Protein kintoun

Overview
NameProtein kintoun
Smed IDSMED30021399
Length (bp)2276
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kintoun (SMED30021399) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kintoun (SMED30021399) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kintoun (SMED30021399) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kintoun (SMED30021399) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021399

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30021399SMESG000052588.1 SmedASXL_010448SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30021399SMESG000052588.1 dd_Smed_v4_14336_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021399SMESG000052588.1 dd_Smed_v4_14336_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30021399SMESG000052588.1 dd_Smed_v6_14336_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30021399SMESG000052588.1 dd_Smed_v4_14336_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30021399SMESG000052588.1 dd_Smed_v4_14336_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kintoun vs. Ensembl Human
Match: DNAAF2 (dynein axonemal assembly factor 2 [Source:HGNC Symbol;Acc:HGNC:20188])

HSP 1 Score: 203.756 bits (517), Expect = 7.746e-55
Identity = 116/315 (36.83%), Postives = 173/315 (54.92%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTNGDVRGAT----WSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNY-VGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPI 1160
            YAEEL DPEN+R YE E+TA+E ERG++V F++P+PGHVL+T  +  ++ F+N+C +  +  PS    + GD RGA     WS+P+S  P RE   + + R +VYDVVF+ +A  +  ++  FR+ML  TALE +EK F V LD+ N K LK K KG P + V+R         + + E +   P  FPYP   +          S P  +     T+P + +   +  ++ +Y        S  P  ++I I+LPL+ SA    L++  + L L + KP  Y L L L YPV    G A+F+K  + L + LP+
Sbjct:   39 YAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDGARRCFVNVCSNALVGAPSSRPGSGGD-RGAAPGSHWSLPYSLAPGREYAGRSSSRYMVYDVVFHPDALALARRHEGFRQMLDATALEAVEKQFGVKLDRRNAKTLKAKYKGTPEAAVLRTPLPGVIPARPDGEPKGPLP-DFPYP--YQYPAAPGPRAPSPPEAALQPAPTEPRYSVVQRHHVDLQDYRCSRDSAPSPVPHELVITIELPLLRSAEQAALEVTRKLLCLDSRKP-DYRLRLSLPYPVDDGRGKAQFNKARRQLVVTLPV 348          
BLAST of Protein kintoun vs. Ensembl Human
Match: DNAAF2 (dynein axonemal assembly factor 2 [Source:HGNC Symbol;Acc:HGNC:20188])

HSP 1 Score: 203.756 bits (517), Expect = 1.382e-54
Identity = 116/315 (36.83%), Postives = 173/315 (54.92%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTNGDVRGAT----WSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNY-VGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPI 1160
            YAEEL DPEN+R YE E+TA+E ERG++V F++P+PGHVL+T  +  ++ F+N+C +  +  PS    + GD RGA     WS+P+S  P RE   + + R +VYDVVF+ +A  +  ++  FR+ML  TALE +EK F V LD+ N K LK K KG P + V+R         + + E +   P  FPYP   +          S P  +     T+P + +   +  ++ +Y        S  P  ++I I+LPL+ SA    L++  + L L + KP  Y L L L YPV    G A+F+K  + L + LP+
Sbjct:   39 YAEELTDPENRRRYEAEITALERERGVEVRFVHPEPGHVLRTSLDGARRCFVNVCSNALVGAPSSRPGSGGD-RGAAPGSHWSLPYSLAPGREYAGRSSSRYMVYDVVFHPDALALARRHEGFRQMLDATALEAVEKQFGVKLDRRNAKTLKAKYKGTPEAAVLRTPLPGVIPARPDGEPKGPLP-DFPYP--YQYPAAPGPRAPSPPEAALQPAPTEPRYSVVQRHHVDLQDYRCSRDSAPSPVPHELVITIELPLLRSAEQAALEVTRKLLCLDSRKP-DYRLRLSLPYPVDDGRGKAQFNKARRQLVVTLPV 348          
BLAST of Protein kintoun vs. Ensembl Human
Match: PIH1D1 (PIH1 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26075])

HSP 1 Score: 62.7734 bits (151), Expect = 8.408e-11
Identity = 38/113 (33.63%), Postives = 54/113 (47.79%), Query Frame = 3
Query:  324 INPKPGHVLKTIQNSEKKVFINICQSEKIEKPS----VNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLD 650
            I P+PG  +KT  +SE KVFINIC S  I  P+           +   A + IP S   P  +LD K   C  YDV  N + Y     +   R+++   A EG+E  + + L+
Sbjct:   37 IQPQPGFCIKT-NSSEGKVFINICHSPSIPPPADVTEEELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSDFYRRMQNSDFLRELVITIAREGLEDKYNLQLN 148          
BLAST of Protein kintoun vs. Ensembl Human
Match: PIH1D1 (PIH1 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26075])

HSP 1 Score: 63.929 bits (154), Expect = 2.043e-10
Identity = 67/287 (23.34%), Postives = 114/287 (39.72%), Query Frame = 3
Query:  324 INPKPGHVLKTIQNSEKKVFINICQSEKIEKPS----VNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPIEQTP 1172
            I P+PG  +KT  +SE KVFINIC S  I  P+           +   A + IP S   P  +LD K   C  YDV  N + Y     +   R+++   A EG+E  + + L+   +++    MK  P    I ++ +  SE++  ++            E+ +  T      ES P   + N + +                          P  ++ E+ LP +  A  + L+I    L +   + + Y L+  +   + S    A F +  K L + +P+   P
Sbjct:   48 IQPQPGFCIKT-NSSEGKVFINICHSPSIPPPADVTEEELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSDFYRRMQNSDFLRELVITIAREGLEDKYNLQLNP-EWRM----MKNRPFMGSISQQNIR-SEQRPRIQ------------ELGDLYTPAPGRAESGPEKPHLNLWLE-------------------------APDLLLAEVDLPKLDGALGLSLEIGENRLVMGGPQQL-YHLDAYIPLQINSHESKAAFHRKRKQLMVAMPLLPVP 289          
BLAST of Protein kintoun vs. Ensembl Human
Match: PIH1D1 (PIH1 domain containing 1 [Source:HGNC Symbol;Acc:HGNC:26075])

HSP 1 Score: 63.929 bits (154), Expect = 2.043e-10
Identity = 67/287 (23.34%), Postives = 114/287 (39.72%), Query Frame = 3
Query:  324 INPKPGHVLKTIQNSEKKVFINICQSEKIEKPS----VNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPIEQTP 1172
            I P+PG  +KT  +SE KVFINIC S  I  P+           +   A + IP S   P  +LD K   C  YDV  N + Y     +   R+++   A EG+E  + + L+   +++    MK  P    I ++ +  SE++  ++            E+ +  T      ES P   + N + +                          P  ++ E+ LP +  A  + L+I    L +   + + Y L+  +   + S    A F +  K L + +P+   P
Sbjct:   48 IQPQPGFCIKT-NSSEGKVFINICHSPSIPPPADVTEEELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSDFYRRMQNSDFLRELVITIAREGLEDKYNLQLNP-EWRM----MKNRPFMGSISQQNIR-SEQRPRIQ------------ELGDLYTPAPGRAESGPEKPHLNLWLE-------------------------APDLLLAEVDLPKLDGALGLSLEIGENRLVMGGPQQL-YHLDAYIPLQINSHESKAAFHRKRKQLMVAMPLLPVP 289          
BLAST of Protein kintoun vs. Ensembl Fly
Match: Nop17l (gene:FBgn0033224 transcript:FBtr0088902)

HSP 1 Score: 216.853 bits (551), Expect = 1.952e-59
Identity = 128/316 (40.51%), Postives = 188/316 (59.49%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTN--GDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVD-FSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVG--DQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKL-TTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPI 1160
            Y +E+QDPEN++IYE E+T +E ERG++V FI+PKPG V+KT  + E K FINI   E+I++P    +T+     RG +WSIP + T  R+D D KN+ C V+DVVF+ +A  +  +N +FR+ L DTAL+ IE+ +KVSLD+ N K  KL  KG+P  TVIRK   +  +E+Q         P K P P  +E         ++KPS     EFT P + IK+S+D ++  Y    D   H T P  +++EI+LPL+ S     LD+ S+++ L +  +  KY L+L L + V    G A+FD   + L + LP+
Sbjct:   45 YVDEIQDPENRKIYESEITQLEKERGVEVRFIHPKPGFVIKTALDGELKCFINIASCEEIQRPKNEVATDPSSGSRGLSWSIPMAQTTSRDDFDAKNNHCKVFDVVFHPDALHLAMRNKQFRQCLIDTALDAIEREYKVSLDRANLKFPKLDYKGIPRPTVIRKMADNPTAEEQEPHPLAHMFPTKPPAPGKQEPRVL---PMKTKPSPV--PEFTVPRYTIKHSHDVDLSEYTDELDAKLHVTVPRSLVVEIELPLLRSTAECQLDVTSKSIYLFSERQGAKYRLKLDLPFIVDDKAGRARFDTDMRRLSITLPV 355          
BLAST of Protein kintoun vs. Ensembl Fly
Match: Nop17l (gene:FBgn0033224 transcript:FBtr0088900)

HSP 1 Score: 216.853 bits (551), Expect = 1.952e-59
Identity = 128/316 (40.51%), Postives = 188/316 (59.49%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTN--GDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVD-FSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVG--DQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKL-TTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPI 1160
            Y +E+QDPEN++IYE E+T +E ERG++V FI+PKPG V+KT  + E K FINI   E+I++P    +T+     RG +WSIP + T  R+D D KN+ C V+DVVF+ +A  +  +N +FR+ L DTAL+ IE+ +KVSLD+ N K  KL  KG+P  TVIRK   +  +E+Q         P K P P  +E         ++KPS     EFT P + IK+S+D ++  Y    D   H T P  +++EI+LPL+ S     LD+ S+++ L +  +  KY L+L L + V    G A+FD   + L + LP+
Sbjct:   45 YVDEIQDPENRKIYESEITQLEKERGVEVRFIHPKPGFVIKTALDGELKCFINIASCEEIQRPKNEVATDPSSGSRGLSWSIPMAQTTSRDDFDAKNNHCKVFDVVFHPDALHLAMRNKQFRQCLIDTALDAIEREYKVSLDRANLKFPKLDYKGIPRPTVIRKMADNPTAEEQEPHPLAHMFPTKPPAPGKQEPRVL---PMKTKPSPV--PEFTVPRYTIKHSHDVDLSEYTDELDAKLHVTVPRSLVVEIELPLLRSTAECQLDVTSKSIYLFSERQGAKYRLKLDLPFIVDDKAGRARFDTDMRRLSITLPV 355          
BLAST of Protein kintoun vs. Ensembl Fly
Match: Nop17l (gene:FBgn0033224 transcript:FBtr0088901)

