Glutamate receptor

Overview
NameGlutamate receptor
Smed IDSMED30021366
Length (bp)2733
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glutamate receptor (SMED30021366) t-SNE clustered cells

Violin plots show distribution of expression levels for Glutamate receptor (SMED30021366) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glutamate receptor (SMED30021366) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glutamate receptor (SMED30021366) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021366

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30021366SMESG000069665.1 SmedASXL_016843SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30021366SMESG000069665.1 dd_Smed_v4_13399_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021366SMESG000069665.1 dd_Smed_v4_13399_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30021366SMESG000069665.1 dd_Smed_v4_13399_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30021366SMESG000069665.1 dd_Smed_v4_13399_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30021366SMESG000069665.1 dd_Smed_v4_13399_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30021366SMESG000069665.1 dd_Smed_v4_13399_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021366SMESG000069665.1 Contig39290newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021366SMESG000069665.1 Contig39290uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30021366SMESG000069665.1 dd_Smed_v6_13399_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glutamate receptor vs. Ensembl Human
Match: GRIA1 (glutamate ionotropic receptor AMPA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4571])

HSP 1 Score: 412.535 bits (1059), Expect = 4.086e-129
Identity = 253/749 (33.78%), Postives = 400/749 (53.40%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPI-YLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQW--------TRLLGDEELSSVAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE--------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK--PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRK 2559
            +  ++P+L   LI+ +  +KW  FVYIY  +     +  VL        +E    VT +  L   E+G     R+L Q + K  ER +VVD +    +  +L  +  L      YHY++ N   M + L+ +K S  N+TGF +++Y        + QW        TR+       + A   D  +V+   F + R +      R    DC +       +  V    G D+   ++ +   G TG + F+ K   R N T+ + +     G   I   N D+ + +    +     ++  ++NR+++  V TIL +P+VML    + +   G    EGYC++LA EI   +  SY + +V D  YGA   +   WNGMVGEL+ G AD+ +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTL+AGSTKE+F  S    + K++  M+   PSV+ +T +EG+ RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT     K   ++  +  A+L+L E+  L KL +KWW  KGEC  +  GS  K   L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K
Sbjct:  122 VLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDT-----AAEKNWQVTAVNILTTTEEG----YRMLFQDLEKKKERLVVVDCESE-RLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLA-------NPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKG-RRTNYTLHVIEMK-HDGIRKIGYWNEDDKF-VPAATDAQAGGDNSSVQNRTYI--VTTILEDPYVML--KKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT----PKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK 840          
BLAST of Glutamate receptor vs. Ensembl Human
Match: GRIA1 (glutamate ionotropic receptor AMPA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4571])

HSP 1 Score: 410.223 bits (1053), Expect = 4.624e-129
Identity = 254/751 (33.82%), Postives = 401/751 (53.40%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPI-YLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQW--------TRLLGDEELSSVAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE--------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK----PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRK 2559
            +  ++P+L   LI+ +  +KW  FVYIY  +     +  VL        +E    VT +  L   E+G     R+L Q + K  ER +VVD +    +  +L  +  L      YHY++ N   M + L+ +K S  N+TGF +++Y        + QW        TR+       + A   D  +V+   F + R +      R    DC +       +  V    G D+   ++ +   G TG + F+ K   R N T+ + +     G   I   N D+ + +    +     ++  ++NR+++  V TIL +P+VML  ++++         EGYC++LA EI   +  SY + +V D  YGA   +   WNGMVGEL+ G AD+ +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTL+AGSTKE+F  S    + K++  M+   PSV+ +T +EG+ RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT     K   ++  +  A+L+L E+  L KL  KWW  KGEC   SGG  SK     L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K
Sbjct:   53 VLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDT-----AAEKNWQVTAVNILTTTEEG----YRMLFQDLEKKKERLVVVDCESE-RLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLA-------NPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKG-RRTNYTLHVIEMK-HDGIRKIGYWNEDDKF-VPAATDAQAGGDNSSVQNRTYI--VTTILEDPYVMLKKNANQFEGND--RYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT----PKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGEC--GSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK 771          
BLAST of Glutamate receptor vs. Ensembl Human
Match: GRIA1 (glutamate ionotropic receptor AMPA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4571])

