Dual specificity protein phosphatase 22

Overview
NameDual specificity protein phosphatase 22
Smed IDSMED30021392
Length (bp)1078
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dual specificity protein phosphatase 22 (SMED30021392) t-SNE clustered cells

Violin plots show distribution of expression levels for Dual specificity protein phosphatase 22 (SMED30021392) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dual specificity protein phosphatase 22 (SMED30021392) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dual specificity protein phosphatase 22 (SMED30021392) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021392

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30021392SMESG000036587.1 Contig3397GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Human
Match: DUSP15 (dual specificity phosphatase 15 [Source:HGNC Symbol;Acc:HGNC:16236])

HSP 1 Score: 144.05 bits (362), Expect = 1.646e-40
Identity = 70/165 (42.42%), Postives = 109/165 (66.06%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEE--RKRIKNKFGESPF 580
            MG  M+K++ G+Y+G++ +A + D L +  ITH++++H    E+ +   +   + RI ++D     I K+F EC +FIH CRL+GGNCL+HC  GISRS +I  AY+M+VT + +RD L  ++  R  A+PNPGFR+QL  F   W S +  R++++ +FGESPF
Sbjct:    1 MGNGMTKVLPGLYLGNFIDAKDLDQLGRNKITHIISIH----ESPQPLLQDITYLRIPVADTPEVPIKKHFKECINFIHCCRLNGGNCLVHCFAGISRSTTIVTAYVMTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEF--GWASSQKLRRQLEERFGESPF 159          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Human
Match: DUSP15 (dual specificity phosphatase 15 [Source:HGNC Symbol;Acc:HGNC:16236])

HSP 1 Score: 135.576 bits (340), Expect = 2.494e-37
Identity = 66/158 (41.77%), Postives = 104/158 (65.82%), Query Frame = 2
Query:  113 IVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEE--RKRIKNKFGESPF 580
            ++ G+Y+G++ +A + D L +  ITH++++H    E+ +   +   + RI ++D     I K+F EC +FIH CRL+GGNCL+HC  GISRS +I  AY+M+VT + +RD L  ++  R  A+PNPGFR+QL  F   W S +  R++++ +FGESPF
Sbjct:    5 VLPGLYLGNFIDAKDLDQLGRNKITHIISIH----ESPQPLLQDITYLRIPVADTPEVPIKKHFKECINFIHCCRLNGGNCLVHCFAGISRSTTIVTAYVMTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEF--GWASSQKLRRQLEERFGESPF 156          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Human
Match: DUSP22 (dual specificity phosphatase 22 [Source:HGNC Symbol;Acc:HGNC:16077])

HSP 1 Score: 132.494 bits (332), Expect = 1.207e-36
Identity = 67/173 (38.73%), Postives = 107/173 (61.85%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPDLQEMKN 610
            MG  M+KI+ G+Y+G++ +A + + L K  +TH+L+VH+    + R   +   +  I  +D   +N+ ++F E   FIHECRL G +CL+HC  G+SRSV++  AY+M+VT   + D L  V+  R  A+PN GF+ QL  FE+  + + R+ +K ++GESP    D +E KN
Sbjct:    1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHD----SARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPL--QDAEEAKN 167          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Human
Match: DUSP22 (dual specificity phosphatase 22 [Source:HGNC Symbol;Acc:HGNC:16077])

HSP 1 Score: 132.88 bits (333), Expect = 1.537e-36
Identity = 67/173 (38.73%), Postives = 107/173 (61.85%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPDLQEMKN 610
            MG  M+KI+ G+Y+G++ +A + + L K  +TH+L+VH+    + R   +   +  I  +D   +N+ ++F E   FIHECRL G +CL+HC  G+SRSV++  AY+M+VT   + D L  V+  R  A+PN GF+ QL  FE+  + + R+ +K ++GESP    D +E KN
Sbjct:    1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHD----SARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPLQ--DAEEAKN 167          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Human
Match: DUSP15 (dual specificity phosphatase 15 [Source:HGNC Symbol;Acc:HGNC:16236])

HSP 1 Score: 122.094 bits (305), Expect = 1.268e-31
Identity = 59/144 (40.97%), Postives = 93/144 (64.58%), Query Frame = 2
Query:  113 IVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEER 544
            ++ G+Y+G++ +A + D L +  ITH++++H    E+ +   +   + RI ++D     I K+F EC +FIH CRL+GGNCL+HC  GISRS +I  AY+M+VT + +RD L  ++  R  A+PNPGFR+QL  F   W S ++
Sbjct:    5 VLPGLYLGNFIDAKDLDQLGRNKITHIISIH----ESPQPLLQDITYLRIPVADTPEVPIKKHFKECINFIHCCRLNGGNCLVHCFAGISRSTTIVTAYVMTVTGLGWRDVLEAIKATRPIANPNPGFRQQLEEF--GWASSQK 142          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Celegans
Match: lip-1 (Dual specificity protein phosphatase lip-1 [Source:UniProtKB/Swiss-Prot;Acc:V6CIV8])

HSP 1 Score: 77.0258 bits (188), Expect = 1.908e-15
Identity = 49/142 (34.51%), Postives = 70/142 (49.30%), Query Frame = 2
Query:  110 KIVNGVYVGSYGNAANEDYLEKFNITHVLAV----HNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFER 523
            K+ N +Y+G+   A N D L+K++I+HV+ V     N  EE          + RI+  D    N+ K+F E   FI + R +   CL+HC  GISRSV+I  AYLM             VQ      +PN  F  QL ++E+
Sbjct:  187 KLTNFLYLGNAETAKNRDVLKKYSISHVINVTSNLPNTFEE-----DPNMRYLRISADDNASHNLTKFFPEAISFIDDARRNDSACLVHCLAGISRSVTICLAYLMKTEMCTLDSAYEWVQKRNASIAPNFHFMGQLTDYEK 323          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Celegans
Match: lip-1 (Dual specificity protein phosphatase lip-1 [Source:UniProtKB/Swiss-Prot;Acc:V6CIV8])

HSP 1 Score: 76.6406 bits (187), Expect = 2.610e-15
Identity = 49/142 (34.51%), Postives = 70/142 (49.30%), Query Frame = 2
Query:  110 KIVNGVYVGSYGNAANEDYLEKFNITHVLAV----HNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFER 523
            K+ N +Y+G+   A N D L+K++I+HV+ V     N  EE          + RI+  D    N+ K+F E   FI + R +   CL+HC  GISRSV+I  AYLM             VQ      +PN  F  QL ++E+
Sbjct:  187 KLTNFLYLGNAETAKNRDVLKKYSISHVINVTSNLPNTFEE-----DPNMRYLRISADDNASHNLTKFFPEAISFIDDARRNDSACLVHCLAGISRSVTICLAYLMKTEMCTLDSAYEWVQKRNASIAPNFHFMGQLTDYEK 323          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Celegans
Match: F13D11.3 (pep chromosome:WBcel235:X:5804379:5805922:-1 gene:WBGene00017428.1 transcript:F13D11.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F13D11.3)

HSP 1 Score: 70.4774 bits (171), Expect = 2.647e-14
Identity = 37/140 (26.43%), Postives = 70/140 (50.00%), Query Frame = 2
Query:  104 MSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFER 523
            ++++   +++  YG       L+++NITH +   NL  +  +   +      + + D  +  I +YF     +I + +  G N +I+C  G+SRS ++T  YLM    ++  +  L V   R   SPN GF  Q+++FE+
Sbjct:   11 ITQVRPHLFLAGYG-CITPSLLKQYNITHGVDCTNLKTKPIKGLDRIE----VPVDDNTLAKITQYFEPVVKYIEDAKQQGHNTVIYCAAGVSRSATLTIVYLMVTENLSLEEAYLQVNQVRPIISPNIGFWRQMIDFEK 145          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 73.1738 bits (178), Expect = 6.011e-14
Identity = 43/148 (29.05%), Postives = 77/148 (52.03%), Query Frame = 2
Query:   95 GGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSE 538
            G  ++ I   +Y+GS  ++ +E  L+  +I+ V+ + +++       K+ +   RI ++D   E ++ YF    +F+ +CR +G  CLIHC  GISRS ++  +Y+M    M   D    V+  R   SPN  F  QL+ +E   + +
Sbjct:  177 GDGITLITPNIYLGSQIDSLDETMLDALDISVVINL-SMTCPKSVCIKEDKNFMRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYMKMGSDDAYRYVKERRPSISPNFNFMGQLLEYENVLIKD 323          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Celegans
Match: vhp-1 (Tyrosine-protein phosphatase vhp-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10038])

HSP 1 Score: 73.1738 bits (178), Expect = 6.011e-14
Identity = 43/148 (29.05%), Postives = 77/148 (52.03%), Query Frame = 2
Query:   95 GGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSE 538
            G  ++ I   +Y+GS  ++ +E  L+  +I+ V+ + +++       K+ +   RI ++D   E ++ YF    +F+ +CR +G  CLIHC  GISRS ++  +Y+M    M   D    V+  R   SPN  F  QL+ +E   + +
Sbjct:  177 GDGITLITPNIYLGSQIDSLDETMLDALDISVVINL-SMTCPKSVCIKEDKNFMRIPVNDSYQEKLSPYFPMAYEFLEKCRRAGKKCLIHCLAGISRSPTLAISYIMRYMKMGSDDAYRYVKERRPSISPNFNFMGQLLEYENVLIKD 323          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Fly
Match: CG10089 (gene:FBgn0036369 transcript:FBtr0075821)