HSP 1 Score: 216.853 bits (551), Expect = 1.952e-59
Identity = 128/316 (40.51%), Postives = 188/316 (59.49%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTN--GDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVD-FSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVG--DQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKL-TTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPI 1160
            Y +E+QDPEN++IYE E+T +E ERG++V FI+PKPG V+KT  + E K FINI   E+I++P    +T+     RG +WSIP + T  R+D D KN+ C V+DVVF+ +A  +  +N +FR+ L DTAL+ IE+ +KVSLD+ N K  KL  KG+P  TVIRK   +  +E+Q         P K P P  +E         ++KPS     EFT P + IK+S+D ++  Y    D   H T P  +++EI+LPL+ S     LD+ S+++ L +  +  KY L+L L + V    G A+FD   + L + LP+
Sbjct:   45 YVDEIQDPENRKIYESEITQLEKERGVEVRFIHPKPGFVIKTALDGELKCFINIASCEEIQRPKNEVATDPSSGSRGLSWSIPMAQTTSRDDFDAKNNHCKVFDVVFHPDALHLAMRNKQFRQCLIDTALDAIEREYKVSLDRANLKFPKLDYKGIPRPTVIRKMADNPTAEEQEPHPLAHMFPTKPPAPGKQEPRVL---PMKTKPSPV--PEFTVPRYTIKHSHDVDLSEYTDELDAKLHVTVPRSLVVEIELPLLRSTAECQLDVTSKSIYLFSERQGAKYRLKLDLPFIVDDKAGRARFDTDMRRLSITLPV 355          
BLAST of Protein kintoun vs. Ensembl Zebrafish
Match: dnaaf2 (dynein, axonemal, assembly factor 2 [Source:NCBI gene;Acc:606664])

HSP 1 Score: 139.043 bits (349), Expect = 4.411e-34
Identity = 106/361 (29.36%), Postives = 173/361 (47.92%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTNGDVR-GATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPE----------------------------------------------IKETETTHYNITESKPSD---SNGNEFTKPVHKIKYSNDFEMLNYVGDQVQHST-KPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPI 1160
            Y EE+  PEN+R YEEE+  +E ERG  V+FI+P P HVLK  +    K FINIC  + IEKP    +T+   R G +W IP+S TP R   D     C+++D VF+ +A  M   N+RF  ++H TA  GI+  F++ L+ +  ++  +K KG P  T+IR+     +E       +  DP +   P+                                               +++   H      +P+D   +     T P +++KY +  ++ +Y   +   S  +PT +IIE+++P + SA   +L ++ R  +L      +Y LEL L+YPV  +   A+F+ T ++L + LP+
Sbjct:   35 YVEEISSPENRRRYEEEIRRLEEERGAAVQFIHPTPHHVLKG-RGPSGKCFINICSDQLIEKPRSEAATDDRGRSGHSWRIPYSLTPGRAGRDAAGAPCVLFDAVFHPDALLMAENNARFMTLIHRTATGGIQDNFRIRLEHVT-RLKMMKYKGEPQPTMIRRPNPGQTEAADRGPQQPTDPQQTTGPQQPTDTQQPTDTQQPTDPQQTTGTQQTTDPQQTTGPQQPTDPQQTTDPQQSTDPHQPTGPHQPTDPQQTTDPPPTAPQYRLKYRSVLDLQDYRCCRDSGSAGRPTAIIIEVEVPRLRSAQEAELRVEER--RLLEAPTAEYRLELPLAYPVEEERAEAQFNHTHRLLTVTLPV 391          
BLAST of Protein kintoun vs. Ensembl Zebrafish
Match: pih1d1 (PIH1 domain containing 1 [Source:NCBI gene;Acc:553260])

HSP 1 Score: 79.337 bits (194), Expect = 1.023e-15
Identity = 79/288 (27.43%), Postives = 130/288 (45.14%), Query Frame = 3
Query:  324 INPKPGHVLKTIQNSEKK-VFINICQSEKIEKPSVNKSTNGDVR------GATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDM--GSAKFDKTTKVLRLELPI 1160
            I P+PG  +KT   S+KK VF+NICQS+ +  P  + S    V         ++ +P S   P  ++D  +  C VYDVV N   ++   K++ F++ L   +LEG+E  + + L + + KILK            RK     +E+    +++         P I+E ++     + + PS +   EFT  V                     S K   +I EI LP +SSA ++ LD+    L L   +P   L  L + +PVL D     A+++  T+ L + +P+
Sbjct:   43 IRPQPGLCVKTSSVSDKKKVFLNICQSQTVPPPP-HLSQEALVELLESEDPTSYRVPMSLGEPHTEVDNSSQGCTVYDVVINDEFFQKCEKDTLFQQFLIAVSLEGLENKYSLELSR-DIKILK-----------NRKFMGSIAEQNIRTKSK---------PIIQEIDSKE---SLTLPSAAKCPEFTLLVEP------------------PSGKAEHLIAEILLPGVSSARSVVLDLGEDRLVLIA-RP--SLFHLDIFFPVLIDQENSVAQYNTNTQTLTVTMPV 284          
BLAST of Protein kintoun vs. Ensembl Xenopus
Match: arsl (arylsulfatase L [Source:Xenbase;Acc:XB-GENE-6049177])

HSP 1 Score: 213.772 bits (543), Expect = 2.357e-58
Identity = 118/329 (35.87%), Postives = 191/329 (58.05%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTNGDVR-GATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYP---------------EIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVGDQ-VQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPIEQ 1166
            YAEE+ DPEN++ YE+E+  MENERGMD++FI+PKPG+VL +  N  +K ++NIC ++ I+KP      +G+ + G  WS+P+S +P R+DL K   + ++YDVVF+ +   + SKN +F+ ++  TALE +   F V+LDK N + L +K KG+P  +V+RK   + S K  +LE    DPL FPYP                + + E   + +T  +  D N      P + +++ +  ++ ++   +    S  P  ++I + LPL++SA  ++L I  +NL L + KP  Y L +KL Y V  + G A+F+K  K L + +P+ Q
Sbjct:   34 YAEEISDPENRKKYEQEIYKMENERGMDIKFIHPKPGYVLLSSVNGVQKCYLNICSNDLIQKPEFKPGKDGEGKAGLHWSLPYSLSPGRDDLSKDGSKHVIYDVVFHPDTLHIASKNGKFKGIVDSTALEAVASQFNVTLDKANVRTLSMKYKGVPNPSVLRKPLPEASPKSRDLE----DPLCFPYPYDVPTAVGTEKKDQKRVIQKECKQHLVTPEQ--DPNVQVAATPNYTVRHRSYVDLQDFRDSRDSTPSPVPKELVITVDLPLLNSAAGVNLHIAGKNLSLESEKPA-YKLNVKLPYAVEDNQGKAQFNKVKKQLIITVPVIQ 355          
BLAST of Protein kintoun vs. Ensembl Xenopus
Match: pih1d1 (PIH1 domain containing 1 [Source:NCBI gene;Acc:100135181])

HSP 1 Score: 88.9669 bits (219), Expect = 1.133e-18
Identity = 72/287 (25.09%), Postives = 134/287 (46.69%), Query Frame = 3
Query:  324 INPKPGHVLKTIQNSEKKVFINICQSEKIEKPS-------VNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPIE 1163
            I P+PG  +KT  +   K+FINIC++  I  P        VN   + D  G  + +P S   P  ++D   + C VY++V N   ++    N  FR+     A+EG+E  +++ L + ++++LK            RK     S++    +++         P I+E +T+     +SKP           + +IK S +      V +  +    P+ ++ EI LP ++S  ++ LD+    + L   +P  Y L++ L Y +  +   A+F++ TKVL + +P++
Sbjct:   45 IRPQPGFCIKTRTSENAKIFINICKTNDIPAPPDLSEVELVNILESDDPSG--YRVPMSIGEPHVEVDNSGNGCTVYEIVINSTFFDKMKSNELFREFFITVAMEGLENKYEMELSR-DWRMLK-----------NRKFMGSISDQNIRTKSK---------PIIQEMDTSASQKPQSKPL----------ISEIKSSPEVPKYTIVAEPAEG--HPSFLVAEISLPKVTSVRSLVLDLGEDRIVLWG-RPDLYHLDIFLPYNIAQEESGAQFNRDTKVLTITMPVQ 295          
BLAST of Protein kintoun vs. Ensembl Mouse
Match: Dnaaf2 (dynein, axonemal assembly factor 2 [Source:MGI Symbol;Acc:MGI:1923566])

HSP 1 Score: 189.889 bits (481), Expect = 4.389e-50
Identity = 111/319 (34.80%), Postives = 166/319 (52.04%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSV--NKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETET------THYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNY-VGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPI 1160
            YA E+ DPEN+R YEEE+TA+E ERG+DV F++P+PGHVL+T  + E + ++N+C +  +  PS        G   G+ WS+P+S  P R+   +   R  VYDVVF+  A  +   + RFR+ML  TALE +E+ F V LD+ N K LK+K KG+P + V+R         Q E E     P  FP P             T  +     P      E T+P   +   +  ++ +Y        ST P  +++ I+LPL+ S    +L++  + L L +  P  Y L L L YPV    G A+++K  + L + LP+
Sbjct:   39 YAAEITDPENRRRYEEEITALERERGVDVRFVHPEPGHVLRTSLDGEHRCYVNVCSNSLVGVPSSRPGPGRGGTAAGSHWSLPYSLAPGRQYAGRNGARYTVYDVVFHPEALALARSHERFREMLDATALEAVEQQFGVRLDRRNAKTLKIKYKGMPEAAVLRTPLPGGVPAQPEGEP----PGLFPDPPYPYRYPAAAAANTARSPASPAPEAVQRPEPTEPRCSVVQRHHVDLQDYRCSRDAAPSTVPHELVVTIELPLLRSVERAELEVKGKLLCLDSRNP-DYRLRLSLPYPVDDGRGKAQYNKARRQLVVTLPV 352          
BLAST of Protein kintoun vs. Ensembl Mouse
Match: Pih1d1 (PIH1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1916095])