HSP 1 Score: 410.994 bits (1055), Expect = 1.580e-128
Identity = 252/749 (33.64%), Postives = 401/749 (53.54%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPI-YLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQW--------TRLLGDEELSSVAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE--------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK--PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRK 2559
            +  ++P+L   LI+ +  +KW  FVYIY  +     +  VL        +E    VT +  L   E+G     R+L Q + K  ER +VVD +    +  +L  +  L      YHY++ N   M + L+ +K S  N+TGF +++Y        + QW        TR+       + A   D  +V+   F + R +      R    DC +       +  V    G D+   ++ +   G TG + F+ K   R N T+ + +     G   I   N D+ + +    +     ++  ++NR+++  V TIL +P+VML  ++++         EGYC++LA EI   +  SY + +V D  YGA   +   WNGMVGEL+ G AD+ +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTL+AGSTKE+F  S    + K++  M+   PSV+ +T +EG+ RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT     K   ++  +  A+L+L E+  L KL +KWW  KGEC  +  GS  K   L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K
Sbjct:  132 VLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDT-----AAEKNWQVTAVNILTTTEEG----YRMLFQDLEKKKERLVVVDCESE-RLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLA-------NPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKG-RRTNYTLHVIEMK-HDGIRKIGYWNEDDKF-VPAATDAQAGGDNSSVQNRTYI--VTTILEDPYVMLKKNANQFEGND--RYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT----PKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK 850          
BLAST of Glutamate receptor vs. Ensembl Human
Match: GRIA1 (glutamate ionotropic receptor AMPA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4571])

HSP 1 Score: 410.223 bits (1053), Expect = 3.062e-128
Identity = 255/751 (33.95%), Postives = 400/751 (53.26%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPI-YLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQW--------TRLLGDEELSSVAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE--------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK----PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRK 2559
            +  ++P+L   LI+ +  +KW  FVYIY  +     +  VL        +E    VT +  L   E+G     R+L Q + K  ER +VVD +    +  +L  +  L      YHY++ N   M + L+ +K S  N+TGF +++Y        + QW        TR+       + A   D  +V+   F + R +      R    DC +       +  V    G D+   ++ +   G TG + F+ K   R N T+ + +     G   I   N D+ + +    +     ++  ++NR+++  V TIL +P+VML    + +   G    EGYC++LA EI   +  SY + +V D  YGA   +   WNGMVGEL+ G AD+ +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTL+AGSTKE+F  S    + K++  M+   PSV+ +T +EG+ RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT     K   ++  +  A+L+L E+  L KL  KWW  KGEC   SGG  SK     L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K
Sbjct:  122 VLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDT-----AAEKNWQVTAVNILTTTEEG----YRMLFQDLEKKKERLVVVDCESE-RLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLA-------NPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKG-RRTNYTLHVIEMK-HDGIRKIGYWNEDDKF-VPAATDAQAGGDNSSVQNRTYI--VTTILEDPYVML--KKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT----PKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGEC--GSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK 840          
BLAST of Glutamate receptor vs. Ensembl Human
Match: GRIA1 (glutamate ionotropic receptor AMPA type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4571])

HSP 1 Score: 409.838 bits (1052), Expect = 4.651e-128
Identity = 254/751 (33.82%), Postives = 401/751 (53.40%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPI-YLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQW--------TRLLGDEELSSVAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE--------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK----PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRK 2559
            +  ++P+L   LI+ +  +KW  FVYIY  +     +  VL        +E    VT +  L   E+G     R+L Q + K  ER +VVD +    +  +L  +  L      YHY++ N   M + L+ +K S  N+TGF +++Y        + QW        TR+       + A   D  +V+   F + R +      R    DC +       +  V    G D+   ++ +   G TG + F+ K   R N T+ + +     G   I   N D+ + +    +     ++  ++NR+++  V TIL +P+VML  ++++         EGYC++LA EI   +  SY + +V D  YGA   +   WNGMVGEL+ G AD+ +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTL+AGSTKE+F  S    + K++  M+   PSV+ +T +EG+ RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT     K   ++  +  A+L+L E+  L KL  KWW  KGEC   SGG  SK     L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K
Sbjct:  132 VLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDT-----AAEKNWQVTAVNILTTTEEG----YRMLFQDLEKKKERLVVVDCESE-RLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLA-------NPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKG-RRTNYTLHVIEMK-HDGIRKIGYWNEDDKF-VPAATDAQAGGDNSSVQNRTYI--VTTILEDPYVMLKKNANQFEGND--RYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT----PKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGEC--GSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK 850          
BLAST of Glutamate receptor vs. Ensembl Celegans
Match: glr-2 (Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10914])