HSP 1 Score: 129.028 bits (323), Expect = 3.795e-34
Identity = 69/177 (38.98%), Postives = 114/177 (64.41%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPDLQEMKNNMEN 622
            MG  M+K++ G+YVG+Y ++ +   LE+F I+H++A+H    ++ R+    + +  +  SD   +N+++YFS CNDFIH  RL  GN LIHC  G+SRSV++  AY+M+ T +N+++ L  V+  R  A+PN GF+ QL  FE+  LSEER+R++ +F  S   + D  ++   ++N
Sbjct:    1 MGNGMNKVLPGLYVGNYRDSKDHAQLERFKISHIIAIH----DSPRRLLPDKHYLCVMASDTPDQNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQLQEFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDN 173          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Fly
Match: CG10089 (gene:FBgn0036369 transcript:FBtr0075822)

HSP 1 Score: 129.028 bits (323), Expect = 3.795e-34
Identity = 69/177 (38.98%), Postives = 114/177 (64.41%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPDLQEMKNNMEN 622
            MG  M+K++ G+YVG+Y ++ +   LE+F I+H++A+H    ++ R+    + +  +  SD   +N+++YFS CNDFIH  RL  GN LIHC  G+SRSV++  AY+M+ T +N+++ L  V+  R  A+PN GF+ QL  FE+  LSEER+R++ +F  S   + D  ++   ++N
Sbjct:    1 MGNGMNKVLPGLYVGNYRDSKDHAQLERFKISHIIAIH----DSPRRLLPDKHYLCVMASDTPDQNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQLQEFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDN 173          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Fly
Match: CG10089 (gene:FBgn0036369 transcript:FBtr0075823)

HSP 1 Score: 126.331 bits (316), Expect = 4.202e-33
Identity = 68/177 (38.42%), Postives = 112/177 (63.28%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPDLQEMKNNMEN 622
            M   M K++ G+YVG+Y ++ +   LE+F I+H++A+H    ++ R+    + +  +  SD   +N+++YFS CNDFIH  RL  GN LIHC  G+SRSV++  AY+M+ T +N+++ L  V+  R  A+PN GF+ QL  FE+  LSEER+R++ +F  S   + D  ++   ++N
Sbjct:    1 MNWHMGKVLPGLYVGNYRDSKDHAQLERFKISHIIAIH----DSPRRLLPDKHYLCVMASDTPDQNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQLQEFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDN 173          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Fly
Match: CG10089 (gene:FBgn0036369 transcript:FBtr0345364)

HSP 1 Score: 128.257 bits (321), Expect = 4.437e-33
Identity = 69/177 (38.98%), Postives = 114/177 (64.41%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPDLQEMKNNMEN 622
            MG  M+K++ G+YVG+Y ++ +   LE+F I+H++A+H    ++ R+    + +  +  SD   +N+++YFS CNDFIH  RL  GN LIHC  G+SRSV++  AY+M+ T +N+++ L  V+  R  A+PN GF+ QL  FE+  LSEER+R++ +F  S   + D  ++   ++N
Sbjct:    1 MGNGMNKVLPGLYVGNYRDSKDHAQLERFKISHIIAIH----DSPRRLLPDKHYLCVMASDTPDQNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQLQEFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDN 173          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Fly
Match: CG10089 (gene:FBgn0036369 transcript:FBtr0075820)

HSP 1 Score: 128.257 bits (321), Expect = 4.437e-33
Identity = 69/177 (38.98%), Postives = 114/177 (64.41%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPDLQEMKNNMEN 622
            MG  M+K++ G+YVG+Y ++ +   LE+F I+H++A+H    ++ R+    + +  +  SD   +N+++YFS CNDFIH  RL  GN LIHC  G+SRSV++  AY+M+ T +N+++ L  V+  R  A+PN GF+ QL  FE+  LSEER+R++ +F  S   + D  ++   ++N
Sbjct:    1 MGNGMNKVLPGLYVGNYRDSKDHAQLERFKISHIIAIH----DSPRRLLPDKHYLCVMASDTPDQNLSQYFSVCNDFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQLQEFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDN 173          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Zebrafish
Match: dusp22a (dual specificity phosphatase 22a [Source:NCBI gene;Acc:436787])

HSP 1 Score: 125.176 bits (313), Expect = 7.461e-34
Identity = 59/163 (36.20%), Postives = 99/163 (60.74%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPF 580
            MG  M+K+++G+Y+G+  ++ N D L +  ITH+L+V N ++              I  +D + +N++++F E   FIHECRL+GG CL+HC  G+SRS ++  AYLM+VT+  +++ L  V+  R    PN GF++QL  F+   +SE +  ++  +  SPF
Sbjct:    1 MGNGMNKVIDGLYLGNIRDSENRDSLSRNGITHILSVCNNAKPVLEDMTYLC----INAADASSQNLSQHFKESIRFIHECRLNGGACLVHCLAGVSRSTTVVVAYLMTVTSYGWQECLTAVKAVRSFVGPNYGFQQQLQEFQMKQVSEYQAWLRASYRSSPF 159          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Zebrafish
Match: dusp22b (dual specificity phosphatase 22b [Source:NCBI gene;Acc:100002272])

HSP 1 Score: 121.709 bits (304), Expect = 9.677e-33
Identity = 61/188 (32.45%), Postives = 114/188 (60.64%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPDLQEMKNNMENALNKDKQPIMN 655
            MG  ++K++  +Y+G++ +A + + L + NITH+L++H+ +        +   +  I  +D   +N+ ++F +   FIH+ RL G  CL+HC  G+SRSV++  AY+M+VTT+ +++ L  V+ AR  ASPN GF+ QL  F+   L + R+ +K ++ E+PF   D ++++N +  A  ++   + N
Sbjct:    1 MGNGINKVLPDLYLGNFKDARDREQLARNNITHILSIHDTA----APILQEMTYLCIAAADSPTQNLIQHFRQSIAFIHQSRLKGEGCLVHCLAGVSRSVTLVVAYIMTVTTLGWQEALAAVKIARPCASPNTGFQNQLQEFQTGELQQFREWLKEEYKENPF--NDEEDIRNLLTKASTEEDAELQN 182          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Zebrafish
Match: styx (serine/threonine/tyrosine interacting protein [Source:ZFIN;Acc:ZDB-GENE-050522-45])

HSP 1 Score: 83.5741 bits (205), Expect = 3.172e-18
Identity = 51/153 (33.33%), Postives = 76/153 (49.67%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDY--LEKFNITHVLAVHNLSEE--AXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSE 538
            M  +M +I+ G+++G Y  A       LEK  ITH++ V    E             +  + I+D  +ENI +YF    +FI  C  +GG  L+H   GISRS ++  AYLM    + +RD    VQ  R   +PN GF  QL  +E  +L++
Sbjct:   26 MRREMQEILPGLFLGPYSAAMKSKLSMLEKQGITHIVCVRQDIEANFIKPNFPHKFRYLVLDIADNPVENIIRYFPMTKEFIDGCLETGGKVLVHGNAGISRSAALVIAYLMETFGVKYRDAFSHVQERRFCINPNVGFVHQLQEYEAIYLAK 178          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Zebrafish
Match: dusp19b (dual specificity phosphatase 19b [Source:ZFIN;Acc:ZDB-GENE-040502-1])

HSP 1 Score: 80.4925 bits (197), Expect = 2.363e-17
Identity = 45/136 (33.09%), Postives = 71/136 (52.21%), Query Frame = 2
Query:  113 IVNGVYVGSYGNAANE-DYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNF 517
            I+    + S  +AA++ D L+K  +THVL V    E A  +    +    +++ D+   +I  YF EC +FI + R   G  L+HC  G+SRS S+   +LMS   M+F +     + +R    PNPGF +QL  +
Sbjct:   68 IITPFLLLSSQDAAHDIDTLKKLKVTHVLNVAFGVENAFPELFTYKT---VSMLDLPETDITAYFPECFEFITQARQQDGVVLVHCNAGVSRSASVVIGFLMSELKMSFDEAFSVAKTSRPQIQPNPGFLQQLKTY 200          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Zebrafish
Match: dusp19b (dual specificity phosphatase 19b [Source:ZFIN;Acc:ZDB-GENE-040502-1])

HSP 1 Score: 78.9518 bits (193), Expect = 7.829e-17
Identity = 43/128 (33.59%), Postives = 65/128 (50.78%), Query Frame = 2
Query:  134 GSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNF 517
             S   A + D L+K  +THVL V    E A  +    +    +++ D+   +I  YF EC +FI + R   G  L+HC  G+SRS S+   +LMS   M+F +     + +R    PNPGF +QL  +
Sbjct:   78 ASQDAAHDIDTLKKLKVTHVLNVAFGVENAFPELFTYKT---VSMLDLPETDITAYFPECFEFITQARQQDGVVLVHCNAGVSRSASVVIGFLMSELKMSFDEAFSVAKTSRPQIQPNPGFLQQLKTY 202          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Xenopus
Match: ENSXETT00000045497.1 (dual specificity protein phosphatase 22-A [Source:NCBI gene;Acc:100485576])