HSP 1 Score: 65.4698 bits (158), Expect = 5.314e-11
Identity = 47/130 (36.15%), Postives = 67/130 (51.54%), Query Frame = 3
Query:  312 DVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPS------VNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRF-RKMLHDTALEGIEKMFKVSLDKINFKILKLK 680
            D   I PKPG  +KT  +SE KVFINIC S  I  P+      + +    D  G  + IP S   P  +LD K   C  YDV  N N Y +  +NS F R+++   A EG+E  + + L+   +++LK +
Sbjct:   44 DSTQIQPKPGFCVKT-NSSEGKVFINICHSPSIPPPADVTEDELLQMLEEDQAG--FRIPMSLGEPHAELDAKGQGCTAYDVAVNSNFY-LRMQNSDFLRELVVTIAREGLEDKYGLQLNP-EWRMLKYR 168          
BLAST of Protein kintoun vs. Ensembl Mouse
Match: Pih1d1 (PIH1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1916095])

HSP 1 Score: 65.4698 bits (158), Expect = 5.314e-11
Identity = 47/130 (36.15%), Postives = 67/130 (51.54%), Query Frame = 3
Query:  312 DVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPS------VNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRF-RKMLHDTALEGIEKMFKVSLDKINFKILKLK 680
            D   I PKPG  +KT  +SE KVFINIC S  I  P+      + +    D  G  + IP S   P  +LD K   C  YDV  N N Y +  +NS F R+++   A EG+E  + + L+   +++LK +
Sbjct:   44 DSTQIQPKPGFCVKT-NSSEGKVFINICHSPSIPPPADVTEDELLQMLEEDQAG--FRIPMSLGEPHAELDAKGQGCTAYDVAVNSNFY-LRMQNSDFLRELVVTIAREGLEDKYGLQLNP-EWRMLKYR 168          
BLAST of Protein kintoun vs. Ensembl Mouse
Match: Pih1d1 (PIH1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1916095])

HSP 1 Score: 65.4698 bits (158), Expect = 5.314e-11
Identity = 47/130 (36.15%), Postives = 67/130 (51.54%), Query Frame = 3
Query:  312 DVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPS------VNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRF-RKMLHDTALEGIEKMFKVSLDKINFKILKLK 680
            D   I PKPG  +KT  +SE KVFINIC S  I  P+      + +    D  G  + IP S   P  +LD K   C  YDV  N N Y +  +NS F R+++   A EG+E  + + L+   +++LK +
Sbjct:   44 DSTQIQPKPGFCVKT-NSSEGKVFINICHSPSIPPPADVTEDELLQMLEEDQAG--FRIPMSLGEPHAELDAKGQGCTAYDVAVNSNFY-LRMQNSDFLRELVVTIAREGLEDKYGLQLNP-EWRMLKYR 168          
BLAST of Protein kintoun vs. Ensembl Mouse
Match: Pih1d1 (PIH1 domain containing 1 [Source:MGI Symbol;Acc:MGI:1916095])

HSP 1 Score: 56.9954 bits (136), Expect = 2.987e-9
Identity = 35/85 (41.18%), Postives = 42/85 (49.41%), Query Frame = 3
Query:  324 INPKPGHVLKTIQNSEKKVFINICQSEKIEKPS------VNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAY 560
            I PKPG  +KT  +SE KVFINIC S  I  P+      + +    D  G  + IP S   P  +LD K   C  YDV  N N Y
Sbjct:   48 IQPKPGFCVKT-NSSEGKVFINICHSPSIPPPADVTEDELLQMLEEDQAG--FRIPMSLGEPHAELDAKGQGCTAYDVAVNSNFY 129          
BLAST of Protein kintoun vs. UniProt/SwissProt
Match: sp|B4J4Y2|KTU_DROGR (Protein kintoun OS=Drosophila grimshawi OX=7222 GN=Nop17l PE=3 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 3.011e-64
Identity = 139/358 (38.83%), Postives = 206/358 (57.54%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTNGDV--RGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVG--DQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKP-VKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELP-IEQTPDQLMELTENV------PSNVSNNLIEECPSTGNEIGEQ 1268
            Y +E+QDPEN++IYE+E+T +E ERG+DV FI+PKPG V+KT  + E K FINIC S+ +E+P+   + N +   RG TWSIP +  P R+D+D     C V+DVVF+ +A  +G++NS+FRK L DTAL+G+E+ F V+LD+ N K  KL  KG P +TVIRK       K    E R+  PL+  YP+  E       +   K + ++   F  P + IK+S+D +M  Y    D     T P  +I+EI+LPL+SS     LD+  +++ L + +   KY L+L L Y V    G+A+FD   + L + LP +  +  +  ++ +NV       S V  N   E P+   E G +
Sbjct:   45 YVDEIQDPENRKIYEQEITQLEKERGVDVTFIHPKPGFVVKTAIDGELKCFINICGSQIVERPNNEVAINSETGERGLTWSIPMAQAPARDDIDANKKLCKVFDVVFHPDALHLGTRNSQFRKCLIDTALDGVEREFNVNLDRANLKYPKLDYKGEPHATVIRK-----LSKNATAEEREPHPLEHTYPKKPEANAGKPKVLPMKKNVTSTPTFAVPKYSIKHSHDIDMAQYTDELDAKLQVTIPRALIVEIELPLLSSTADCQLDVTEKSVYLLSERSGAKYRLKLDLPYTVDDKSGNARFDTEHRRLCITLPVVRSSAREQRQMHDNVRILSREDSGVELNSNSESPAEDEEAGSE 397          
BLAST of Protein kintoun vs. UniProt/SwissProt
Match: sp|B4LMK1|KTU_DROVI (Protein kintoun OS=Drosophila virilis OX=7244 GN=Nop17l PE=3 SV=1)

HSP 1 Score: 223.016 bits (567), Expect = 2.310e-60
Identity = 123/315 (39.05%), Postives = 188/315 (59.68%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTNGDV--RGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVG--DQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLK-LTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPI 1160
            Y +E+QDPEN+++YE+E+T +E ERG+DV FI+P+PG V+KT  + E K FINI  S  +E+P+   S N     +G +WSIP + TPPR+DLD  N +C V+DVVF+ +A  +G +N++FR+ L DTAL+G+E+ +KV+LD+ N K  KL  KGL   TV+RK   D + ++ E       PL+  YP+          +   K   +    F  P + IK+S+D ++  Y    D     T P  +++EI+LPL+SS     LD+  +++  L+  +  KY L+L L Y V    G+A+FD   + L + LP+
Sbjct:   44 YVDEIQDPENRKLYEKEITQLEKERGVDVTFIHPQPGFVVKTSIDGELKCFINIASSTVVERPNNEVSVNSQTGQKGLSWSIPMAQTPPRDDLDANNKQCKVFDVVFHPDALHLGKRNAQFRQCLIDTALDGVEREYKVNLDRANLKFPKLDYKGLARPTVLRKLSKDATAEELEPH-----PLEHMYPKKPAANADQPKVLPMKTKVTPAPTFAVPKYSIKHSHDVDLAEYTDELDAKLQVTMPRALVVEIELPLLSSTADCQLDVTEKSVYLLSERQGAKYRLKLDLPYTVNDKAGNARFDTEHRRLCITLPV 353          
BLAST of Protein kintoun vs. UniProt/SwissProt
Match: sp|Q0IEW8|KTU_AEDAE (Protein kintoun OS=Aedes aegypti OX=7159 GN=AAEL007767 PE=3 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 3.865e-60
Identity = 132/338 (39.05%), Postives = 196/338 (57.99%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTN--GDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPL-KFPYPEIKETETTH------YNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVG--DQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPIEQTPDQLMELTENVPSN 1211
            Y +EL+DPEN++ YEEEL  ME ERG DV+FI P PG+V+KT+ + + K F+N+C  + + KPS   STN  G+ +G  WSIP++ + PR+D D KN  C+VYDVVF+ +   +   N  FRK++ DTAL+ +E  F VSLD++N K  KL+ KG+   TVIR+K  +F       ETR  D L    Y   ++++ TH       N+ +     ++  E+T P +K+ +  + E     G  D    +  P  +++ I+LPL+ SAN   L++ S  + L +  P KY LE+KL Y VL   GSAKF+     L + LP+ +    L ++T  V SN
Sbjct:   34 YCQELKDPENRKQYEEELKLMEAERGYDVKFIKPLPGYVIKTVVDGKTKAFVNVCHCDLVGKPSSQCSTNKRGE-KGLKWSIPYAQSQPRKDYDNKNVDCVVYDVVFHYDTLHLTKSNKNFRKLVTDTALDAVEGAFHVSLDRVNLKFPKLQYKGVAKMTVIRQKLKNF-------ETRRKDGLIDTLYRASEQSKITHDNSADKENVNKQTFKSASQLEYTTPAYKLIHRKEVEYHELTGELDAKLDAAIPKELVLVIELPLLKSANQCTLNVTSSEVHLISDSPAKYKLEVKLPYTVLEKNGSAKFNTDETTLTVLLPVARNRRTLNDVT--VSSN 361          
BLAST of Protein kintoun vs. UniProt/SwissProt
Match: sp|B3MG50|KTU_DROAN (Protein kintoun OS=Drosophila ananassae OX=7217 GN=Nop17l PE=3 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 4.250e-60
Identity = 127/315 (40.32%), Postives = 187/315 (59.37%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTNGDV--RGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVG--DQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKP-VKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPI 1160
            Y +E+QDP N++IYEEE+T +E ERG++V FI+P+PG V+KT  + E K FINI  S +IE P    +TN +   RG +W IP + T  R+D D KN+ C V+DVVF+ +A  +  +NS+FRK L DTAL+ +E+ ++VSLD+ N K  KL  KG+   TVIRK   + + +Q E       PL+  YP    T      +   K   +   EFT P + IK+S+D ++  Y    D   H T P  +++EI+LPL+ S     LD+ S+++ L + KP  KY L++ L + V    GSA+FD   + L + LP+
Sbjct:   44 YVDEIQDPANRKIYEEEITQLEKERGVEVRFIHPQPGFVVKTSLDGELKCFINIASSPEIEAPHNEVATNPENGNRGLSWYIPMAQTSSRDDADAKNNHCKVFDVVFHPDALHLAKRNSQFRKCLVDTALDAVEREYQVSLDRANLKFPKLDYKGIARPTVIRKLAENPTAEQLEPH-----PLQNIYPTAPPTSNPEPRVHPMKTKAAPVPEFTIPRYSIKHSHDVDLSEYTDELDAKLHVTVPRNLVVEIELPLLRSTAECQLDVTSKSVYLLSEKPGAKYRLKMDLPFTVDDKAGSARFDTDLRRLSITLPV 353          
BLAST of Protein kintoun vs. UniProt/SwissProt
Match: sp|B4P238|KTU_DROYA (Protein kintoun OS=Drosophila yakuba OX=7245 GN=Nop17l PE=3 SV=1)