HSP 1 Score: 317.775 bits (813), Expect = 1.251e-93
Identity = 247/855 (28.89%), Postives = 406/855 (47.49%), Query Frame = 1
Query:  307 SRNISIPFITWSPLYNLPNVAGNQNSETCRIFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLPPDEKGIF--------------HTLRILD--QKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQE---TRVFITQWTR---LLGDEELSSVAFILDAF----RVLQ------------------SLFNNNRFRNPSAPNR-EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQ----TGPIMFDNKTCVRKN--ATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIK-------------VVTILANPFVMLAXXXXXXXXXXXXN-LEGYCIDL----AEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPY----EWKRDE-----AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIM-----------------QQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIV-ESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLSQYPEAR 2583
            + ++ +P I W P  +  N+ G        IFSV P     LI+++    W   VYI+  + +   + T+    Y HE S         Y+ P ++ +F              HTL+  D  ++I +     ++VDL+G       LR L+   ++++EYHY+  NF + +  LS +  S +NIT F I D  +++   TR       R      D   ++ AF  DA     + LQ                   LFN  R      P+  + +   F TF           GK + + IK +    +    TG I FD  T  R N  A I+  K        I  +    E    +L  E+   E+    K+ S   K             VVT+L  PFVML   +    ++   +  EGYCIDL    A+ I G     Y++ +   N YG+  + + +W+GM+G L+   AD+ +APLT++  R + + F++PFMT G+S+++KKP + +  +FSFM+P+   +WI T S+   +++ + +++  SPY    E+KR E      F + NS WF+ AA ++QG +I P++   RI +S WW F+L+ ++ YTANLAAFL++  +  PI  + DL  +    I  G  + GST  +F  S    Y K++  M                   +  ++  +  +G+++VR  +GKY F+LE   N Y++ + PCDTM VG    +  Y +AT+  +     ++  +  AIL L EK  L KL  KWW  +G+C    S G  S  L L+ ++G+FYIL  G++LS+   L +FL++ ++  ++++ ++   +R
Sbjct:  113 ANHMKMPLIDWEPSKS-ENI-GKTTENNPMIFSVAPSAEQLLIDYIQYKGWRDVVYIHDGKNADRTLRTMFS--YLHEKSPKYQLFVDNYVAPSDEEMFKEFLNEFHRRISTQHTLKSNDSSEEIDEPIPVNVIVDLEGSYRTRAFLRALEESVLVKKEYHYVFSNFDVDETDLSGFHFSLINITIFRIFDKNNKKFLKTRAEFHDVYRGGFSNTDSIPTAAAFAHDAILVAGKALQIAMNEHGKGIFDKSFVRHQLFNRGRKGLYCRPHEDQTESRQFETF---------EHGKKIAEAIKKVVLTDKDGTLTGRIQFDKVTGKRTNFSAEIVEIKPGVNSLNSIWERFQWAEGEGFLLGGERYVQEKK---KDSSQTRKGILPSKPWQLRFNVVTVLVKPFVMLKRRNPGEPELKGNDRFEGYCIDLLNLLAKNITGF---EYDVFISDGNKYGSR-QADGSWDGMIGYLLNETADVAVAPLTITQERERAVDFSKPFMTTGISIMIKKPEKQEFNIFSFMEPLGMTIWIFTLSSYFGVSLTIFLVSWFSPYEKRIEFKRGEFTVTNEFTLYNSLWFTLAAFMQQGTDILPRAVSGRIASSCWWFFTLIIVSSYTANLAAFLTLERMTPPIESVEDLANQNK--ILYGVNEGGSTAAFFEDSIVPLYKKMWNFMVSTTQKQIELEKQSITNSTSNRIFVSSYADGIEKVRTSKGKYAFLLEETTNNYESGRRPCDTMKVGQNLNTLGYGIATKIGN----PLRVSLNLAILYLSEKGELKKLENKWWYDRGQCDTGTSDGGTSSSLNLSKVAGIFYILLAGMVLSMCTALVEFLFRKNKENREKERNRMRSSR 941          
BLAST of Glutamate receptor vs. Ensembl Celegans
Match: glr-1 (Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot;Acc:P34299])