HSP 1 Score: 132.494 bits (332), Expect = 1.747e-36
Identity = 63/167 (37.72%), Postives = 105/167 (62.87%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPD 592
            MGG M+KIV+G+Y+G+  ++ ++  L +  I H+++VHN ++   ++         I+ SD + +N+ ++F +C  FIHECRL GG CL+HC  G+SRS +I  AYLM+VT   + + L  V+  R +  PN GF++QL  +E T + E R  ++ ++G +PF + D
Sbjct:    1 MGGGMTKIVDGLYLGNIRDSEDKATLNRNGIRHIVSVHNNAKPLLQEMTYLC----ISASDSSSQNLIQHFKQCIKFIHECRLHGGGCLVHCLAGVSRSTTILVAYLMTVTNFGWDECLSAVRSVRSYVGPNFGFQQQLQEYEMTLVKEYRLWLRQEYGRNPFNDQD 163          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Xenopus
Match: smad6 (SMAD family member 6 [Source:Xenbase;Acc:XB-GENE-481307])

HSP 1 Score: 128.257 bits (321), Expect = 9.254e-35
Identity = 68/184 (36.96%), Postives = 113/184 (61.41%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPDLQEMKNNMENALNKDKQ 643
            MG  M+KI+  +++G++ +A + + L K NITH+L++H    ++ R   +   +  I  SD   +N+ ++F +   FIHECRL G  CL+HC  G+SRSV++  AY+M+VT   + D L  V+GAR  A+PN GF++QL +F +  + + R  +K  +GE+PF +      K++ +  L+K KQ
Sbjct:    1 MGNGMNKILPSLFIGNFKDARDVEQLHKNNITHILSIH----DSARPMLEGMKYLCIPASDSPSQNLIQHFKDSIAFIHECRLKGEGCLVHCLAGVSRSVTLVVAYVMTVTDFGWEDALSAVRGARTCANPNMGFQKQLEDFGKHDVYQFRTWLKETYGENPFND------KDDAKQLLDKHKQ 174          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Xenopus
Match: dusp19 (dual specificity phosphatase 19 [Source:NCBI gene;Acc:549071])

HSP 1 Score: 80.4925 bits (197), Expect = 3.861e-17
Identity = 43/132 (32.58%), Postives = 71/132 (53.79%), Query Frame = 2
Query:  125 VYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFE 520
            + +GS   A + D L+K+ +TH+L   N++            +K+++I D+   +I  +F EC +F+   +L  G  L+HC  G+SR+ +I   +LM    +NF      V+ AR  A PNPGF EQL  ++
Sbjct:   73 LLLGSQDVAQDLDVLKKYKVTHIL---NVAYGVDNAFPNEFTYKKMSILDLPETDIASFFPECFNFLENVKLQNGVVLVHCNAGVSRAPAIAIGFLMYDEKINFARAFSIVKNARPAACPNPGFMEQLHKYQ 201          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Xenopus
Match: eci1 (enoyl-CoA delta isomerase 1 [Source:Xenbase;Acc:XB-GENE-999272])

HSP 1 Score: 82.4185 bits (202), Expect = 6.126e-17
Identity = 53/140 (37.86%), Postives = 80/140 (57.14%), Query Frame = 2
Query:  110 KIVNGVYVGSYGNAANEDYLEKFNITHVLAV-HNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERT 526
            +I+  +Y+G   ++AN D L K+NI ++L V  NL      +H     +K+I ISD   +N++++F E   FI E R      L+HC  GISRSV++T AYLM    ++  D    V+  + + SPN  F  QL++FERT
Sbjct:  195 QILPYLYLGCAKDSANLDILAKYNIKYILNVTPNLPN--MFEHNGEFKYKQIPISDHWSQNLSQFFPEAISFIDEARSKNCGILVHCLAGISRSVTVTVAYLMQKLNLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERT 332          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Xenopus
Match: usp48 (ubiquitin specific peptidase 48 [Source:Xenbase;Acc:XB-GENE-5938602])

HSP 1 Score: 82.0333 bits (201), Expect = 8.978e-17
Identity = 53/143 (37.06%), Postives = 77/143 (53.85%), Query Frame = 2
Query:  110 KIVNGVYVGSYGNAANEDYLEKFNITHVLAV----HNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERT 526
            +I+  +Y+G   ++ N D LE+F I ++L V     NL E A     K      I ISD   +N++++F E   FI E R      L+HC  GISRSV++T AYLM    ++  D    V+  + + SPN  F  QL++FERT
Sbjct:  206 EILPYLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFRYKQ-----IPISDHWSQNLSQFFPEAISFIDEARGKSCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERT 343          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Mouse
Match: Dusp15 (dual specificity phosphatase-like 15 [Source:MGI Symbol;Acc:MGI:1934928])

HSP 1 Score: 140.198 bits (352), Expect = 3.512e-39
Identity = 69/172 (40.12%), Postives = 112/172 (65.12%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFL-EPDLQEM 604
            MG  M+K++ G+Y+G++ +A + D L +  ITH++++H    E+ +   +   + RI++SD     I K+F EC  FIH CRL+GGNCL+HC  GISRS +I  AY+M+VT + +++ L  ++ +R  A+PNPGFR+QL  F      + R++++ +FGE PF  E DL+ +
Sbjct:    1 MGNGMTKVLPGLYLGNFIDAKDPDQLGRNKITHIISIH----ESPQPLLQDITYLRISVSDTPEVPIKKHFKECVHFIHSCRLNGGNCLVHCFAGISRSTTIVIAYVMTVTGLGWQEVLEAIKASRPIANPNPGFRQQLEEFGWANSQKLRRQLEERFGEIPFRDEEDLRAL 168          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Mouse
Match: Dusp22 (dual specificity phosphatase 22 [Source:MGI Symbol;Acc:MGI:1915926])

HSP 1 Score: 130.183 bits (326), Expect = 5.319e-36
Identity = 63/173 (36.42%), Postives = 106/173 (61.27%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPDLQEMKN 610
            MG  MS+I+ G+Y+G++ +A + + L +  +TH+L+VH+ +        +   +  I  +D   +N+ ++F E   FIHECRL G +CL+HC  G+SRSV++  AY+M+VT   + D L  V+  R  A+PN GF+ QL  FE+  + + R+ ++ ++GE+P    D +E KN
Sbjct:    1 MGSGMSQILPGLYIGNFKDARDAEQLSRNKVTHILSVHDTARP----MLEGVKYLCIPAADTPSQNLTRHFKESIKFIHECRLQGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNLGFQRQLQEFEKHEVHQYRQWLREEYGENPL--RDAEEAKN 167          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Mouse
Match: Dusp22 (dual specificity phosphatase 22 [Source:MGI Symbol;Acc:MGI:1915926])

HSP 1 Score: 130.954 bits (328), Expect = 5.703e-36
Identity = 63/173 (36.42%), Postives = 106/173 (61.27%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPDLQEMKN 610
            MG  MS+I+ G+Y+G++ +A + + L +  +TH+L+VH+ +        +   +  I  +D   +N+ ++F E   FIHECRL G +CL+HC  G+SRSV++  AY+M+VT   + D L  V+  R  A+PN GF+ QL  FE+  + + R+ ++ ++GE+P    D +E KN
Sbjct:    1 MGSGMSQILPGLYIGNFKDARDAEQLSRNKVTHILSVHDTARP----MLEGVKYLCIPAADTPSQNLTRHFKESIKFIHECRLQGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNLGFQRQLQEFEKHEVHQYRQWLREEYGENPLR--DAEEAKN 167          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Mouse
Match: Dusp19 (dual specificity phosphatase 19 [Source:MGI Symbol;Acc:MGI:1915332])

HSP 1 Score: 83.1889 bits (204), Expect = 3.572e-18
Identity = 47/132 (35.61%), Postives = 67/132 (50.76%), Query Frame = 2
Query:  125 VYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFE 520
            + +GS   A + + L K  +TH+L V    E A       +    I+I D+   NI  YF EC +FI + +L  G  L+HC  G+SR+ +I   +LMS     F   L  V+ AR    PNPGF EQL  ++
Sbjct:   72 LLLGSQDAAHDLELLRKHKVTHILNVAYGVENAFLSEFTYKT---ISILDVPETNILSYFPECFEFIEQAKLKDGVVLVHCNAGVSRAAAIVIGFLMSSEEATFTTALSLVKEARPSICPNPGFMEQLRTYQ 200          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Mouse
Match: Dusp6 (dual specificity phosphatase 6 [Source:MGI Symbol;Acc:MGI:1914853])

HSP 1 Score: 82.4185 bits (202), Expect = 4.946e-17
Identity = 56/145 (38.62%), Postives = 80/145 (55.17%), Query Frame = 2
Query:  110 KIVNGVYVGSYGNAANEDYLEKFNITHVLAV----HNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNC--LIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERT 526
            +I+  +Y+G   ++ N D LE+F I ++L V     NL E A     K      I ISD   +N++++F E   FI E R  G NC  L+HC  GISRSV++T AYLM    ++  D    V+  + + SPN  F  QL++FERT
Sbjct:  209 EILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYKQ-----IPISDHWSQNLSQFFPEAISFIDEAR--GKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERT 346          
BLAST of Dual specificity protein phosphatase 22 vs. UniProt/SwissProt
Match: sp|Q8R4V2|DUS15_MOUSE (Dual specificity protein phosphatase 15 OS=Mus musculus OX=10090 GN=Dusp15 PE=1 SV=3)