HSP 1 Score: 220.705 bits (561), Expect = 8.331e-60
Identity = 130/316 (41.14%), Postives = 189/316 (59.81%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTN--GDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVD-FSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVG--DQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKL-TTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPI 1160
            Y EE+QDPEN++IYEEE+T +E ERG++V FI+PKPG V+KT  + E K FINI  SE+IE+P    +T+     RG +WSIP + T  R+D D KN+ C V+DVVF+ +A  +  +N +FR+ L DTAL+ +E+ +KVSLD+ N K  KL  KG+P  TVIRK   +  +E+Q         P K P P   E         ++KP+     EFT P + IK+S+D ++  Y    D   H T P  +++EI+LPL+ S     LD+ S+++ L +  +  KY L+L L + V    G A+FD   + L + LP+
Sbjct:   47 YVEEIQDPENRKIYEEEITQLEKERGVEVRFIHPKPGFVIKTALDGELKCFINIAGSEEIERPKNEVATDPSSGSRGLSWSIPMAQTSSRDDCDAKNNHCKVFDVVFHPDALHLAKRNKQFRQCLIDTALDAVEREYKVSLDRANLKFPKLDYKGIPRPTVIRKLADNPTAEEQEPHPLAHMFPTKPPAPGKPEPRVL---PMKTKPTPV--PEFTVPRYSIKHSHDVDLSEYTDELDAKLHVTVPRSLVVEIELPLLRSTAECQLDVTSKSVYLFSERQGAKYRLKLDLPFSVDDKAGQARFDTDMRRLSITLPV 357          
BLAST of Protein kintoun vs. TrEMBL
Match: T1FY12 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20213710 PE=4 SV=1)

HSP 1 Score: 269.626 bits (688), Expect = 9.127e-80
Identity = 143/324 (44.14%), Postives = 201/324 (62.04%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPL-KFPYPEIKETET----------THYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVGDQVQ---HSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPI 1160
            YAEE+ +PENK IYEEE+  ME ERGMD++F+NP+PGHVLKT+ N   K FINIC++  +  PS  K       G +WSIPH F PPR+DL K    C ++D V + + Y M   N RFR+M+HD A++GIEKMF V+LD+ N K LK+K  G   +TVIR K  D   K+ + E    DPL  FPYP   ET +           + N T SK    N   FT P +++K+ +D ++ NY  +  +    ST+P ++I+ +KLPL+SSA +++LD+  +++KL + KP KY LE+ L YPV  ++ SAKFDK    L + +P+
Sbjct:   37 YAEEIANPENKAIYEEEIRQMEQERGMDIKFVNPEPGHVLKTVLNGSTKAFINICKNVHVGIPSHEKKDVYGKCGVSWSIPHIFAPPRDDLTKTKQNCKIFDFVIHPDTYRMSETNQRFRQMVHDLAVDGIEKMFNVTLDRKNLKQLKMKFMGHKTATVIRNKIADAKVKKQDDENDGEDPLSSFPYPYSNETSSERTQRIAKNENNENATTSKDGVVNDG-FTIPKYEMKHQSDVDLKNYANEMSRVCTLSTRPDKLIMSVKLPLLSSAASLELDVFEKSMKLISTKPAKYKLEISLPYPVDENLSSAKFDKLKHELMITMPV 359          
BLAST of Protein kintoun vs. TrEMBL
Match: V3ZG29 (Protein kintoun OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_123979 PE=3 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 1.095e-78
Identity = 151/345 (43.77%), Postives = 210/345 (60.87%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPL-KFPYP---EIKETETTHYNITE------SKPSDSNGNEFTKPVHKIKYSNDFEMLNYVGDQV-QHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPIEQTPDQLME--LTENVPSNVSNNL 1226
            YAEEL DPEN+R+YEEEL+ +ENERGMD+ F+NP PG+VLKT  N E+K FINICQS+KI+KPS  +       G  W +PHSF PPREDLDK   +C VYDVVF+ + Y M   N RF+K++ DTAL+GIEK F   LD+ N K   +K KG P +TVIR K       Q      +N+ L K P P   ++   + +   I E      S+ S++  +  T P + I + ++ ++  Y  +Q  + ST+P  +++ I+LPL+ SA + DLDI  + L L + +P  Y L++ L YPV  + GSAKFDKT   L + LP+   PD+L E   T N+ S  ++ L
Sbjct:   34 YAEELSDPENRRLYEEELSRLENERGMDITFVNPTPGYVLKTSLNGEQKAFINICQSDKIDKPSGKREKESGKNGLMWYLPHSFAPPREDLDKNGQKCQVYDVVFHPDTYRMAESNQRFKKLVEDTALDGIEKQFAAKLDRKNLKRPNMKFKGTPTATVIRTK------SQNGTPNTENEFLKKLPNPYEDKVAPKKVSENKIVEEKNKRNSESSETKVSGPTVPKYSIIHRSELDLQEYTNNQANKKSTRPKELVVTIQLPLLKSAASADLDIFEKRLVLESKQPAAYKLDIMLPYPVNDEEGSAKFDKTKHSLIVTLPVIPVPDKLDEELTTSNIESEGTDML 372          
BLAST of Protein kintoun vs. TrEMBL
Match: A0A1S3HBE3 (Protein kintoun OS=Lingula unguis OX=7574 GN=LOC106153809 PE=3 SV=1)

HSP 1 Score: 277.33 bits (708), Expect = 7.204e-77
Identity = 183/528 (34.66%), Postives = 277/528 (52.46%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNK--STNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETR-------DNDPL-KFPYP--------------------EIKETET-THYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYV-GDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPIEQTPDQLMELTENVPSNVSNNLIEECPSTGNEIGEQLPGDARVLSDGIVEDDNSESPNANTDGKENADSD----KFTHTNPEFLTKEMTXXXXXXXXXXXXXXXXXNNSTHAFIVCHIRNIDKSNWNYQWDPISPMKHQVIIAFSNCGQGGWKNFYKLPIVIDFKDEITNVRSEIQCQISEESMVL 1706
            YAEE+ DPEN++ YEEE+  +E+ERGMD+ F+NP PG+V+KT  N E+K FINIC++E I+KP + K    NG  R   W IPHSF+PPR+DLDK   +C VYDVVFN +AY M   N+RF+KM+ DTA +GIE+ F V LD+ N K  K+K KG+PV+TVIRK++ +   +Q +  T+       D+DPL K PYP                      K+ ET     +T +   D +  E   PV+ I + +D ++ +Y      + ST+P  + + + LPL+ SA  IDL+I  + L L +  P KY L+L L YPV  + GSAKFDK+ + L + LP+      L   T  +PS + +   EE P   N        D + L + I   +N E+P+A      ++ +     +  ++ PEF                        + T+  I+ ++R +DK++ N  +      +    +  ++ G GG+ N Y   I + F D+    +      I E ++V+
Sbjct:   48 YAEEISDPENRKRYEEEIAQLESERGMDITFVNPDPGYVIKTTVNGEQKAFINICKNEHIDKPQMTKELGPNGKTR-VGWQIPHSFSPPRDDLDKGGQKCKVYDVVFNPDAYRMAESNARFKKMIQDTAFDGIERQFDVKLDRKNLKFPKMKFKGVPVATVIRKRKDEGPNEQDKPATKVEGDAADDDDPLSKLPYPYDNKTTEEKRIAREEELAKQNAKKAETEAKTKVTATSTKDPDAAEI--PVYHIIHRSDMDLGDYRNAPDAKTSTRPKELAVVVTLPLLKSAANIDLEIFDKRLLLESETPAKYKLDLNLPYPVDENKGSAKFDKSKRQLIITLPV------LPAETPKLPSFIDDK--EENPPLQNGTLSNSAVDGKPLVEVISSLEN-ENPSATATAPVSSTNHSVKLQIPYSLPEF--------------------DIFQDETNVSIILNVRRVDKASCNATF-----TQAGCSLQMTSLGSGGFPNHYS--ICLSFPDKHCLAKDMCTVDIGESNVVV 536          
BLAST of Protein kintoun vs. TrEMBL
Match: A0A1S3HCV8 (Protein kintoun OS=Lingula unguis OX=7574 GN=LOC106153809 PE=3 SV=1)