HSP 1 Score: 298.516 bits (763), Expect = 9.836e-87
Identity = 197/644 (30.59%), Postives = 335/644 (52.02%), Query Frame = 1
Query:  736 YHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQE---TRVFITQWTRLLGDEELSSVAFI-LDAFRV---------------LQSLFNNNRFRNPSAPNREIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQ-----TGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKN--RSHVIKVVTILANPFVMLAXXXXXXXXXXXXN----LEGYCIDLAEEIFGMINQ-SYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDEA----------FNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQ-QNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGEC---IVESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYK 2532
            YHY++ N+  +      +++  +NI+GF+I++   +E    +  +   + L G +++S  A +  DA  V                   F + RF N   P    D  S  +  N         GK +    +++  +G      TG I FD +   RKN  + +            +K        +   + +   + S   +N  + + + V+T L  PFVM+  +  + + + +       EG+CIDL + +   I + +YEI L          + + +W+GM+GEL+ G A  V+A LT++  R + + F++PFMT G+S+++KKP + +  VFSFM+P+S  +W+    A + +++ + +++  SPYEW+ +E           F++ N  WF+ AA ++QG +I P+S   RI +S WW F+++ ++ YTANLAAFL++  + +PI  + DL ++    IK G    GST  +F  S+   Y +++  M+ Q P V+  +  EG++RVR  +G+Y F+LE+  NEY+N + PCDTM VG+   S  Y +AT        D K+ I  AIL L+E+  L KL  KWW  +G+C   I   G SAS  L L+ ++G+FYIL  G+++S++  L +FLY+
Sbjct:  252 YHYVLANYDFLPYDQEMFQNGNINISGFNIINKDGREYWSLKKHLKTSSSLGGGDDVSVEAAVGHDAMLVTWHGFAKCLQANDSLFHGTFRHRRFFNRGFPGIYCDPLSDRSHPNRPFS-SFEHGKTIGVAFRNMK-IGHKEGTLTGNIEFD-RFGNRKNFDVSIVDLVSNTKATFNSKEVLAWRQGVGFFSNRTVAQHSRKSQNDHKDNQVIVLTNLVAPFVMIKRECLEMANLTECQGNNKFEGFCIDLLKLLADKIEEFNYEIKL---GTKAGSKQADGSWDGMIGELLSGRAHAVVASLTINQERERVVDFSKPFMTTGISIMIKKPDKQEFSVFSFMQPLSTEIWMYIIFAYIGVSVVIFLVSRFSPYEWRVEETSRGGFTISNDFSVYNCLWFTLAAFMQQGTDILPRSISGRIASSAWWFFTMIIVSSYTANLAAFLTLEKMQAPIESVEDLAKQSK--IKYGIQGGGSTASFFKYSSVQIYQRMWRYMESQVPPVFVASYAEGIERVRSHKGRYAFLLEATANEYENTRKPCDTMKVGANLNSIGYGIATPFGS----DWKDHINLAILALQERGELKKLENKWWYDRGQCDAGITVDGSSAS--LNLSKVAGIFYILMGGMVISMLAALGEFLYR 881          
BLAST of Glutamate receptor vs. Ensembl Celegans
Match: glr-2 (Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10914])

HSP 1 Score: 293.123 bits (749), Expect = 2.861e-85
Identity = 223/809 (27.56%), Postives = 378/809 (46.72%), Query Frame = 1
Query:  313 NISIPFITWSPLYNLPNVAGNQNSETCRIFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSSVAFILDAFRVLQSLFNNNRFRNPSAPNR-EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQ----TGPIMFDNKTCVRKN--ATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIK-------------VVTILANPFVMLAXXXXXXXXXXXXN-LEGYCIDL----AEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPY----EWKRDE-----AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIM-----------------QQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIV-ESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLSQYPEAR 2583
            ++ +P I W P  +  N+ G        IFSV P     LI+++    W   VYI+  + +   + T+    Y HE S         Y+ P ++ +F     L++   +++ +  +   D   E++E ++        R E+H +             Y+    N            +  +   +  ++  +E       I D   V   LFN  R      P+  + +   F TF           GK + + IK +    +    TG I FD  T  R N  A I+  K        I  +    E    +L  E+   E+    K+ S   K             VVT+L  PFVML   +    ++   +  EGYCIDL    A+ I G     Y++ +   N YG+  + + +W+GM+G L+   AD+ +APLT++  R + + F++PFMT G+S+++KKP + +  +FSFM+P+   +WI T S+   +++ + +++  SPY    E+KR E      F + NS WF+ AA ++QG +I P++   RI +S WW F+L+ ++ YTANLAAFL++  +  PI  + DL  +    I  G  + GST  +F  S    Y K++  M                   +  ++  +  +G+++VR  +GKY F+LE   N Y++ + PCDTM VG    +  Y +AT+  +     ++  +  AIL L EK  L KL  KWW  +G+C    S G  S  L L+ ++G+FYIL  G++LS+   L +FL++ ++  ++++ ++   +R
Sbjct:  115 HMKMPLIDWEPSKS-ENI-GKTTENNPMIFSVAPSAEQLLIDYIQYKGWRDVVYIHDGKNADRTLRTMFS--YLHEKSPKYQLFVDNYVAPSDEEMFK--EFLNEFHRRISTQHTLKSNDSSEEIDEPIKT-------RAEFHDV-------------YRGGFSNTDSIPTAAAFAHDAILVAGKALQIAMNEHGKG---IFDKSFVRHQLFNRGRKGLYCRPHEDQTESRQFETF---------EHGKKIAEAIKKVVLTDKDGTLTGRIQFDKVTGKRTNFSAEIVEIKPGVNSLNSIWERFQWAEGEGFLLGGERYVQEKK---KDSSQTRKGILPSKPWQLRFNVVTVLVKPFVMLKRRNPGEPELKGNDRFEGYCIDLLNLLAKNITGF---EYDVFISDGNKYGSR-QADGSWDGMIGYLLNETADVAVAPLTITQERERAVDFSKPFMTTGISIMIKKPEKQEFNIFSFMEPLGMTIWIFTLSSYFGVSLTIFLVSWFSPYEKRIEFKRGEFTVTNEFTLYNSLWFTLAAFMQQGTDILPRAVSGRIASSCWWFFTLIIVSSYTANLAAFLTLERMTPPIESVEDLANQNK--ILYGVNEGGSTAAFFEDSIVPLYKKMWNFMVSTTQKQIELEKQSITNSTSNRIFVSSYADGIEKVRTSKGKYAFLLEETTNNYESGRRPCDTMKVGQNLNTLGYGIATKIGN----PLRVSLNLAILYLSEKGELKKLENKWWYDRGQCDTGTSDGGTSSSLNLSKVAGIFYILLAGMVLSMCTALVEFLFRKNKENREKERNRMRSSR 872          
BLAST of Glutamate receptor vs. Ensembl Celegans
Match: glr-3 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q21415])