HSP 1 Score: 140.198 bits (352), Expect = 2.457e-38
Identity = 69/172 (40.12%), Postives = 112/172 (65.12%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFL-EPDLQEM 604
            MG  M+K++ G+Y+G++ +A + D L +  ITH++++H    E+ +   +   + RI++SD     I K+F EC  FIH CRL+GGNCL+HC  GISRS +I  AY+M+VT + +++ L  ++ +R  A+PNPGFR+QL  F      + R++++ +FGE PF  E DL+ +
Sbjct:    1 MGNGMTKVLPGLYLGNFIDAKDPDQLGRNKITHIISIH----ESPQPLLQDITYLRISVSDTPEVPIKKHFKECVHFIHSCRLNGGNCLVHCFAGISRSTTIVIAYVMTVTGLGWQEVLEAIKASRPIANPNPGFRQQLEEFGWANSQKLRRQLEERFGEIPFRDEEDLRAL 168          
BLAST of Dual specificity protein phosphatase 22 vs. UniProt/SwissProt
Match: sp|B4F7B7|DUS15_RAT (Dual specificity protein phosphatase 15 OS=Rattus norvegicus OX=10116 GN=Dusp15 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 5.630e-38
Identity = 68/172 (39.53%), Postives = 112/172 (65.12%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFL-EPDLQEM 604
            MG  M+K++ G+Y+G++ +A + D L +  ITH++++H    E+ +   +   + RI++SD     I K+F EC  FIH CRL+GGNCL+HC  GISRS ++  AY+M+VT + +++ L  ++ +R  A+PNPGFR+QL  F      + R++++ +FGE PF  E DL+ +
Sbjct:    1 MGNGMTKVLPGLYLGNFIDAKDPDQLGRNKITHIVSIH----ESPQPLLQDITYLRISVSDTPEVPIKKHFKECVHFIHSCRLNGGNCLVHCFAGISRSTTVVIAYVMTVTGLGWQEVLEAIKASRPIANPNPGFRQQLEEFGWANSQKLRRQLEERFGEIPFRDEEDLRAL 168          
BLAST of Dual specificity protein phosphatase 22 vs. UniProt/SwissProt
Match: sp|Q9NRW4|DUS22_HUMAN (Dual specificity protein phosphatase 22 OS=Homo sapiens OX=9606 GN=DUSP22 PE=1 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 5.796e-36
Identity = 67/173 (38.73%), Postives = 107/173 (61.85%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPDLQEMKN 610
            MG  M+KI+ G+Y+G++ +A + + L K  +TH+L+VH+    + R   +   +  I  +D   +N+ ++F E   FIHECRL G +CL+HC  G+SRSV++  AY+M+VT   + D L  V+  R  A+PN GF+ QL  FE+  + + R+ +K ++GESP    D +E KN
Sbjct:    1 MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHD----SARPMLEGVKYLCIPAADSPSQNLTRHFKESIKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEKHEVHQYRQWLKEEYGESPL--QDAEEAKN 167          
BLAST of Dual specificity protein phosphatase 22 vs. UniProt/SwissProt
Match: sp|Q99N11|DUS22_MOUSE (Dual specificity protein phosphatase 22 OS=Mus musculus OX=10090 GN=Dusp22 PE=1 SV=1)

HSP 1 Score: 130.183 bits (326), Expect = 3.720e-35
Identity = 63/173 (36.42%), Postives = 106/173 (61.27%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPDLQEMKN 610
            MG  MS+I+ G+Y+G++ +A + + L +  +TH+L+VH+ +        +   +  I  +D   +N+ ++F E   FIHECRL G +CL+HC  G+SRSV++  AY+M+VT   + D L  V+  R  A+PN GF+ QL  FE+  + + R+ ++ ++GE+P    D +E KN
Sbjct:    1 MGSGMSQILPGLYIGNFKDARDAEQLSRNKVTHILSVHDTARP----MLEGVKYLCIPAADTPSQNLTRHFKESIKFIHECRLQGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNLGFQRQLQEFEKHEVHQYRQWLREEYGENPL--RDAEEAKN 167          
BLAST of Dual specificity protein phosphatase 22 vs. UniProt/SwissProt
Match: sp|Q6GQJ8|DUS22_XENLA (Dual specificity protein phosphatase 22 OS=Xenopus laevis OX=8355 GN=dusp22 PE=2 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 1.249e-34
Identity = 69/184 (37.50%), Postives = 113/184 (61.41%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPDLQEMKNNMENALNKDKQ 643
            MG  M+KI+ G+++G++ +A + + L K NITH+L++H    ++ R   +   +  I  SD   +N+ ++F +   FIHECRL G  CL+HC  G+SRSV++  AY+M+VT   + D+L  V+GAR  A+PN GF++QL +F +  +   R  +K+ +GES F +      K+  +  L+K KQ
Sbjct:    1 MGNGMNKILTGLFLGNFKDARDVEQLHKNNITHILSIH----DSARPMLEGMKYLCIPASDSPSQNLIQHFKDSIAFIHECRLKGEGCLVHCLAGVSRSVTLVVAYVMTVTDFGWEDSLSAVRGARTCANPNMGFQKQLEDFGKCEVHHFRTWLKDTYGESTFHD------KDEAKQLLDKHKQ 174          
BLAST of Dual specificity protein phosphatase 22 vs. TrEMBL
Match: A0A1S3H255 (dual specificity protein phosphatase 22-B-like OS=Lingula unguis OX=7574 GN=LOC106151484 PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 9.891e-42
Identity = 74/163 (45.40%), Postives = 115/163 (70.55%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPF 580
            MG  M+KIV G+YVG+  +A +   L+  NITH+L++H+++++        + +  I  SD   ++++++F +CN+FIH  RLSGG+ L+HC  G+SRSV++T AYLM+VT + +RDTL  V+GARQ A+PN GF+ QL N+E   L +ERK +K++F E+PF
Sbjct:    1 MGNGMNKIVEGLYVGNIRDAQDRKRLDSNNITHILSIHDMAKK----LHDDKEYLCIKASDNAAQDLSQFFRQCNEFIHAARLSGGSVLVHCLAGVSRSVTVTVAYLMTVTNLGWRDTLKAVRGARQCANPNFGFQRQLGNYEEEQLEQERKWLKSQFPENPF 159          
BLAST of Dual specificity protein phosphatase 22 vs. TrEMBL
Match: A0A210PT61 (Dual specificity protein phosphatase 22 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT13551 PE=3 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 1.798e-41
Identity = 69/163 (42.33%), Postives = 110/163 (67.48%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPF 580
            MG  M+KI+ G+YVG++ ++ + + LEK+ ITH+L++H+ +++     +       I  SD   + + K+F +C DFIHE RL GGN ++HC  G+SRSV++T AY+M+VT++ +RD +  ++GAR  A+PN GF+ QL  FE   + +ERKRIK K+  SP+
Sbjct:    1 MGNGMNKIIPGLYVGNFRDSKDPEQLEKYKITHILSIHDNAKKILEDKEYLC----IVASDTPEQTLTKFFPQCIDFIHEARLKGGNVIVHCIAGVSRSVTVTAAYIMTVTSLGWRDAVNAIRGARSCANPNFGFQRQLQQFESDLVEKERKRIKEKYDPSPY 159          
BLAST of Dual specificity protein phosphatase 22 vs. TrEMBL
Match: A0A0C9R0F2 (DUSP22_2 protein OS=Fopius arisanus OX=64838 GN=DUSP22_2 PE=3 SV=1)

HSP 1 Score: 150.214 bits (378), Expect = 4.303e-40
Identity = 74/177 (41.81%), Postives = 114/177 (64.41%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPDLQEMKNNMEN 622
            MG  M+K++ G+YVG+Y ++ +E  L++F ITH+LA+H    +A R+    + +  I  +D   +N+ +YFS CNDFIH  RL GGN LIHC  G+SRSV++  AY+MS+T +++++ L  V+  R  A+PN GF++QL +FE T L EERKR+K +F        D +  +  + N
Sbjct:    1 MGNGMNKVLPGLYVGNYRDSKDEAQLKEFEITHILAIH----DAARRLHSDKHYLCILAADTPDQNLTQYFSLCNDFIHAARLRGGNVLIHCLAGMSRSVTVAVAYIMSITNLSWKEALKVVRVGRTVANPNVGFQQQLQDFEATRLQEERKRLKERFPSLALTASDAEACRATLRN 173          
BLAST of Dual specificity protein phosphatase 22 vs. TrEMBL
Match: L7MME5 (Putative dual specificity protein phosphatase 22 (Fragment) OS=Rhipicephalus pulchellus OX=72859 PE=2 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 2.232e-39
Identity = 73/172 (42.44%), Postives = 116/172 (67.44%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPDLQEMK 607
            MG  M+K++ GVY+G++ ++ + + L+  NITH++++H+ + +      + + +  I  SD   +N++++FS+ NDFIH  R+ GGN LIHC  G+SRSV+I  AY+MSVT++N+R+ L  V+GAR  A+PN GF++QL  +E   L EERKR++ KF    F E D QE +
Sbjct:    1 MGNGMNKVLPGVYIGNFRDSKDPEQLQANNITHIISIHDTARK----LHEDKEYLCIQASDTPGQNLSQFFSQSNDFIHHARMEGGNVLIHCLAGVSRSVTIAVAYVMSVTSLNWREALKAVRGARSIANPNFGFQKQLHEYECKKLHEERKRLRQKFPRESFCE-DEQECR 167          
BLAST of Dual specificity protein phosphatase 22 vs. TrEMBL
Match: R7UA30 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_162057 PE=3 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 2.242e-39
Identity = 71/170 (41.76%), Postives = 116/170 (68.24%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPDLQE 601
            MG  M+K++ G+Y+G++ +A +++ L++  ITH+LA+H+ ++ A            I+ SD + + + +YFS+ NDFIH  RL+GG+ L+HC  G+SRSV+IT AY+M+VT + +RD L  V+GAR+ A+PN GF+ QL+ F+   L +E++R+   FG  PF E DL++
Sbjct:    1 MGNGMNKVLPGLYLGNFRDARDQNQLKENGITHILAIHDNAKPALPDRVYLC----ISASDTSNQELRQYFSQTNDFIHRARLNGGSVLVHCLAGVSRSVTITTAYIMTVTGLGWRDALNAVRGARRCANPNFGFQRQLLAFQHEGLDKEKQRLIEAFGAIPFRERDLEQ 166          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Cavefish
Match: dusp22a (dual specificity protein phosphatase 22-A [Source:NCBI gene;Acc:103030962])

