLIEKTMRPSRKRLLKLSIHHESPSSDEKLQQLISQSQTVKRKFNRHISIHPERVLDAPEVSLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLFNDKINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNRNQKSSLLEDLERFR 471          
BLAST of Cell division cycle 20-like protein vs. Planmine SMEST
Match: SMESG000051493.1 (SMESG000051493.1)

HSP 1 Score: 106.686 bits (265), Expect = 6.903e-25
Identity = 86/376 (22.87%), Postives = 175/376 (46.54%), Query Frame = 3
Query:  276 RKRLLKLSIHHESPSSDEKLQQLISQSQTVKRKFNRHISIHPERVLDAPEVSLVHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHGTQYKSDHILALGSTDGSIILWDSKRKTKIRKI---------YSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHVP-DWDNKKTIHHLKWSLDFHYLAVVAKDSHLSFWAENRLYSSPLVLF---NDKINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQ-------LII---ELVGHLKSILC------MATNPTGEVIATIGEDEQIRLWNCF 1316
            R R +K +++ +SPS+ EKL +  +   +   K  R+I   PE++L     S+       W++  ++A+ L   V LWD  +     I  Y   +   +S L W   T       LA+G+ DG + + +     K+            ++ +  + + + S+A  NN+L++G   G +EH+    + N +  +  +K+ I  + WS D ++LAV+     LS W    L   P V     N +INDI+W+ R+    + C+     +L++ ++  +  + +++T   +  + WS++  E+  ++   N  +   + D++++       LI    + +G +  I+C      +  N +G+ + T+G+  +I +W  F
Sbjct:   26 RSRKIKHNLNQKSPSNLEKLDEFYNSQSSKYMKPTRNIPTQPEKILKIGFESIERIRT-SWNENGLLAIGLDYLVILWDEKSNSSSIIHEYDEDTGKHVSSLVWIETTNAPK---LAIGNNDGELEIVEINEFYKVSDSSVVCEKNIKHTINIKDNTSITSLAFANNLLTIGLESGIIEHHTFGSSINLLSKNKYHKQKISKMIWSADKNHLAVITDCGLLSVWESKFLNRKPKVKLREKNQRINDISWNPRNSGQLVFCSGKSDCKLRIIDVKSKQFIKSVNTNLILRFIYWSKVENEILCVA---NQPKPNPISDESIEEEFNYSNLIFFDQKTLGKMSEIICNKKQYGLTGNGSGDKVVTVGKAGEITIWKLF 394          
BLAST of Cell division cycle 20-like protein vs. Planmine SMEST
Match: SMESG000011293.1 (SMESG000011293.1)

HSP 1 Score: 107.842 bits (268), Expect = 7.549e-25
Identity = 91/368 (24.73%), Postives = 165/368 (44.84%), Query Frame = 3
Query:  369 RKFNRHISIHPERVLDAPEVSL-VHPNVMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFH-GTQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKNNILSVGRSCGKLEHYDIRHNSNHV-PDWDNKKTIHHLKWSLDFHYLAVVAKDSHLSFW-----------------AENRLYSS-----------PLVLFND---KINDIAWSHRDVDIFLCCTACEKGELKLYNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNLQLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKNNRNQKSSL 1370
            R   R I   P +VLDAP++    + N++DWS QNV+AV LG+ VYLW+A++ ++  + +   + S +I+ + W   GT+      +A+G+  G + +WD+  + +++ +      + + V ++A    +L+ G     +   D R +S    P  ++++ +  LKWSLD  YLA    D+ L  W                       SS           P +++ +    +  IAWS     +           +K +NI  R  + ++ TG  +  + WS    E+ + +   +  +I V        + +L GH   +L +A +P G  + T   DE +R WN F+    K  K   + +S+L
Sbjct:  154 RPQTRKIPKFPYKVLDAPDLQDDFYLNLVDWSSQNVLAVGLGTCVYLWNAVSSEINRLCDVN-SDSDTITSVAWCEKGTR------VAVGTHHGKVQIWDAAAEQQLQTLEG----HTARVGTLAWNAELLASGSRDRNVHLRDTRTSSTEFKPLKEHRQEVCGLKWSLDKQYLASGGNDNRLVVWNLTSRSGMGGTLGDRATGAGTTGSSVNSNAGSYCLNPFIIYENHAAAVKAIAWSPHQNGLLASGGGTADRCIKFWNILTRQAVHSVDTGSQVCNIAWSPHSNEL-VSTHGYSQNQIVVWKYPGCTPLAKLTGHSCRVLYLALSPDGSNVVTGAGDETLRFWNVFE--KQKSTKATTSNRSAL 507          
The following BLAST results are available for this feature:
BLAST of Cell division cycle 20-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CDC201.265e-3725.81cell division cycle 20 [Source:HGNC Symbol;Acc:HGN... [more]