HSP 1 Score: 271.166 bits (692), Expect = 1.216e-74
Identity = 182/528 (34.47%), Postives = 277/528 (52.46%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNK--STNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETR-------DNDPL-KFPYP--------------------EIKETET-THYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYV-GDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPIEQTPDQLMELTENVPSNVSNNLIEECPSTGNEIGEQLPGDARVLSDGIVEDDNSESPNANTDGKENADSD----KFTHTNPEFLTKEMTXXXXXXXXXXXXXXXXXNNSTHAFIVCHIRNIDKSNWNYQWDPISPMKHQVIIAFSNCGQGGWKNFYKLPIVIDFKDEITNVRSEIQCQISEESMVL 1706
            YAEE+ DPEN++ YEEE+  +E+ERGMD+ F+NP PG+V+KT  N E+K FINIC++E I+KP + K    NG  R   W IPHSF+PPR+DLDK   +C VYDVVFN +AY M   N+RF+KM+ DTA +GIE+ F V LD+ N K  K+K KG+PV+TVIRK++ +   +Q +  T        D+DPL K PYP                      K+ ET     +T +   D +  E   PV+ I + +D ++ +Y      + ST+P  + + + LPL+ SA  IDL+I  + L L +  P KY L+LKL YPV    GSAKFDK+ + L + LP+      L   T  +PS + +   EE P   N        D + L + I   +N E+P+A      ++ +     +  ++ PE+                        + T+  ++ ++R +DK++ N  +      +   ++  ++ G GG+ N Y   I + F D+    +      I E ++V+
Sbjct:   37 YAEEISDPENRKRYEEEIAQLESERGMDITFVNPDPGYVIKTTVNGEQKAFINICKNEHIDKPQMTKELGPNGKTR-VGWQIPHSFSPPRDDLDKGGQKCKVYDVVFNPDAYRMAESNARFKKMIQDTAFDGIERQFDVKLDRKNLKFPKMKFKGVPVATVIRKRKDEGPNEQDKPATNVEGDADDDDDPLSKLPYPYDNKTTEEKRIAREEELAKQNAKKAETEAKTKVTATSTKDPDAAEI--PVYHIIHRSDMDLGDYRNAPDAKTSTRPKELAVVVTLPLLKSAANIDLEIFEKRLLLESETPAKYKLDLKLPYPVDETKGSAKFDKSKRQLIITLPV------LPAETPKLPSFIDDK--EENPPLQNGTLSNSAVDGKPLVEVISSLEN-ENPSATATAPVSSTNHSVKLQIPYSLPEY--------------------DIFQDETNVSVILNVRRVDKASCNATF-----TQAGCLLQMTSLGSGGFPNHYS--ICLSFPDKHCLAKDMCTVDIGETNVVV 525          
BLAST of Protein kintoun vs. TrEMBL
Match: A0A1I8J5Z9 (Protein kintoun OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 261.536 bits (667), Expect = 5.096e-72
Identity = 178/509 (34.97%), Postives = 269/509 (52.85%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKS-TNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSL-DKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETET-------------THYNITESKPSDSNGNEFTKPVHKIKYS--NDFEMLNYVG-DQVQHSTK--------PTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMK-PVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELP-------IEQTPDQLMELTENVPSNVSNNLIEECPSTGNEIGEQLPGDARVLSDGIVEDDNSESPNANTDGKENADSDKFTHTNPEFLTKEMTXXXXXXXXXXXXXXXXXNNSTHAFIVCHIRNIDKSNWNYQWDPISPMKHQVIIAFSNCGQGGWKNFYKLPIV-----IDF 1640
            Y EELQ+PE + +YE+E+  +E ERGMDVEFI+P PGHVLK    S KKVFINIC ++KI+  ++ ++  NG V G  WSIPHSF PPRED DK    CLV D VF+ + Y M S+N++F+KM+ DTA++G E+ F++   +  + K  K+  KGLP +TVIR+KR DF +KQ +LET   +P    Y   +  ET                   ES PS  N  +  +P ++IKYS  +DF    Y       H+T         P  + I ++LP +++A AID+D+D+R+L++T+ +    Y L+L+L YPV  D GSAKFD+ +  L L LP       +EQ+    + + +  P      LIEE P + +E    +  DA+              P   T+  ENA     T    EF   ++         +P   +R     +H  ++  ++N+D    + +   +S       ++F++ G GGW++ Y L ++     +DF
Sbjct:   49 YVEELQNPEQRALYEKEIAQLEEERGMDVEFIHPTPGHVLKLKDASGKKVFINICTNDKIQVATMQRTEQNGKV-GGNWSIPHSFAPPREDTDKSKQTCLVIDTVFHPDTYLMASRNAQFKKMIEDTAVQGAERNFQIKFANGGSVKRPKMTFKGLPQATVIRRKRPDFEDKQAQLETEPPNPFVQHYNNTQSGETPTAEGREFDLQDRAAEGDNESSPSTKNSPK--QPKYEIKYSYQSDFGDFAYESPSDGSHTTALAGSSQSCPHSVQIVVELPGVTTAQAIDVDVDNRDLRVTSQQSSAAYNLQLRLPYPVTEDNGSAKFDRKSHRLTLILPCIAQQRSVEQSVSSAVAMPDPAP------LIEELPDS-SETASSV--DAK--------------PTDATNTTENATDSSSTSMKEEFRVGQL---------LPSTAIRCNQTDSHLTMLIDVKNVDPE--SIKEAEVSSGGCCWAVSFASVGSGGWRSDYSLAVMRSDFTVDF 520          
BLAST of Protein kintoun vs. Ensembl Cavefish
Match: dnaaf2 (dynein, axonemal, assembly factor 2 [Source:NCBI gene;Acc:606664])

HSP 1 Score: 221.861 bits (564), Expect = 6.487e-64
Identity = 126/325 (38.77%), Postives = 184/325 (56.62%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTNGDVR-GATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDND----------PLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVGDQ----VQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPI 1160
            Y EE+ DPEN+R YEEE+T +E ERG+D  F++P P HVLKT  N ++K FINIC ++ + +PS       D R G  WS+P+S  P R D D K  +C VYDVVF+ +   +  KN+RF ++++ TA + +E+   V LDKIN K LK++ KG+P   VIRK          E E +D            P+  P   +K+  T     + ++ S    +  T+P + +KY +  ++ +Y   +         +P ++II I LPL+ SA  IDL++  R+L L + KP  Y L+L+LSYPV SD G AKF K  K L + LP+
Sbjct:   32 YTEEISDPENRRRYEEEITQLEQERGVDARFVHPTPHHVLKTSLNGQEKCFINICSNDLLNQPSCKPGRGEDGRLGQHWSLPYSLAPGRSDRDAKGKKCTVYDVVFHPDTLHIAGKNTRFMELVNSTAFQAVEEGCGVKLDKINAKTLKMQYKGVPQPAVIRKP---IPGHPGEKEKKDKALPDEIPELCLPISKPDTALKKNNTA---ASTAESSSKAQHHPTEPHYTVKYRSHVDLQDYSCSRDSVPSPQPNRPNKIIITIDLPLLRSAGDIDLNVTERSLVLESQKPA-YKLDLQLSYPVDSDKGDAKFTKAKKQLTITLPV 349          
BLAST of Protein kintoun vs. Ensembl Cavefish
Match: dnaaf2 (dynein, axonemal, assembly factor 2 [Source:NCBI gene;Acc:606664])

HSP 1 Score: 182.956 bits (463), Expect = 3.494e-52
Identity = 106/297 (35.69%), Postives = 158/297 (53.20%), Query Frame = 3
Query:  273 EEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTNGDVR-GATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPI 1160
            +EE+T +E ERG+D  F++P P HVLKT  N ++K FINIC ++ + +PS       D R G  WS+P+S  P R D D K  +C VYDVVF+ +   +  KN+RF ++++ TA + +E+   V LDKIN K LK++ KG+P                   +   +  L    PE+ +                  +  T+P + +KY +  ++            +P ++II I LPL+ SA  IDL++  R+L L + KP  Y L+L+LSYPV SD G AKF K  K L + LP+
Sbjct:    1 QEEITQLEQERGVDARFVHPTPHHVLKTSLNGQEKCFINICSNDLLNQPSCKPGRGEDGRLGQHWSLPYSLAPGRSDRDAKGKKCTVYDVVFHPDTLHIAGKNTRFMELVNSTAFQAVEEGCGVKLDKINAKTLKMQYKGVP-------------------QPAKDKALPDEIPELSQ------------------HHPTEPHYTVKYRSHVDL--------PQPNRPNKIIITIDLPLLRSAGDIDLNVTERSLVLESQKPA-YKLDLQLSYPVDSDKGDAKFTKAKKQLTITLPV 251          
BLAST of Protein kintoun vs. Ensembl Cavefish
Match: dnaaf2 (dynein, axonemal, assembly factor 2 [Source:NCBI gene;Acc:606664])

HSP 1 Score: 166.777 bits (421), Expect = 3.332e-46
Identity = 77/163 (47.24%), Postives = 107/163 (65.64%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTNGDVR-GATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRK 716
            Y EE+ DPEN+R YEEE+T +E ERG+D  F++P P HVLKT  N ++K FINIC ++ + +PS       D R G  WS+P+S  P R D D K  +C VYDVVF+ +   +  KN+RF ++++ TA + +E+   V LDKIN K LK++ KG+P   VIRK
Sbjct:   18 YTEEISDPENRRRYEEEITQLEQERGVDARFVHPTPHHVLKTSLNGQEKCFINICSNDLLNQPSCKPGRGEDGRLGQHWSLPYSLAPGRSDRDAKGKKCTVYDVVFHPDTLHIAGKNTRFMELVNSTAFQAVEEGCGVKLDKINAKTLKMQYKGVPQPAVIRK 180          
BLAST of Protein kintoun vs. Ensembl Cavefish
Match: pih1d1 (PIH1 domain containing 1 [Source:NCBI gene;Acc:103026325])

HSP 1 Score: 81.2629 bits (199), Expect = 2.116e-16
Identity = 82/319 (25.71%), Postives = 147/319 (46.08%), Query Frame = 3
Query:  240 ELQDPENKRIYEEELTA----MENERGMDVEFINPKPGHVLKTI-QNSEKKVFINICQSEKIEKPS-------VNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPI 1160
            EL+   ++ +Y++ L      ++NE G   + I P+PG  LKT  Q  ++KVF+NICQS  +  P        V    + D  G  + +P S      ++D   + C VYDVV N   ++   K++ F++ L   +LEG+E  + + L + + KILK            RK     +E+    +++         P I+E        ++S+PS++   EF   V              +G        P  +I EI+LP +SSA ++ LD+    L L   +P  + L++   + V  +  +A+++  ++VL + +P+
Sbjct:   11 ELEQQRHEELYQQLLLQTMGKIQNE-GPPSKVIRPQPGMCLKTSSQKDQQKVFVNICQSWDVPPPPELSQDALVELLESDDPTG--YKVPMSLGEAHIEMDNSLNSCTVYDVVINEEFFQKCQKDTLFQQFLVAVSLEGLENKYSLELSR-DVKILK-----------NRKFMGSLTEQNVRTKSK---------PIIQEISKQ----SQSQPSEAKRPEFCLWVEP-----------PIG-------PPEFLIAEIQLPGVSSARSLLLDLGEDRLVLNA-RPSLFQLDIFFPFLVNQESSAAQYNTNSQVLTVTMPV 282          
BLAST of Protein kintoun vs. Ensembl Cavefish
Match: pih1d1 (PIH1 domain containing 1 [Source:NCBI gene;Acc:103026325])