HSP 1 Score: 115.546 bits (288), Expect = 3.229e-30
Identity = 61/167 (36.53%), Postives = 100/167 (59.88%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPD 592
            MG  M+K+++G+Y+G+  ++ N + L +  ITH+L+V+N ++              I  +D + +N+ ++F EC  FIHECRL+GG CL+HC  G+SRS ++  AYLM+VT   + D L  V+  R    PN GF++QL  ++ T +SE R  ++  +  S F + D
Sbjct:    1 MGNGMNKVIDGLYLGNVRDSENRESLSQKGITHILSVYNNAKPVLEDMTYLC----IHAADASNQNLLQHFKECIRFIHECRLNGGACLVHCLAGVSRSTTMVVAYLMTVTNYGWEDCLSAVKAVRSFVGPNYGFQQQLQQYQMTQVSEYRTWLRMTYRSSTFRDQD 163          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Cavefish
Match: dusp22b (dual specificity protein phosphatase 22-B-like [Source:NCBI gene;Acc:103046428])

HSP 1 Score: 114.39 bits (285), Expect = 5.334e-30
Identity = 53/157 (33.76%), Postives = 95/157 (60.51%), Query Frame = 2
Query:  110 KIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPF 580
            +++  +Y+G++ +A + + L + NITH+L++H+ +        +   +  I  +D+  +N+ ++F E   F+HE RL G  CL+HC  G+SRSV++  AY+M+VT + ++D L  V+  R  A PN GF++QL  F+ T   E R  ++ ++ E PF
Sbjct:   11 QVLPDLYLGNFKDARDREQLARNNITHILSIHDTAAP----ILQEMTYLCIPAADLPTQNLTQHFKESIMFMHESRLKGEGCLVHCLAGVSRSVTLVVAYIMTVTGLGWQDALAAVRAVRPCAGPNMGFQKQLEEFQNTQAQEFRDWLRMEYKECPF 163          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Cavefish
Match: dusp19b (dual specificity protein phosphatase 19 [Source:NCBI gene;Acc:103043145])

HSP 1 Score: 82.0333 bits (201), Expect = 5.220e-18
Identity = 47/125 (37.60%), Postives = 66/125 (52.80%), Query Frame = 2
Query:  137 SYGNAANE-DYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQL 508
            S  +AAN+ + L+KF +TH+L V    E A       +    IT+ D+    +  YF +C +FI + R   G  LIHC  G+SRS S+   YLMS   + F +    V+ AR +  PNPGF  QL
Sbjct:   72 SSQDAANDLETLQKFKVTHILNVAYGVENAFPDLFTYKT---ITMLDLPETQLTSYFPQCFEFIAQAREQDGVVLIHCNAGVSRSASVAIGYLMSREKIPFEEAFNRVKSARPYIQPNPGFLIQL 193          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Cavefish
Match: styx (serine/threonine/tyrosine interacting protein [Source:NCBI gene;Acc:103045482])

HSP 1 Score: 82.0333 bits (201), Expect = 8.820e-18
Identity = 51/152 (33.55%), Postives = 75/152 (49.34%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDY--LEKFNITHVLAVHNLSEE--AXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLS 535
            M  +M +I+ G+++G Y  A       LEK  ITH++ V    E             +  + I+D  +ENI ++F    +FI  C  SGG  L+H   GISRS ++  AYLM    + +RD    VQ  R   +PN GF  QL  +E  +L+
Sbjct:   26 MRREMQEILPGLFLGPYSAAMKSKLSMLEKQGITHIVCVRQDIEANFIKPNFPLKFRYLVLDIADNPVENIIRHFPVTKEFIDGCLESGGKVLVHGNAGISRSAALVIAYLMETFGVKYRDAFSHVQERRFCINPNVGFVHQLQEYEAIYLA 177          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Cavefish
Match: dusp6 (dual specificity phosphatase 6 [Source:NCBI gene;Acc:103030496])

HSP 1 Score: 82.8037 bits (203), Expect = 3.686e-17
Identity = 53/143 (37.06%), Postives = 77/143 (53.85%), Query Frame = 2
Query:  110 KIVNGVYVGSYGNAANEDYLEKFNITHVLAV----HNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERT 526
            +I+  +Y+G   ++ N D LE+F I ++L V     NL E A     K      I ISD   +N++++F E   FI E R      L+HC  GISRSV++T AYLM    ++  D    V+  + + SPN  F  QL++FERT
Sbjct:  208 EILPHLYLGCAKDSTNLDILEEFGIKYILNVTPNLPNLFENAGEFKYKQ-----IPISDHWSQNLSQFFPEAISFIDEARGQKCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERT 345          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Sea Lamprey
Match: dusp22b (dual specificity phosphatase 22b [Source:NCBI gene;Acc:100002272])

HSP 1 Score: 117.472 bits (293), Expect = 1.854e-32
Identity = 53/145 (36.55%), Postives = 93/145 (64.14%), Query Frame = 2
Query:  104 MSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSE 538
            +S ++ G+Y+G+  ++A+   L   NITH+L+VH+ + EA  +         I +SD   +N+ ++F +C  FIH+CR+    CL+HC  G+SRSV++  AY+M+VT++ + + ++ V+ AR  A+PN GF++QL  F+   L+E
Sbjct:    5 ISDVLEGLYLGNIKDSADLKQLRDHNITHILSVHDAAREALEEMTYLC----IQVSDTPSQNLTQHFKDCIQFIHKCRMEKKGCLVHCLAGVSRSVTMVVAYIMTVTSLGWEEAMVAVKTARTCANPNLGFQQQLQMFQNEQLAE 145          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006071.1 (pep scaffold:Pmarinus_7.0:GL479824:161791:175185:-1 gene:ENSPMAG00000005490.1 transcript:ENSPMAT00000006071.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 3.875e-16
Identity = 38/94 (40.43%), Postives = 49/94 (52.13%), Query Frame = 2
Query:  272 DINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRI 553
            D + +N+ +YF E  +FI +    G   L+HCQ G+SRS +I  AYLM  T M   D    V+G R   SPN  F  QL+ FE    S    RI
Sbjct:   41 DSDKQNLRQYFEEAFEFIEDAHRRGQGLLVHCQAGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDLNSGVTPRI 134          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Sea Lamprey
Match: dusp19b (dual specificity phosphatase 19b [Source:ZFIN;Acc:ZDB-GENE-040502-1])

HSP 1 Score: 71.2478 bits (173), Expect = 1.248e-15
Identity = 32/86 (37.21%), Postives = 47/86 (54.65%), Query Frame = 2
Query:  260 ITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNF 517
            +T+ D+    +  YF EC DFI      GG  L+HC  G+SR+ S+   YL+    ++F+D    V+ AR  A PN GF +QL  +
Sbjct:   25 VTMLDVPDTKLTNYFPECFDFISRAHKQGGVVLVHCNAGVSRAASVIIGYLIQEDGLSFQDAFSLVKRARPAAHPNSGFMQQLSEY 110          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Sea Lamprey
Match: dusp28 (dual specificity phosphatase 28 [Source:ZFIN;Acc:ZDB-GENE-131127-257])

HSP 1 Score: 72.0182 bits (175), Expect = 2.099e-15
Identity = 44/143 (30.77%), Postives = 74/143 (51.75%), Query Frame = 2
Query:  104 MSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNL----SEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFE 520
            ++ +   +++ +  +A   D L+   IT ++ V  L     E A  + +  RV  R+ + D   E++  + + C D I E R+ GG  L++C+ G SRSV++  AYLM    ++ R     V+  R  ASPN GF  QL+ +E
Sbjct:   15 LNAVTEWLFISNARSACCPDLLDAAGITLLINVSRLQPFPPEPAPGQGQGQRVCIRVPVFDEPSESLGPHLTPCADAIEEERVRGGRTLVYCKHGRSRSVAVVTAYLMRHGELSLRSAFQKVKSVRPSASPNEGFWRQLLQYE 157          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Sea Lamprey
Match: dusp4 (dual specificity phosphatase 4 [Source:ZFIN;Acc:ZDB-GENE-040426-709])