CDC201.265e-3725.81cell division cycle 20 [Source:HGNC Symbol;Acc:HGN... [more]
FZR12.457e-2625.36fizzy and cell division cycle 20 related 1 [Source... [more]
FZR11.207e-2525.43fizzy and cell division cycle 20 related 1 [Source... [more]
FZR11.207e-2525.43fizzy and cell division cycle 20 related 1 [Source... [more]
back to top
BLAST of Cell division cycle 20-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
fzr-17.488e-2728.27FiZzy Related family [Source:UniProtKB/TrEMBL;Acc... [more]
fzy-13.112e-1522.86WD repeat-containing protein fzy-1 [Source:UniPro... [more]
wdr-5.23.058e-623.75WD repeat-containing protein wdr-5.2 [Source:UniP... [more]
back to top
BLAST of Cell division cycle 20-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
fzy1.869e-3826.20gene:FBgn0001086 transcript:FBtr0080833[more]
fzr1.677e-2926.55gene:FBgn0262699 transcript:FBtr0070687[more]
fzr1.677e-2926.55gene:FBgn0262699 transcript:FBtr0070686[more]
fzr22.605e-2725.48gene:FBgn0034937 transcript:FBtr0072146[more]
back to top
BLAST of Cell division cycle 20-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc202.028e-3328.28cell division cycle 20 homolog [Source:ZFIN;Acc:ZD... [more]
cdc202.028e-3328.28cell division cycle 20 homolog [Source:ZFIN;Acc:ZD... [more]
fzr1a2.650e-2626.29fizzy/cell division cycle 20 related 1a [Source:ZF... [more]
fzr1a2.650e-2626.29fizzy/cell division cycle 20 related 1a [Source:ZF... [more]
fzr1b9.378e-2526.99fizzy/cell division cycle 20 related 1b [Source:ZF... [more]
back to top
BLAST of Cell division cycle 20-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc202.601e-3326.35cell division cycle 20 [Source:NCBI gene;Acc:39454... [more]
mcoln12.976e-2626.49mucolipin 1 [Source:Xenbase;Acc:XB-GENE-982338][more]
mcoln17.478e-2625.65mucolipin 1 [Source:Xenbase;Acc:XB-GENE-982338][more]
mcoln13.374e-1723.90mucolipin 1 [Source:Xenbase;Acc:XB-GENE-982338][more]
vps541.148e-1421.84VPS54 GARP complex subunit [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Cell division cycle 20-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cdc201.148e-3627.30cell division cycle 20 [Source:MGI Symbol;Acc:MGI:... [more]
Fzr16.254e-2625.43fizzy and cell division cycle 20 related 1 [Source... [more]
Cdc20b1.197e-1724.07cell division cycle 20B [Source:MGI Symbol;Acc:MGI... [more]
Cdc20b3.166e-1724.24cell division cycle 20B [Source:MGI Symbol;Acc:MGI... [more]
Cdc20b1.263e-1429.81cell division cycle 20B [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Cell division cycle 20-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q12834|CDC20_HUMAN6.073e-3725.81Cell division cycle protein 20 homolog OS=Homo sap... [more]
sp|Q5H7C0|CDC20_PIG2.682e-3625.58Cell division cycle protein 20 homolog OS=Sus scro... [more]
sp|Q62623|CDC20_RAT7.346e-3627.30Cell division cycle protein 20 homolog OS=Rattus n... [more]
sp|Q9JJ66|CDC20_MOUSE8.029e-3627.30Cell division cycle protein 20 homolog OS=Mus musc... [more]
sp|Q3E906|CD205_ARATH2.062e-3427.55Cell division cycle 20.5, cofactor of APC complex ... [more]
back to top
BLAST of Cell division cycle 20-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K7ISD33.740e-4428.89WD_REPEATS_REGION domain-containing protein OS=Nas... [more]