HSP 1 Score: 75.8702 bits (185), Expect = 1.033e-14
Identity = 80/314 (25.48%), Postives = 143/314 (45.54%), Query Frame = 3
Query:  240 ELQDPENKRIYEEELTA----MENERGMDVEFINPKPGHVLKTI-QNSEKKVFINICQSEKIEKPS-------VNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLR 1145
            EL+   ++ +Y++ L      ++NE G   + I P+PG  LKT  Q  ++KVF+NICQS  +  P        V    + D  G  + +P S      ++D   + C VYDVV N   ++   K++ F++ L   +LEG+E  + + L + + KILK            RK     +E+    +++         P I+E        ++S+PS++   EF   V              +G        P  +I EI+LP +SSA ++ LD+    L L   +P  + L++   + V  +  +A+++  +++ R
Sbjct:   11 ELEQQRHEELYQQLLLQTMGKIQNE-GPPSKVIRPQPGMCLKTSSQKDQQKVFVNICQSWDVPPPPELSQDALVELLESDDPTG--YKVPMSLGEAHIEMDNSLNSCTVYDVVINEEFFQKCQKDTLFQQFLVAVSLEGLENKYSLELSR-DVKILK-----------NRKFMGSLTEQNVRTKSK---------PIIQEISKQ----SQSQPSEAKRPEFCLWVEP-----------PIG-------PPEFLIAEIQLPGVSSARSLLLDLGEDRLVLNA-RPSLFQLDIFFPFLVNQESSAAQYNTNSQISR 277          
BLAST of Protein kintoun vs. Ensembl Sea Lamprey
Match: pih1d1 (PIH1 domain containing 1 [Source:NCBI gene;Acc:553260])

HSP 1 Score: 78.9518 bits (193), Expect = 2.315e-16
Identity = 76/287 (26.48%), Postives = 125/287 (43.55%), Query Frame = 3
Query:  324 INPKPGHVLKTIQNSEK----KVFINICQSEKI-EKPSVNK---STNGDVRGAT-WSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELP 1157
            I P PG  +KT    E     KVF+N+C S  +   PS+++   +T  D    T + +P S   P  + D   + C  YDVV N   YE    +  F   L    LEG+E  + + ++K  +K+LK              ++   S  Q  + TR       P P I+E  +     T S    SN     KP +++              +   S +P  ++ EI LP ++S++++ LD+    + L+T       LE  L + V  +  SA+F++ TK+L + +P
Sbjct:   23 ITPSPGFCVKTQGGPEGEQPGKVFVNVCTSPAVPSPPSISEEQLATLLDSSDPTSFRVPMSLGEPHNEFDTGGNVCTAYDVVINPEFYERAKGSELFMNFLLIVVLEGLEDKYHIQINK-EWKLLK-------------NRKFMGSLSQQHVRTR-------PRPVIQELSSGVKINTMSSQLPSNQ---PKPKYRLL-------------REPASGQPRFLVAEINLPKMTSSSSLQLDLGEDRVVLSTQPSRLPCLEFDLPWCVQQEESSAQFNRDTKILHITMP 272          
BLAST of Protein kintoun vs. Ensembl Yeast
Match: PIH1 (Component of the conserved R2TP complex (Rvb1-Rvb2-Tah1-Pih1); R2TP complex interacts with Hsp90 (Hsp82p and Hsc82p) to mediate assembly large protein complexes such as box C/D snoRNPs and RNA polymerase II [Source:SGD;Acc:S000001076])

HSP 1 Score: 51.6026 bits (122), Expect = 2.338e-7
Identity = 37/118 (31.36%), Postives = 54/118 (45.76%), Query Frame = 3
Query:  372 KKVFINICQSEKIEKPSVN---KSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSL--DKINFKILKLKMKGLPVSTVI 710
            +KVFIN+C S  + KP V+   +     +    W IP   +  R D DKK   C V+D   N +       + + R++L +  LE  E    V L  D+I F  +K K   LP   V+
Sbjct:   57 RKVFINVCHSPLVPKPEVDFNARIVFPLIIQNEWEIPIITSCYRMDHDKKGQECYVWDCCINSDCSRWICDDIQLREILVEWCLESCEIRDSVVLCRDRIAFPKMKKKGAELPALEVL 174          
BLAST of Protein kintoun vs. Ensembl Nematostella
Match: EDO37801 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEW3])

HSP 1 Score: 180.644 bits (457), Expect = 2.508e-47
Identity = 111/320 (34.69%), Postives = 181/320 (56.56%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEK-KVFINICQSEKIEKPSVNKSTNGDV----RGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFS-EKQTELETRDNDPLKFPYP--------EIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSN--DFEMLNYVGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTM-KPVKYLLE---LKLSYPVLSDMGSAKFDKT 1130
            YA+E+ DPENK+ YEEE+  MENERGMDV+F+NP+ G V+KT + ++  K F+NIC ++ IEK +   +  GD     +G  WSIP+S   PR+D D+   +C+ +DVVF+ + Y+  +K  +F+KM+ +TALEGIE+   + L+K N K  K+K KG+  +TVIR K  + S +K  E  T  +  + +PY         +  ++ T     ++ K ++++  +   P + I +    DF+      D    ST+P  ++I I LP        DL ++    + +   +  ++ L+   + L YP+  + GSAKFDK+
Sbjct:   34 YAQEISDPENKKRYEEEIRQMENERGMDVKFVNPEEGFVVKTTRETDGIKAFVNICYNQHIEKATFRMAEKGDGTERKKGQQWSIPYSLAQPRDDFDRAGKKCVTFDVVFHPDTYKKCTKMPQFKKMVIETALEGIERQLNIKLNKKNLKFPKMKFKGMKQATVIRNKSNENSFKKPNEGITIGDKTIPYPYADQPTCANKQAHKSRTPGQITSKVKDNNADTRDPRNPEYTILHRGIIDFQNFTNARDSCT-STRPKELVIRIDLP--------DLALNHCKYRYSAFSRCCQFFLDICHITLPYPIDENKGSAKFDKS 344          
BLAST of Protein kintoun vs. Ensembl Nematostella
Match: EDO43254 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZC7])

HSP 1 Score: 72.0182 bits (175), Expect = 8.958e-14
Identity = 80/299 (26.76%), Postives = 133/299 (44.48%), Query Frame = 3
Query:  288 AMENERGMDVEFIN--PKPGHVLK---TIQNSEKKVFINICQSEKIEKP-SVNKSTNGDVRGA----TWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILK-LKMKGLPVSTVIRKKR----VDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKV 1139
            AM+  +  D +FI   P  G V K   T     KKVF+NIC SE I K   +++    ++  +     + +P S   P  ++DK  + C VYD+V N    +   +N+ F+        +G+E+ + + LD+ ++ ILK  K  G P    +RKK     +D +    + E+               +++T   I+  +PS        +P++ I        L    D      KP  +++EI LP + S     LD+    L L  + P +Y L+L L + V  +   A+F+K TKV
Sbjct:   28 AMKTHQEEDKDFIEFFPDHGFVFKSKVTADAGVKKVFVNICTSEHIPKAKDISEQELAEILDSEDPMRYRVPLSLGEPHAEMDKSGNGCTVYDIVINPTFLKKVQENTFFKNFFLTVVFQGLEEKYGLDLDR-SWSILKNKKYMGKPQMHYVRKKSKPVIMDLTNSADKEES---------------SKSTSQLISTLEPS------IPQPMYNI--------LTEPSDD-----KPEFIVLEISLPGLKSIKDTALDVGEDRL-LLHVDPNRYHLDLDLPHNVDVETCGAQFNKKTKV 290          
BLAST of Protein kintoun vs. Ensembl Medaka
Match: dnaaf2 (dynein axonemal assembly factor 2 [Source:NCBI gene;Acc:100192402])

HSP 1 Score: 183.726 bits (465), Expect = 4.637e-49
Identity = 121/379 (31.93%), Postives = 198/379 (52.24%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNY-VGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPIEQTPDQLMELTENVPSNVSN----------NLIEECPSTGNEIGEQLPGDARVLSDG---IVEDDNSE 1325
            Y +E+  PEN + Y+EE+T +E +RG  +EFI+P P   L+T  + +++ FINIC  +K+ KP           G  WS+PH   P R++ ++K +   +YDV F+     +  K+ +F  M+ + A++GI+K FKV LDK N K + +K KG+P S VIRK    +  K+   E RD  P     PE   +      + + +P      E  KP++ IKY +  ++ ++ V  +   S +P  ++I I LPL+ + + + L+++ + L L +  P  Y LEL LSYPV  + G AKF+K  + L + LP+ Q P +  +L    P+  S+            +EE    G E  ++  G+    + G   ++ED N E
Sbjct:   65 YFQEISSPENVKTYQEEVTLLEQKRGNSIEFIHPSPFRALETSVDGKQRCFINICACDKVGKPESKTVRTVQRFGEKWSLPHLLQPGRQNCERKGNISTIYDVCFHPETLHLADKSEKFMDMVKEVAIQGIQKAFKVLLDKSNLKEMDIKYKGVPQSCVIRKPIPGYEAKEPP-EERDLSPSTSHLPE--NSIDVPSKLLQKQPE-----EPIKPIYAIKYRSVIDLQDFRVSRESARSLRPKEIVITIDLPLLPTVHGMVLEVEEKRLLLESENP-SYRLELHLSYPVDENNGKAKFNKHQRQLTVTLPV-QPPLEAPQLPGGSPNPTSDPQNENQTRVEERVEEMAEKGGEQRQR--GNDNGAAQGRRQVLEDQNGE 431          
BLAST of Protein kintoun vs. Ensembl Medaka
Match: pih1d1 (PIH1 domain containing 1 [Source:NCBI gene;Acc:101171583])