HSP 1 Score: 72.4034 bits (176), Expect = 1.705e-14
Identity = 45/141 (31.91%), Postives = 69/141 (48.94%), Query Frame = 2
Query:   98 GDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFE 520
            G   +I+  +Y+GS  +A+  + L+   IT +L   N+S +     +    +K I + D +  +I  +F E  DFI   R  GG   +HC  G+SRS +I  AYLM    +   +    V+  R   SPN  F  QL +FE
Sbjct:  193 GGPVEILPFLYLGSAYHASRRELLDAIGITALL---NVSADLPNHFEGLFTYKSIPVEDNHKADIGAWFLEAIDFIDSTRRGGGRVFVHCHAGVSRSATICLAYLMKTRRLRLDEAFEFVRQRRSVISPNFNFLGQLQSFE 330          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Yeast
Match: YVH1 (Dual specificity protein phosphatase; regulates growth, sporulation, and glycogen accumulation in a cAMP-dependent protein kinase cascade dependent manner; mutants are defective in 60S ribosome assembly; positively regulates pre-autophagosomal structure (PAS) formation upon nitrogen starvation or rapamycin treatment [Source:SGD;Acc:S000001465])

HSP 1 Score: 69.3218 bits (168), Expect = 1.086e-13
Identity = 46/159 (28.93%), Postives = 73/159 (45.91%), Query Frame = 2
Query:  101 DMSKIVNGVYVGSYGNAANEDYL-EKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHEC-----------------RLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFER 523
            ++++I+ G+Y+G      +   L  +FNITH+L+V           +K    K I I D ++ ++ +YF E N FI +C                 +   G    HCQ G+SRSV+   AYLM    ++    +  V+  +    PN  F EQL  FE+
Sbjct:   11 EVTRILGGIYLGGIRPIIDHRPLGAEFNITHILSVIKFQVIPEYLIRKGYTLKNIPIDDDDVTDVLQYFDETNRFIDQCLFPNEVEYSPRLVDFKKKPQRGAVFAHCQAGLSRSVTFIVAYLMYRYGLSLSMAMHAVKRKKPSVEPNENFMEQLHLFEK 169          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Yeast
Match: MSG5 (Dual-specificity protein phosphatase; exists in 2 isoforms; required for maintenance of a low level of signaling through the cell integrity pathway, adaptive response to pheromone; regulates and is regulated by Slt2p; dephosphorylates Fus3p; MSG5 has a paralog, SDP1, that arose from the whole genome duplication [Source:SGD;Acc:S000004998])

HSP 1 Score: 51.9878 bits (123), Expect = 7.728e-8
Identity = 26/76 (34.21%), Postives = 37/76 (48.68%), Query Frame = 2
Query:  290 INKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNF 517
            I K  S     IH     G   L+HCQ G+SRS S+  AY+M    ++  D    ++G  +  SPN G   QL+ +
Sbjct:  294 IVKDLSRLTRIIHTAHSQGKKILVHCQCGVSRSASLIVAYIMRYYGLSLNDAYNKLKGVAKDISPNMGLIFQLMEW 369          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Nematostella
Match: EDO34920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN01])

HSP 1 Score: 110.923 bits (276), Expect = 1.137e-29
Identity = 56/153 (36.60%), Postives = 94/153 (61.44%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHN----LSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSE 538
            MG  M+KI+ G+Y+G+  ++ + + L++ NITH+L++H+    L E+   K         I  +D   +++  +F EC +FIH CR+   NCL+HC  GISRS +I  AY+M++T +++R TL  ++  R  A+PN GF+ QL +F    L++
Sbjct:    1 MGNGMNKIIPGLYLGNIRDSKDAEQLQEHNITHILSIHDNANPLREDIMYKC--------IHAADSPDQDLMPFFQECIEFIHSCRVKEMNCLVHCIAGISRSTTICAAYIMTITELSWRQTLQAIRANRSIANPNYGFKRQLQDFYNKHLTK 145          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Nematostella
Match: EDO33587 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRS7])

HSP 1 Score: 86.6557 bits (213), Expect = 6.829e-20
Identity = 47/159 (29.56%), Postives = 84/159 (52.83%), Query Frame = 2
Query:  101 DMSKIVNGVYVGSYGNAANE--DYLEKFNITHVLAVHNLSEE--AXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLS--EERKRIKN 559
            +M +IV G+++G Y  A     ++L+   ITH++ +    E            ++  + ++D   ENI +YF +   F+ +C   GG  L+H   GISRS ++  AY+M    + +R+  L VQ  R   +PN GF +QL+ +E  +L+  + +++I N
Sbjct:   33 EMQEIVPGIFLGPYSAAMKSKLEHLKSQGITHIVCIRQNIEANFVKPNFPNDFLYLVLDVADTTTENIIRYFPQVKAFVDDCVSKGGKVLVHGNAGISRSAALMIAYIMETYGLAYREAFLFVQQRRFCINPNEGFTQQLMEYEPIYLANYQAKQQIAN 191          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Nematostella
Match: EDO37675 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF21])

HSP 1 Score: 82.8037 bits (203), Expect = 8.898e-18
Identity = 49/138 (35.51%), Postives = 76/138 (55.07%), Query Frame = 2
Query:  107 SKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFE 520
            SKI + VY+GS  NA+N + L++  + +VL   N+++E       T  +  I + D+   N+  Y+ E   FI++ R  G   L+HC+ GISRS S   AY M     +  DT+  V+  RQ  +PN GF +QL+ +E
Sbjct:  224 SKIYDHVYLGSEWNASNLEELKENGVEYVL---NITKEIDNFFAGTFTYFNIRLWDLEDSNLLPYWDETFKFINQARDKGSKVLVHCKRGISRSASTVIAYGMKEYGTSLNDTMKHVKSRRQCVNPNQGFWKQLITYE 358          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Nematostella
Match: EDO45432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTA2])

HSP 1 Score: 81.6481 bits (200), Expect = 1.955e-17
Identity = 50/142 (35.21%), Postives = 80/142 (56.34%), Query Frame = 2
Query:  101 DMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERT 526
            ++++I+  +Y+GS  +A+N + L K  I++VL V +        H +   +K + + D  M N+ + F E   FI E R    N L+HC  GISRSV+IT AYLMS   ++  +    V+  + + SPN  F  QL++FER+
Sbjct:  185 ELAEILPRLYLGSEKDASNIELLRKHKISYVLNVTH-DRPNTFAHIEGFKYKNLPVEDNLMANLTELFPEAFAFIDEGRQKSSNVLVHCLAGISRSVTITIAYLMSSQHLSLNEAYDFVKARKSNVSPNFNFMGQLLDFERS 325          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Nematostella
Match: EDO47156 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMT6])

HSP 1 Score: 76.6406 bits (187), Expect = 1.239e-16
Identity = 51/159 (32.08%), Postives = 78/159 (49.06%), Query Frame = 2
Query:  104 MSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEER-KRIKNKFGESP 577
            M++I   +++ S   A +E  L +  IT V+   N + EA  +  K   H RI ++D     I  +F   +D I   R  GG  L+HC  G+SRS S+  AYLM    +N RD    VQ  R    PN GF ++L+++E+    +   + +  K G  P
Sbjct:   19 MARITEWLFLSSCQVARDEKLLLEKGITLVI---NATIEAPEQDYKKVKHIRIKVNDNPGNKIGIFFDMVSDKIESVRRVGGKVLVHCIAGVSRSASLVIAYLMKYQRLNLRDAHKLVQDKRPLIRPNTGFWKELIDYEKKLFGKNSVQMVDTKLGPVP 174          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Medaka
Match: ENSORLT00000015946.2 (dual specificity phosphatase 22 [Source:NCBI gene;Acc:101161478])

HSP 1 Score: 122.479 bits (306), Expect = 6.377e-33
Identity = 63/163 (38.65%), Postives = 95/163 (58.28%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPF 580
            MG  ++KI+  +Y+G+  +A + + L + NITH+L+VH+ +               I+ SD + +N+ +YF +   FIHE RL G  CL+HC  G+SRSV++  AY+M+VT   + + L  V+ AR  A PN GF  QL  FE T L+E R   K K+G+  F
Sbjct:    1 MGNGINKILPDLYLGNMRDARDPELLAQHNITHILSVHDTAAPVLEGVTYLC----ISASDHSKQNLTQYFRDSIVFIHESRLKGEGCLVHCVAGVSRSVTLVVAYIMTVTDCGWVEALAAVRSARPCAGPNLGFLRQLEEFENTQLAEYRAWWKEKYGQKSF 159          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Medaka
Match: dusp22a (dual specificity protein phosphatase 22-A [Source:NCBI gene;Acc:101160226])

HSP 1 Score: 116.316 bits (290), Expect = 6.480e-31
Identity = 59/149 (39.60%), Postives = 87/149 (58.39%), Query Frame = 2
Query:  146 NAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPD 592
            +A   + L + +ITH+L+V+N  +      K       I   D + +N+ ++F EC  FIHECRL+GG CL+HC  G SRS ++  AYLM+VT   + D L  V+  R    PNPGFR+QL  ++ T +SE R  +++ F  SPF + D
Sbjct:   25 DAETRESLSENSITHILSVYNNPQPVFEDKKYLC----IHAVDASSQNLIQHFKECIGFIHECRLTGGACLVHCLAGASRSTTMVVAYLMTVTHYTWEDCLSAVKSVRSFVDPNPGFRDQLQEYQETRVSEYRAWLESSFLSSPFKDSD 169          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Medaka
Match: dusp22b (dual specificity protein phosphatase 22-B [Source:NCBI gene;Acc:101167990])