A0A1B6E2R71.658e-4228.31WD_REPEATS_REGION domain-containing protein OS=Cla... [more]
M4SIX72.228e-4230.32Cdc20C (Fragment) OS=Brachionus calyciflorus OX=10... [more]
A0A1B6CDG82.259e-4228.31WD_REPEATS_REGION domain-containing protein OS=Cla... [more]
A0A291S6V92.979e-4228.64Fizzy-like protein OS=Diachasma muliebre OX=130957... [more]
back to top
BLAST of Cell division cycle 20-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc204.649e-3828.77cell division cycle 20 [Source:NCBI gene;Acc:10304... [more]
ENSAMXT00000052515.11.631e-2527.61fizzy-related protein homolog [Source:NCBI gene;Ac... [more]
fzr1a3.391e-2527.62fizzy and cell division cycle 20 related 1 [Source... [more]
fzr1b6.143e-2527.08fizzy-related protein homolog [Source:NCBI gene;Ac... [more]
fzr1b1.900e-1625.33fizzy-related protein homolog [Source:NCBI gene;Ac... [more]
back to top
BLAST of Cell division cycle 20-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cdc204.802e-3627.84cell division cycle 20 homolog [Source:ZFIN;Acc:ZD... [more]
fzr1a2.175e-2125.52fizzy/cell division cycle 20 related 1a [Source:ZF... [more]
wdr48a4.131e-622.16WD repeat domain 48a [Source:ZFIN;Acc:ZDB-GENE-061... [more]
wdr48a4.391e-622.16WD repeat domain 48a [Source:ZFIN;Acc:ZDB-GENE-061... [more]
back to top
BLAST of Cell division cycle 20-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CDH11.585e-1923.60Activator of anaphase-promoting complex/cyclosome ... [more]
CDC201.918e-1923.71Activator of anaphase-promoting complex/cyclosome ... [more]
back to top
BLAST of Cell division cycle 20-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO337003.453e-4329.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451341.260e-3026.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314043.372e-2823.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330061.511e-1131.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO323084.883e-932.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cell division cycle 20-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdc204.900e-3124.29cell division cycle 20 [Source:NCBI gene;Acc:10030... [more]
cdc204.900e-3124.29cell division cycle 20 [Source:NCBI gene;Acc:10030... [more]
ENSORLT00000045059.16.209e-2627.22cell division cycle 20B [Source:NCBI gene;Acc:1053... [more]
fzr1b1.355e-2526.47fizzy-related protein homolog [Source:NCBI gene;Ac... [more]
fzr1b1.310e-2426.69fizzy-related protein homolog [Source:NCBI gene;Ac... [more]
back to top
BLAST of Cell division cycle 20-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000051492.10.000e+0100.00SMESG000051492.1[more]
SMESG000051493.16.903e-2522.87SMESG000051493.1[more]
SMESG000011293.17.549e-2524.73SMESG000011293.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021402 ID=SMED30021402|Name=Cell division cycle 20-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1460bp
AGAACAAAGATGAATGAAAAATTGAGAAAACCATTTTAAAAACACCAAGT
CTAAAGCGGCGTCGAAGTTTAAAATCAATCAGATCTGCTAAATATTGTCT
GGGATCAAAGTTAAAACCTAAAACTCAATATATTGGAGATAGAATAATGG
TGCATAGAGGTGTTATGAATTTTGAAAATTTTGAAATTGGTTTGTCTAGA
AAATCTATTGATAGTAATTCAAATTATCAAGAATTATCTATTCCAAATTT
AATTGAAAAAACAATGAGACCGTCTCGGAAACGATTGTTAAAATTAAGTA