HSP 1 Score: 77.411 bits (189), Expect = 3.781e-15
Identity = 72/291 (24.74%), Postives = 132/291 (45.36%), Query Frame = 3
Query:  312 DVEFINPKPGHVLKTI-QNSEKKVFINICQSEKIEKPS-------VNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPI 1160
            D + I P+PG  +KT  +  ++KVFINICQS  +  P        V+   + D  G  + +P S   P  ++D  +  C  YDVV N + ++   +++ F++ +   + EG+E  +K+ L + ++K+LK            RK     SE+    ++R         P I+  +  + N  + +P                    F +L  V     H   P  ++ EI LP + S+ ++ LD+    L LT  +P  + L++   + V  D  +A+F+  T++L + +P+
Sbjct:   38 DSKSIRPQPGMCVKTFTEPGKEKVFINICQSSSVPPPPELSREELVDLLQSEDPSG--YRVPMSLGEPHTEVDNSSQSCTAYDVVINQDFFQKCQEDALFQQFVILVSAEGLENKYKLELSR-DWKVLK-----------NRKFLGSVSEQNIRTKSR---------PTIQVLQPQYINSCDFRPK-------------------FRLL--VEPPTGH---PENLVAEIHLPGVPSSRSLLLDVGEDRLVLTA-RPSLFHLDVFHPFLVDQDNTAAQFNNQTQILTVTMPV 280          
BLAST of Protein kintoun vs. Ensembl Medaka
Match: pih1d1 (PIH1 domain containing 1 [Source:NCBI gene;Acc:101171583])

HSP 1 Score: 64.6994 bits (156), Expect = 5.282e-11
Identity = 64/280 (22.86%), Postives = 121/280 (43.21%), Query Frame = 3
Query:  342 HVLKTIQNSEKKVFINICQSEKIEKPS-------VNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPI 1160
            +V    +  ++KVFINICQS  +  P        V+   + D  G  + +P S   P  ++D  +  C  YDVV N + ++   +++ F++ +   + EG+E  +K+ L + ++K+LK            RK     SE+    ++R         P I+                         ++   +   F +L  V     H   P  ++ EI LP + S+ ++ LD+    L LT  +P  + L++   + V  D  +A+F+  T++L + +P+
Sbjct:   34 YVCTFTEPGKEKVFINICQSSSVPPPPELSREELVDLLQSEDPSG--YRVPMSLGEPHTEVDNSSQSCTAYDVVINQDFFQKCQEDALFQQFVILVSAEGLENKYKLELSR-DWKVLK-----------NRKFLGSVSEQNIRTKSR---------PTIQ-------------------------INSCDFRPKFRLL--VEPPTGH---PENLVAEIHLPGVPSSRSLLLDVGEDRLVLTA-RPSLFHLDVFHPFLVDQDNTAAQFNNQTQILTVTMPV 259          
BLAST of Protein kintoun vs. Planmine SMEST
Match: SMESG000052588.1 (SMESG000052588.1)

HSP 1 Score: 1318.91 bits (3412), Expect = 0.000e+0
Identity = 659/665 (99.10%), Postives = 662/665 (99.55%), Query Frame = 3
Query:  231 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPIEQTPDQLMELTENVPSNVSNNLIEECPSTGNEIGEQLPGDARVLSDGIVEDDNSESPNANTDGKENADSDKFTHTNPEFLTKEMTXXXXXXXXXXXXXXXXXNNSTHAFIVCHIRNIDKSNWNYQWDPISPMKHQVIIAFSNCGQGGWKNFYKLPIVIDFKDEITNVRSEIQCQISEESMVLQVPIQINSTFAKSLGFSNQIFTCKYDDPLNCWNTLCDPEIITELNDNNETFQTAFGVISTETLKIICAPLQSPIDMEKEFPKIVCTVTETYTEIDHHETDQMEMVEGEESVETQETNSKFISEPNENIVNESVIIEKDFPTILPLDYMEAQRNLEHRNNCCVELNVDLLFDLE 2225
            YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELE RDNDPLKFPYPEI+ETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDK+TKVLRLELPIEQTPDQLMELTENVPSNVSNNLIEECPSTGNEIGEQLPGDARVLSDGI EDDNSESPNANTDGKENADSDKFTHTNPEFLTKEMTRLDEIERIIPEIEL+FRNNSTHAFIVCHIRNIDKSNWNYQWDPISPMKHQVIIAFSNCGQGGWKNFYKLPIVIDFKDEITNVRSEIQCQISEESMVLQVPIQINSTFAKSLGFSNQIFTCKYDDPLNCWNTLCDPEIITE NDNNETFQTAFGVISTETLKIICAPLQSPIDMEKEFPKIVCTVTETYTEIDHHETDQMEMVEGEESVETQETNSKFISEPNENIVNESVIIEKDFPTILPLDYMEAQRNLEHRNNCCVELNVDLLFDLE
Sbjct:   37 YAEELQDPENKRIYEEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELENRDNDPLKFPYPEIQETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKSTKVLRLELPIEQTPDQLMELTENVPSNVSNNLIEECPSTGNEIGEQLPGDARVLSDGIAEDDNSESPNANTDGKENADSDKFTHTNPEFLTKEMTRLDEIERIIPEIELKFRNNSTHAFIVCHIRNIDKSNWNYQWDPISPMKHQVIIAFSNCGQGGWKNFYKLPIVIDFKDEITNVRSEIQCQISEESMVLQVPIQINSTFAKSLGFSNQIFTCKYDDPLNCWNTLCDPEIITERNDNNETFQTAFGVISTETLKIICAPLQSPIDMEKEFPKIVCTVTETYTEIDHHETDQMEMVEGEESVETQETNSKFISEPNENIVNESVIIEKDFPTILPLDYMEAQRNLEHRNNCCVELNVDLLFDLE 701          
BLAST of Protein kintoun vs. Planmine SMEST
Match: SMESG000066760.1 (SMESG000066760.1)

HSP 1 Score: 67.0106 bits (162), Expect = 6.346e-12
Identity = 70/286 (24.48%), Postives = 120/286 (41.96%), Query Frame = 3
Query:  312 DVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPIEQT 1169
            D   I P+PG  +K   +  +KVF+NIC ++K+ + S+                 S   P  + D     C+ YDVV N         +   +        EGIE  + ++L + ++KIL+ K         ++++ +  + K   ++  +N P     P I E       + E+ PS  N N   +P         FE++     QV     P   + EI+LP I S  ++ LD+    + L +   + Y L+  L   ++ D   A+F+  TKVL L L +  +
Sbjct:   32 DFVVIIPEPGFCIKLYDSDSRKVFVNICTNDKVPQNSM-----------------SIGEPHMEKDHIGSDCVCYDVVINPQLLSKLHSSLTIKGFFFTLCFEGIENKYNLTLKR-DWKILQNKK----AHGNLKEQYLRTASKPVIIDCDNNSPQS---PLITE-------LIENSPSQVNKNLGQRPA--------FEIV-----QVPPKGFPEYFVAEIQLPKIKSGKSLQLDVGENRVVLGSRTKI-YDLDFYLPEFIIPDQTLAEFNVVTKVLSLTLTVNAS 271          
BLAST of Protein kintoun vs. Planmine SMEST
Match: SMESG000066760.1 (SMESG000066760.1)