HSP 1 Score: 116.316 bits (290), Expect = 1.535e-30
Identity = 55/163 (33.74%), Postives = 99/163 (60.74%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPF 580
            MG  ++K++  +Y+G++ +A + + L + NITH+L++H+    +     +   +  I  SD+  +N+ ++F E   FIHE RL G  CL+HC  G+SRSV++  AY+M+VT++ + + L  V+  R  A PN  F+ QL  FE T   + R+ ++ ++ ++PF
Sbjct:   31 MGNGINKVLPDLYLGNFKDARDGEALARNNITHILSIHD----SAAPILQEMTYLCIIASDLVTQNLTQHFKESIMFIHESRLKGEGCLVHCLAGVSRSVTLVVAYIMTVTSLGWEEALAAVRVVRPCACPNLSFQRQLQEFEATQAEQFREWLQKEYKDNPF 189          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Medaka
Match: ENSORLT00000038987.1 (dual specificity phosphatase 22 [Source:NCBI gene;Acc:101161478])

HSP 1 Score: 111.694 bits (278), Expect = 5.226e-29
Identity = 58/149 (38.93%), Postives = 88/149 (59.06%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSE 538
            MG  ++KI+  +Y+G+  +A + + L + NITH+L+VH+ +               I+ SD + +N+ +YF +   FIHE RL G  CL+HC  G+SRSV++  AY+M+VT   + + L  V+ AR  A PN GF  QL  FE T L+E
Sbjct:    1 MGNGINKILPDLYLGNMRDARDPELLAQHNITHILSVHDTAAPVLEGVTYLC----ISASDHSKQNLTQYFRDSIVFIHESRLKGEGCLVHCVAGVSRSVTLVVAYIMTVTDCGWVEALAAVRSARPCAGPNLGFLRQLEEFENTQLAE 145          
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Medaka
Match: dusp22b (dual specificity protein phosphatase 22-B [Source:NCBI gene;Acc:101167990])

HSP 1 Score: 106.301 bits (264), Expect = 6.909e-27
Identity = 52/145 (35.86%), Postives = 88/145 (60.69%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERT 526
            MG  ++K++  +Y+G++ +A + + L + NITH+L++H+    +     +   +  I  SD+  +N+ ++F E   FIHE RL G  CL+HC  G+SRSV++  AY+M+VT++ + + L  V+  R  A PN  F+ QL  FE T
Sbjct:   31 MGNGINKVLPDLYLGNFKDARDGEALARNNITHILSIHD----SAAPILQEMTYLCIIASDLVTQNLTQHFKESIMFIHESRLKGEGCLVHCLAGVSRSVTLVVAYIMTVTSLGWEEALAAVRVVRPCACPNLSFQRQLQEFEAT 171          
BLAST of Dual specificity protein phosphatase 22 vs. Planmine SMEST
Match: SMESG000036587.1 (SMESG000036587.1)

HSP 1 Score: 413.305 bits (1061), Expect = 1.134e-146
Identity = 210/210 (100.00%), Postives = 210/210 (100.00%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPDLQEMKNNMENALNKDKQPIMNKTVNTMDRLKDMLQDRRDPSSG 721
            MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAHRKHKKTRVHKRITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPDLQEMKNNMENALNKDKQPIMNKTVNTMDRLKDMLQDRRDPSSG
Sbjct:    1 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAHRKHKKTRVHKRITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPDLQEMKNNMENALNKDKQPIMNKTVNTMDRLKDMLQDRRDPSSG 210          
BLAST of Dual specificity protein phosphatase 22 vs. Planmine SMEST
Match: SMESG000008792.1 (SMESG000008792.1)

HSP 1 Score: 117.472 bits (293), Expect = 4.802e-30
Identity = 67/167 (40.12%), Postives = 95/167 (56.89%), Query Frame = 2
Query:   92 MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESPFLEPD 592
            MG +MSKI+ G+Y+G   NA N++ +    ITHVL+VH    +  +K       + I + D     I+KYF + NDFIH CR+  GN LIHC  G+SR+ +I  AYLM+V  ++F D    ++  R +  P   F +QL +FE   +  ERKR+ N FG    LE D
Sbjct:    1 MGKEMSKILPGLYLGRLDNAQNDNDMMANCITHVLSVHEPVNQKLQKINSCEYLE-INVKDEETACISKYFGKSNDFIHSCRIKNGNVLIHCLAGVSRAPTIVLAYLMTVYELSFHDAFNCLKAVRPNIKPIATFVKQLNDFETNEVIMERKRLFNTFGPYNNLEDD 166          
BLAST of Dual specificity protein phosphatase 22 vs. Planmine SMEST
Match: SMESG000070817.1 (SMESG000070817.1)

HSP 1 Score: 90.8929 bits (224), Expect = 1.005e-19
Identity = 67/201 (33.33%), Postives = 103/201 (51.24%), Query Frame = 2
Query:   89 IMGGDM---SKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKRIKNKFGESP--------FLEPDLQEMKNNME-NALNKDKQPIMN 655
            I+ G M   S+I+  +Y+GS  NA+N + L K  ITH+L   N++ E+    +    ++ I + D     + K+F  C+ FI + ++  G CL+HCQ GISRS SI  +Y+M    M F   L  V+G R    PN GF +QL  +E   L     R  +KF            F + DL + +N+M+ ++L+ D Q   N
Sbjct:  297 IIYGKMDEPSQILPYLYLGSTYNASNFEELVKNKITHIL---NVTRESENFFRDQFEYENILVFDNEDTKLLKHFDLCHKFITQAKIINGVCLVHCQRGISRSASIVISYIMKEFNMTFEKALEFVKGKRDCIKPNDGFMQQLKTYEGI-LQASSNRHNSKFQADKRKTYDGNEFADRDLVDTQNDMKRSSLSNDYQSRTN 493          
BLAST of Dual specificity protein phosphatase 22 vs. Planmine SMEST
Match: SMESG000035381.1 (SMESG000035381.1)

HSP 1 Score: 75.8702 bits (185), Expect = 4.984e-15
Identity = 53/149 (35.57%), Postives = 80/149 (53.69%), Query Frame = 2
Query:  107 SKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMS-VTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEERKR 550
            S I+  +Y+G+  +A N  +L    ITHVL   N++ +A    +     KRI  +D N++++ ++F +   FI   R S G  L+HCQ GISRS +I  AYLMS  + ++  +    V+  R   SPN  F  QLV FE   ++   KR
Sbjct:  215 SLILPFLYLGNELDALNSTFLTNNKITHVL---NVTIKASFLDEIKFKSKRINCNDNNVQDLIQFFPDAFKFIELARKSNGRILVHCQAGISRSATIVIAYLMSHCSNLDLNNAHQWVKRRRTIISPNFNFMGQLVQFENDLINGTFKR 360          
BLAST of Dual specificity protein phosphatase 22 vs. Planmine SMEST
Match: SMESG000001338.1 (SMESG000001338.1)