TTCACCACGAATCACCTTCATCAGATGAGAAGTTACAGCAATTAATTTCC
CAAAGCCAAACTGTCAAACGGAAATTCAATAGACATATATCAATTCATCC
TGAAAGAGTATTAGACGCTCCAGAAGTATCTTTAGTACATCCGAACGTTA
TGGATTGGAGTAAACAAAATGTTATCGCAGTAGCTTTAGGATCCGCTGTT
TATTTGTGGGATGCGATTGCGTGTAAAGTTGAAGAAATTATGAATTACGG
TCCCACGAGTTCGTTGAGTATTAGCTGTCTTAAATGGTTTCATGGTACGC
AATATAAATCCGATCACATCCTAGCTCTGGGTAGTACTGACGGTTCTATA
ATATTATGGGATTCAAAAAGAAAAACAAAAATACGAAAGATATATTCTTC
TGATCGCTACAATCGATCTGAAGTGATATCTGTCGCTATCAAAAACAATA
TCTTATCAGTAGGTAGATCTTGTGGTAAATTGGAGCATTATGATATTAGG
CATAACTCTAATCATGTTCCCGATTGGGATAATAAAAAGACTATTCACCA
CCTAAAATGGTCTCTCGATTTTCATTACCTTGCAGTAGTAGCAAAAGATT
CTCATTTGTCGTTCTGGGCAGAAAATAGGCTTTATTCTTCACCTTTGGTT
TTGTTTAATGATAAAATCAATGATATTGCATGGAGTCACAGAGATGTGGA
TATTTTCTTGTGCTGCACTGCATGCGAGAAAGGCGAATTAAAACTCTACA
ACATTTCTCAGAGGATTTGTCTGCTAACAATAAGCACAGGATGCAATATC
TCGTGTCTTTTGTGGAGTGAAATCTATGAGGAAGTTGCGATTATTTCCGA
GGATAGGAATAATTTTCGTATTAGGGTTTTGCATGATGATAACTTGCAGC
TGATAATTGAATTAGTCGGGCATTTAAAATCAATTTTATGCATGGCCACT
AATCCCACCGGGGAGGTTATTGCCACCATCGGTGAGGATGAACAAATCAG
ACTTTGGAATTGTTTTCAGTGTCCAGATGCGAAAAAATTGAAAAATAATA
GAAATCAAAAATCTAGTTTATTAGAGGATTTAGAGAGATTTCGTTGAAAT
AGTTTTTGATTGTGCATTTACCGACTATATAAATATAGATATCTTATAAT
AATATATATG
back to top

protein sequence of SMED30021402-orf-1

>SMED30021402-orf-1 ID=SMED30021402-orf-1|Name=SMED30021402-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=417bp
MVHRGVMNFENFEIGLSRKSIDSNSNYQELSIPNLIEKTMRPSRKRLLKL
SIHHESPSSDEKLQQLISQSQTVKRKFNRHISIHPERVLDAPEVSLVHPN
VMDWSKQNVIAVALGSAVYLWDAIACKVEEIMNYGPTSSLSISCLKWFHG
TQYKSDHILALGSTDGSIILWDSKRKTKIRKIYSSDRYNRSEVISVAIKN
NILSVGRSCGKLEHYDIRHNSNHVPDWDNKKTIHHLKWSLDFHYLAVVAK
DSHLSFWAENRLYSSPLVLFNDKINDIAWSHRDVDIFLCCTACEKGELKL
YNISQRICLLTISTGCNISCLLWSEIYEEVAIISEDRNNFRIRVLHDDNL
QLIIELVGHLKSILCMATNPTGEVIATIGEDEQIRLWNCFQCPDAKKLKN
NRNQKSSLLEDLERFR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR033010Cdc20/Fizzy
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0010997anaphase-promoting complex binding
GO:0097027ubiquitin-protein transferase activator activity
Vocabulary: biological process
TermDefinition
GO:0031145anaphase-promoting complex-dependent catabolic process
GO:0051301cell division
GO:1904668positive regulation of ubiquitin protein ligase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 395..415
NoneNo IPR availablePANTHERPTHR19918:SF8FI02843P-RELATEDcoord: 23..391
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 127..172
e-value: 2.7
score: 14.3
coord: 220..258
e-value: 13.0
score: 9.9
coord: 82..122
e-value: 400.0
score: 0.5
coord: 349..388
e-value: 4.8E-6
score: 36.1
coord: 260..302
e-value: 150.0
score: 3.3
IPR001680WD40 repeatPFAMPF00400WD40coord: 351..388
e-value: 0.0012
score: 19.6
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 356..388
score: 12.179
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 73..393
e-value: 2.1E-50
score: 173.5
IPR033010The WD repeat Cdc20/Fizzy familyPANTHERPTHR19918CELL DIVISION CYCLE 20 CDC20 FIZZY -RELATEDcoord: 23..391
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 159..173
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 375..389
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 356..397
score: 10.232
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 100..388