HSP 1 Score: 62.3882 bits (150), Expect = 3.175e-10
Identity = 67/276 (24.28%), Postives = 115/276 (41.67%), Query Frame = 3
Query:  312 DVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPSVNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGSKNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKRVDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTKPVHKIKYSNDFEMLNYVGDQVQHSTKPTRMIIEIKLPLISSANAIDLDIDSRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKV 1139
            D   I P+PG  +K   +  +KVF+NIC ++K+ + S+                 S   P  + D     C+ YDVV N         +   +        EGIE  + ++L + ++KIL+ K         ++++ +  + K   ++  +N P     P I E       + E+ PS  N N   +P         FE++     QV     P   + EI+LP I S  ++ LD+    + L +   + Y L+  L   ++ D   A+F+  TKV
Sbjct:   32 DFVVIIPEPGFCIKLYDSDSRKVFVNICTNDKVPQNSM-----------------SIGEPHMEKDHIGSDCVCYDVVINPQLLSKLHSSLTIKGFFFTLCFEGIENKYNLTLKR-DWKILQNKK----AHGNLKEQYLRTASKPVIIDCDNNSPQS---PLITE-------LIENSPSQVNKNLGQRPA--------FEIV-----QVPPKGFPEYFVAEIQLPKIKSGKSLQLDVGENRVVLGSRTKI-YDLDFYLPEFIIPDQTLAEFNVVTKV 261          
The following BLAST results are available for this feature:
BLAST of Protein kintoun vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAAF27.746e-5536.83dynein axonemal assembly factor 2 [Source:HGNC Sym... [more]
DNAAF21.382e-5436.83dynein axonemal assembly factor 2 [Source:HGNC Sym... [more]
PIH1D18.408e-1133.63PIH1 domain containing 1 [Source:HGNC Symbol;Acc:H... [more]
PIH1D12.043e-1023.34PIH1 domain containing 1 [Source:HGNC Symbol;Acc:H... [more]
PIH1D12.043e-1023.34PIH1 domain containing 1 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of Protein kintoun vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein kintoun vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Nop17l1.952e-5940.51gene:FBgn0033224 transcript:FBtr0088902[more]
Nop17l1.952e-5940.51gene:FBgn0033224 transcript:FBtr0088900[more]
Nop17l1.952e-5940.51gene:FBgn0033224 transcript:FBtr0088901[more]
back to top
BLAST of Protein kintoun vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dnaaf24.411e-3429.36dynein, axonemal, assembly factor 2 [Source:NCBI g... [more]
pih1d11.023e-1527.43PIH1 domain containing 1 [Source:NCBI gene;Acc:553... [more]
back to top
BLAST of Protein kintoun vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
arsl2.357e-5835.87arylsulfatase L [Source:Xenbase;Acc:XB-GENE-604917... [more]
pih1d11.133e-1825.09PIH1 domain containing 1 [Source:NCBI gene;Acc:100... [more]
back to top
BLAST of Protein kintoun vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnaaf24.389e-5034.80dynein, axonemal assembly factor 2 [Source:MGI Sym... [more]
Pih1d15.314e-1136.15PIH1 domain containing 1 [Source:MGI Symbol;Acc:MG... [more]
Pih1d15.314e-1136.15PIH1 domain containing 1 [Source:MGI Symbol;Acc:MG... [more]
Pih1d15.314e-1136.15PIH1 domain containing 1 [Source:MGI Symbol;Acc:MG... [more]
Pih1d12.987e-941.18PIH1 domain containing 1 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Protein kintoun vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B4J4Y2|KTU_DROGR3.011e-6438.83Protein kintoun OS=Drosophila grimshawi OX=7222 GN... [more]
sp|B4LMK1|KTU_DROVI2.310e-6039.05Protein kintoun OS=Drosophila virilis OX=7244 GN=N... [more]
sp|Q0IEW8|KTU_AEDAE3.865e-6039.05Protein kintoun OS=Aedes aegypti OX=7159 GN=AAEL00... [more]
sp|B3MG50|KTU_DROAN4.250e-6040.32Protein kintoun OS=Drosophila ananassae OX=7217 GN... [more]
sp|B4P238|KTU_DROYA8.331e-6041.14Protein kintoun OS=Drosophila yakuba OX=7245 GN=No... [more]
back to top
BLAST of Protein kintoun vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1FY129.127e-8044.14Uncharacterized protein OS=Helobdella robusta OX=6... [more]
V3ZG291.095e-7843.77Protein kintoun OS=Lottia gigantea OX=225164 GN=LO... [more]
A0A1S3HBE37.204e-7734.66Protein kintoun OS=Lingula unguis OX=7574 GN=LOC10... [more]
A0A1S3HCV81.216e-7434.47Protein kintoun OS=Lingula unguis OX=7574 GN=LOC10... [more]
A0A1I8J5Z95.096e-7234.97Protein kintoun OS=Macrostomum lignano OX=282301 P... [more]
back to top
BLAST of Protein kintoun vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnaaf26.487e-6438.77dynein, axonemal, assembly factor 2 [Source:NCBI g... [more]
dnaaf23.494e-5235.69dynein, axonemal, assembly factor 2 [Source:NCBI g... [more]
dnaaf23.332e-4647.24dynein, axonemal, assembly factor 2 [Source:NCBI g... [more]
pih1d12.116e-1625.71PIH1 domain containing 1 [Source:NCBI gene;Acc:103... [more]
pih1d11.033e-1425.48PIH1 domain containing 1 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Protein kintoun vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pih1d12.315e-1626.48PIH1 domain containing 1 [Source:NCBI gene;Acc:553... [more]
back to top
BLAST of Protein kintoun vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PIH12.338e-731.36Component of the conserved R2TP complex (Rvb1-Rvb2... [more]
back to top
BLAST of Protein kintoun vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO378012.508e-4734.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432548.958e-1426.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kintoun vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dnaaf24.637e-4931.93dynein axonemal assembly factor 2 [Source:NCBI gen... [more]
pih1d13.781e-1524.74PIH1 domain containing 1 [Source:NCBI gene;Acc:101... [more]
pih1d15.282e-1122.86PIH1 domain containing 1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Protein kintoun vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000052588.10.000e+099.10SMESG000052588.1[more]
SMESG000066760.16.346e-1224.48SMESG000066760.1[more]
SMESG000066760.13.175e-1024.28SMESG000066760.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021399 ID=SMED30021399|Name=Protein kintoun|organism=Schmidtea mediterranea sexual|type=transcript|length=2276bp
AATTAGTCGTTCTTGTGATAATAATCTGTTACCAATGTCAACTAATTAAA
ATTTAAAGATTGATTAATTTGAGATAATATAAAATAATACTAACACTTTA
TTTATTTAAAAAACATTATAACATGGAAAAATTAAAAGATACTCTTACTG
ATTTAAAGTTAACTAATGATGAAGTTAAAAGATTTAGTGAAGCATTTAAA
AAGGAAGAATTTAAAAAATTATTTCGTGAATATGCAGAAGAATTACAAGA
TCCTGAAAATAAAAGAATATACGAAGAGGAATTAACGGCCATGGAAAATG
AAAGAGGAATGGATGTAGAATTTATTAATCCGAAACCAGGTCATGTTCTG
AAGACTATTCAAAATTCAGAGAAAAAAGTGTTTATTAATATTTGTCAATC
TGAAAAAATAGAGAAACCTAGCGTGAATAAAAGTACAAACGGAGATGTGC
GTGGAGCAACGTGGTCAATACCTCACAGTTTTACACCTCCCAGAGAAGAT
CTTGACAAGAAGAATGATAGATGTCTAGTATATGACGTAGTTTTTAACAT
AAACGCATATGAAATGGGCAGCAAAAACTCTCGTTTCCGTAAAATGTTAC
ACGATACCGCTTTGGAAGGAATCGAAAAGATGTTCAAAGTCTCTCTAGAC
AAAATCAATTTCAAAATACTAAAATTGAAAATGAAAGGATTGCCAGTTTC
GACGGTCATTAGAAAGAAACGAGTTGATTTCAGTGAAAAGCAAACTGAAC
TCGAAACCCGGGATAACGATCCTTTGAAATTCCCGTATCCAGAAATCAAG
GAGACTGAGACAACCCATTACAACATCACCGAGTCAAAGCCTTCCGACAG
CAATGGCAATGAATTCACTAAACCAGTGCACAAAATCAAATACTCAAATG
ATTTCGAAATGTTGAATTATGTCGGCGATCAAGTCCAGCATTCGACAAAG
CCGACAAGAATGATCATAGAGATCAAGCTGCCGTTGATTTCGTCAGCAAA
CGCGATAGATCTCGACATTGACAGTCGGAATCTGAAATTGACGACCATGA
AACCCGTTAAATACCTTTTGGAACTGAAATTGTCATATCCAGTCCTGTCA
GATATGGGGTCAGCCAAATTTGATAAAACCACAAAAGTATTGAGATTGGA
GCTTCCTATTGAACAAACTCCCGACCAATTAATGGAGCTCACTGAAAACG
TACCATCAAATGTTTCAAATAATTTGATAGAAGAATGCCCATCAACTGGT
AATGAAATCGGAGAACAGTTGCCTGGTGATGCAAGGGTTCTCAGTGATGG
AATTGTTGAAGATGATAATTCAGAAAGTCCTAATGCAAATACAGACGGCA
AGGAAAATGCTGACAGTGATAAATTTACTCATACAAATCCAGAATTCCTG
ACCAAGGAAATGACTCGTTTAGATGAAATTGAAAGGATAATCCCGGAAAT
AGAGTTAAGATTTCGAAACAATTCTACGCACGCATTCATAGTTTGTCACA
TTCGAAATATTGACAAATCCAATTGGAATTATCAGTGGGATCCGATATCC
CCTATGAAACATCAAGTTATTATAGCATTTTCTAATTGCGGTCAAGGAGG
CTGGAAAAACTTTTACAAATTACCTATAGTTATTGATTTTAAAGATGAAA
TAACGAATGTCAGAAGTGAAATTCAATGCCAGATATCTGAAGAGAGCATG
GTGCTTCAGGTTCCAATTCAGATAAATTCCACATTTGCAAAATCTTTGGG
TTTCTCTAATCAAATTTTCACCTGCAAATATGATGATCCGCTCAATTGCT
GGAATACACTATGTGACCCCGAAATTATTACTGAACTGAATGATAATAAC
GAAACCTTTCAAACTGCATTTGGTGTCATCAGCACAGAAACTTTGAAAAT
TATTTGCGCACCTCTTCAAAGCCCAATTGATATGGAAAAAGAATTCCCGA
AGATTGTTTGTACTGTCACCGAAACCTACACTGAGATAGATCACCATGAA
ACTGATCAAATGGAAATGGTAGAAGGCGAAGAATCGGTTGAAACTCAGGA
AACGAATAGCAAATTTATAAGTGAGCCTAATGAAAACATTGTAAATGAAT
CAGTAATAATTGAAAAAGACTTTCCAACAATTTTACCTTTGGATTATATG
GAAGCTCAGAGAAATTTGGAACATAGAAATAACTGCTGTGTGGAACTGAA
TGTTGATTTATTATTTGATTTGGAATAATGATAATAATAAACTTGTTTAT
GATGTCGTTAATAAAATTGTATCTCG
back to top

protein sequence of SMED30021399-orf-1

>SMED30021399-orf-1 ID=SMED30021399-orf-1|Name=SMED30021399-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=702bp
MEKLKDTLTDLKLTNDEVKRFSEAFKKEEFKKLFREYAEELQDPENKRIY
EEELTAMENERGMDVEFINPKPGHVLKTIQNSEKKVFINICQSEKIEKPS
VNKSTNGDVRGATWSIPHSFTPPREDLDKKNDRCLVYDVVFNINAYEMGS
KNSRFRKMLHDTALEGIEKMFKVSLDKINFKILKLKMKGLPVSTVIRKKR
VDFSEKQTELETRDNDPLKFPYPEIKETETTHYNITESKPSDSNGNEFTK
PVHKIKYSNDFEMLNYVGDQVQHSTKPTRMIIEIKLPLISSANAIDLDID
SRNLKLTTMKPVKYLLELKLSYPVLSDMGSAKFDKTTKVLRLELPIEQTP
DQLMELTENVPSNVSNNLIEECPSTGNEIGEQLPGDARVLSDGIVEDDNS
ESPNANTDGKENADSDKFTHTNPEFLTKEMTRLDEIERIIPEIELRFRNN
STHAFIVCHIRNIDKSNWNYQWDPISPMKHQVIIAFSNCGQGGWKNFYKL
PIVIDFKDEITNVRSEIQCQISEESMVLQVPIQINSTFAKSLGFSNQIFT
CKYDDPLNCWNTLCDPEIITELNDNNETFQTAFGVISTETLKIICAPLQS
PIDMEKEFPKIVCTVTETYTEIDHHETDQMEMVEGEESVETQETNSKFIS
EPNENIVNESVIIEKDFPTILPLDYMEAQRNLEHRNNCCVELNVDLLFDL
E*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0060285cilium-dependent cell motility
GO:0070286axonemal dynein complex assembly
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR041442PIH1D1/2/3_CS-like
IPR012981PIH1_N
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: molecular function
TermDefinition
GO:0008157protein phosphatase 1 binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR012981PIH1, N-terminalPFAMPF08190PIH1coord: 41..201
e-value: 2.0E-56
score: 190.0
IPR041442PIH1D1/2/3, CS-like domainPFAMPF18201PIH1_CScoord: 249..346
e-value: 3.5E-19
score: 69.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 397..419
NoneNo IPR availablePANTHERPTHR22997UNCHARACTERIZEDcoord: 5..700
NoneNo IPR availablePANTHERPTHR22997:SF3PROTEIN KINTOUNcoord: 5..700