HSP 1 Score: 71.633 bits (174), Expect = 5.673e-14
Identity = 47/139 (33.81%), Postives = 73/139 (52.52%), Query Frame = 2
Query:  104 MSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAXXXXXXXXXXXXITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSVSITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFE 520
            M KI + +++G Y +A N D L K NITH+L VH L    +       +    T SD  ++ +++ F E N+FI +   SGG  LIHCQ G++RS ++  A++MS+     ++    V+  R    P   F  QL  +E
Sbjct:    1 MDKIFDRLFLGGYDDATNSDILMKNNITHILTVHELKLSRNYHKGFQYMFVE-TKSDQEIDLLSR-FVETNEFIEKGMNSGG-VLIHCQFGMARSATLVIAFIMSLQKTTVQEAFDFVKRKRNIICPTDSFMYQLRLYE 136          
The following BLAST results are available for this feature:
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DUSP151.646e-4042.42dual specificity phosphatase 15 [Source:HGNC Symbo... [more]
DUSP152.494e-3741.77dual specificity phosphatase 15 [Source:HGNC Symbo... [more]
DUSP221.207e-3638.73dual specificity phosphatase 22 [Source:HGNC Symbo... [more]
DUSP221.537e-3638.73dual specificity phosphatase 22 [Source:HGNC Symbo... [more]
DUSP151.268e-3140.97dual specificity phosphatase 15 [Source:HGNC Symbo... [more]
back to top
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lip-11.908e-1534.51Dual specificity protein phosphatase lip-1 [Sourc... [more]
lip-12.610e-1534.51Dual specificity protein phosphatase lip-1 [Sourc... [more]
F13D11.32.647e-1426.43pep chromosome:WBcel235:X:5804379:5805922:-1 gene:... [more]
vhp-16.011e-1429.05Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
vhp-16.011e-1429.05Tyrosine-protein phosphatase vhp-1 [Source:UniPro... [more]
back to top
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG100893.795e-3438.98gene:FBgn0036369 transcript:FBtr0075821[more]
CG100893.795e-3438.98gene:FBgn0036369 transcript:FBtr0075822[more]
CG100894.202e-3338.42gene:FBgn0036369 transcript:FBtr0075823[more]
CG100894.437e-3338.98gene:FBgn0036369 transcript:FBtr0345364[more]
CG100894.437e-3338.98gene:FBgn0036369 transcript:FBtr0075820[more]
back to top
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp22a7.461e-3436.20dual specificity phosphatase 22a [Source:NCBI gene... [more]
dusp22b9.677e-3332.45dual specificity phosphatase 22b [Source:NCBI gene... [more]
styx3.172e-1833.33serine/threonine/tyrosine interacting protein [Sou... [more]
dusp19b2.363e-1733.09dual specificity phosphatase 19b [Source:ZFIN;Acc:... [more]
dusp19b7.829e-1733.59dual specificity phosphatase 19b [Source:ZFIN;Acc:... [more]
back to top
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000045497.11.747e-3637.72dual specificity protein phosphatase 22-A [Source:... [more]
smad69.254e-3536.96SMAD family member 6 [Source:Xenbase;Acc:XB-GENE-4... [more]
dusp193.861e-1732.58dual specificity phosphatase 19 [Source:NCBI gene;... [more]
eci16.126e-1737.86enoyl-CoA delta isomerase 1 [Source:Xenbase;Acc:XB... [more]
usp488.978e-1737.06ubiquitin specific peptidase 48 [Source:Xenbase;Ac... [more]
back to top
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dusp153.512e-3940.12dual specificity phosphatase-like 15 [Source:MGI S... [more]
Dusp225.319e-3636.42dual specificity phosphatase 22 [Source:MGI Symbol... [more]
Dusp225.703e-3636.42dual specificity phosphatase 22 [Source:MGI Symbol... [more]
Dusp193.572e-1835.61dual specificity phosphatase 19 [Source:MGI Symbol... [more]
Dusp64.946e-1738.62dual specificity phosphatase 6 [Source:MGI Symbol;... [more]
back to top
BLAST of Dual specificity protein phosphatase 22 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8R4V2|DUS15_MOUSE2.457e-3840.12Dual specificity protein phosphatase 15 OS=Mus mus... [more]
sp|B4F7B7|DUS15_RAT5.630e-3839.53Dual specificity protein phosphatase 15 OS=Rattus ... [more]
sp|Q9NRW4|DUS22_HUMAN5.796e-3638.73Dual specificity protein phosphatase 22 OS=Homo sa... [more]
sp|Q99N11|DUS22_MOUSE3.720e-3536.42Dual specificity protein phosphatase 22 OS=Mus mus... [more]
sp|Q6GQJ8|DUS22_XENLA1.249e-3437.50Dual specificity protein phosphatase 22 OS=Xenopus... [more]
back to top
BLAST of Dual specificity protein phosphatase 22 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3H2559.891e-4245.40dual specificity protein phosphatase 22-B-like OS=... [more]
A0A210PT611.798e-4142.33Dual specificity protein phosphatase 22 OS=Mizuhop... [more]
A0A0C9R0F24.303e-4041.81DUSP22_2 protein OS=Fopius arisanus OX=64838 GN=DU... [more]
L7MME52.232e-3942.44Putative dual specificity protein phosphatase 22 (... [more]
R7UA302.242e-3941.76Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp22a3.229e-3036.53dual specificity protein phosphatase 22-A [Source:... [more]
dusp22b5.334e-3033.76dual specificity protein phosphatase 22-B-like [So... [more]
dusp19b5.220e-1837.60dual specificity protein phosphatase 19 [Source:NC... [more]
styx8.820e-1833.55serine/threonine/tyrosine interacting protein [Sou... [more]
dusp63.686e-1737.06dual specificity phosphatase 6 [Source:NCBI gene;A... [more]
back to top
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dusp22b1.854e-3236.55dual specificity phosphatase 22b [Source:NCBI gene... [more]
ENSPMAT00000006071.13.875e-1640.43pep scaffold:Pmarinus_7.0:GL479824:161791:175185:-... [more]
dusp19b1.248e-1537.21dual specificity phosphatase 19b [Source:ZFIN;Acc:... [more]
dusp282.099e-1530.77dual specificity phosphatase 28 [Source:ZFIN;Acc:Z... [more]
dusp41.705e-1431.91dual specificity phosphatase 4 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
YVH11.086e-1328.93Dual specificity protein phosphatase; regulates gr... [more]
MSG57.728e-834.21Dual-specificity protein phosphatase; exists in 2 ... [more]
back to top
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO349201.137e-2936.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335876.829e-2029.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376758.898e-1835.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO454321.955e-1735.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471561.239e-1632.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dual specificity protein phosphatase 22 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000015946.26.377e-3338.65dual specificity phosphatase 22 [Source:NCBI gene;... [more]
dusp22a6.480e-3139.60dual specificity protein phosphatase 22-A [Source:... [more]
dusp22b1.535e-3033.74dual specificity protein phosphatase 22-B [Source:... [more]
ENSORLT00000038987.15.226e-2938.93dual specificity phosphatase 22 [Source:NCBI gene;... [more]
dusp22b6.909e-2735.86dual specificity protein phosphatase 22-B [Source:... [more]
back to top
BLAST of Dual specificity protein phosphatase 22 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000036587.11.134e-146100.00SMESG000036587.1[more]
SMESG000008792.14.802e-3040.12SMESG000008792.1[more]
SMESG000070817.11.005e-1933.33SMESG000070817.1[more]
SMESG000035381.14.984e-1535.57SMESG000035381.1[more]
SMESG000001338.15.673e-1433.81SMESG000001338.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021392 ID=SMED30021392|Name=Dual specificity protein phosphatase 22|organism=Schmidtea mediterranea sexual|type=transcript|length=1078bp
TGAATATTAAAATTGAAAATTTCAATTTGTTTAAATATGTTTAACAGGGT
TTAATTTTAAGTTGTTACTGTATAATTTCAATTTGTCAATAATGGGAGGA
GATATGTCTAAAATTGTCAACGGTGTATATGTCGGTAGTTATGGAAATGC
AGCAAACGAAGATTATTTAGAAAAATTTAATATAACACATGTATTAGCTG
TTCATAATCTTTCAGAAGAAGCTCACAGGAAGCATAAAAAAACTAGAGTA
CACAAAAGAATTACTATTTCTGATATTAATATGGAAAATATTAATAAATA
TTTCTCCGAGTGCAATGATTTTATTCATGAATGCAGATTAAGTGGAGGAA
ATTGTTTAATTCACTGTCAGGTGGGAATCTCACGCAGTGTCAGCATTACG
TGCGCTTATTTGATGAGTGTAACAACAATGAATTTTCGAGATACTCTATT
GGGTGTCCAAGGTGCCAGGCAACACGCAAGTCCTAATCCAGGATTTCGAG
AGCAGTTGGTCAATTTTGAAAGAACGTGGTTGTCAGAAGAAAGGAAACGG
ATTAAAAATAAATTCGGCGAATCCCCTTTTCTTGAACCAGATTTACAAGA
GATGAAAAATAATATGGAAAATGCTCTGAATAAAGATAAGCAACCAATCA
TGAACAAAACTGTGAATACAATGGACAGGCTGAAGGACATGCTTCAAGAC
CGACGGGATCCATCATCTGGATAATGATAACCTGTGTCAACTACGGTTCT
CTTATTATCGGGAAATGAATCGACATTAATTATTGCTCATTATTCTAATA
CAAATATTTGGTCTTTATTATTATTATTGTGTATGCATATTAATTATGGA
TTTCTGTGTTGTTCTTTCTCATTATTGATAAGATGTGAAAACGTAGCTTC
TTTTTAAAATCTAATATCATTTTGGTGTACGATCGGTGTTTCAAATGTCA
TGTTCATATTTATATCAACCGATAATGTGGTAATCATTAGGATGAAATGT
ATATTGAATGACTTACATTATTTTACTATTCTTTCTGCTATGTGCCTTTG
AGGGCTAAATGAAAATTTTGAATAAATT
back to top

protein sequence of SMED30021392-orf-1

>SMED30021392-orf-1 ID=SMED30021392-orf-1|Name=SMED30021392-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=211bp
MGGDMSKIVNGVYVGSYGNAANEDYLEKFNITHVLAVHNLSEEAHRKHKK
TRVHKRITISDINMENINKYFSECNDFIHECRLSGGNCLIHCQVGISRSV
SITCAYLMSVTTMNFRDTLLGVQGARQHASPNPGFREQLVNFERTWLSEE
RKRIKNKFGESPFLEPDLQEMKNNMENALNKDKQPIMNKTVNTMDRLKDM
LQDRRDPSSG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR020422TYR_PHOSPHATASE_DUAL_dom
IPR000340Dual-sp_phosphatase_cat-dom
IPR029021Prot-tyrosine_phosphatase-like
IPR000387TYR_PHOSPHATASE_dom
Vocabulary: molecular function
TermDefinition
GO:0008138protein tyrosine/serine/threonine phosphatase activity
GO:0016791phosphatase activity
GO:0004721phosphoprotein phosphatase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020422Dual specificity protein phosphatase domainSMARTSM00195dsp_5coord: 4..145
e-value: 1.8E-39
score: 147.2
IPR020422Dual specificity protein phosphatase domainPROSITEPS50054TYR_PHOSPHATASE_DUALcoord: 4..147
score: 32.905
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 3..174
e-value: 4.3E-43
score: 148.7
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 3..148
IPR000340Dual specificity phosphatase, catalytic domainPFAMPF00782DSPccoord: 12..144
e-value: 1.4E-31
score: 109.0
NoneNo IPR availablePANTHERPTHR45948FAMILY NOT NAMEDcoord: 1..192
NoneNo IPR availableCDDcd14519DSP_DUSP22_15coord: 5..143
e-value: 8.07724E-54
score: 166.771
IPR000387Tyrosine specific protein phosphatases domainPROSITEPS50056TYR_PHOSPHATASE_2coord: 68..126
score: 10.209