HSP 1 Score: 267.7 bits (683), Expect = 1.171e-76
Identity = 151/417 (36.21%), Postives = 236/417 (56.59%), Query Frame = 1
Query: 1291 IKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYE-WKRDE----------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASKPLALANLSGVFYILFFGIMLSLVL 2508
            +K+   L  PFVM+ S+          + EGYCIDL  +I  ++  +Y I  V+DN YG+  + N  W+GMVGEL RGDAD+ +A LT+S  R++ I FT P+M  G+S++ KKP       F FM P+S  VWI T ++   +++ + +IA ISPYE ++RDE           F++ NSFWF+  ++++QG+E+ P++   R+L  IWW F+L+ I+ YTANLAA L+   + +PI    DL  +    IK GTL  GST  +F  S    Y +++++M  +P ++ ++  EG+ RV+     Y +++ES M EY   +  C+ M +G +   K Y +       K    +E I+ AIL+L+EK  L +L  KWW  K + +V             ++ G+F IL  G++L+ VL
Sbjct:  403 LKISVYLEAPFVMITSNG---------SYEGYCIDLLHKIANILKFTYTIQKVRDNAYGSK-ESNGKWSGMVGELQRGDADLAVASLTISYGRSEVIDFTVPYMHLGISILFKKPRIRDSDWFKFMDPLSTQVWIMTFASYFVVSVAIWIIAKISPYEQFERDEDNGQYKPVDNQFSLRNSFWFTVCSLMQQGSELCPRAASTRLLTGIWWFFALILISSYTANLAAVLTTRRMETPIENADDLAAQTK--IKYGTLGRGSTMSFFNESKIETYERMWQLMSSSPGLFVQSSKEGIARVK--SSDYAYLMESSMLEYAVERD-CELMQIGGLIDQKGYGIGL----PKGSPYRELISTAILRLQEKTELTELKEKWW--KDKSVVCEQPKRKDQDDGESIGGIFIILVVGLVLTAVL 798          
BLAST of Glutamate receptor vs. Ensembl Celegans
Match: glr-5 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:O01623])

HSP 1 Score: 244.588 bits (623), Expect = 6.936e-68
Identity = 150/537 (27.93%), Postives = 275/537 (51.21%), Query Frame = 1
Query: 1039 KSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDI-MLNNEKNPNEESMHLKN--RSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWK-------------------RDEA-------FNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK---PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQK 2553
            K   G+ LID I   +  G +G +   N   ++ N ++ +      G  + I    P     + M  + K   + ++ + +  + H  +V TI+  P+VML  +  +         EG+CIDL  E+   +  +Y IH VKD  YG     N +W+GM+GE++RG+A++ +APLTV+  R++ + FT+PF++ G+S++ K P + +P +FSF+ P+S  +W    ++ + + +G+  +AN++PYEW                      EA       ++  N+ W+  + +++ G +  P++   R+L   WW+F LV I+ YTANLAA L+V+    PI  + DL  +    I  GT+  GST ++F  S    + K+++ M ++  V+  +  +GV+R       Y +++ES   EY+  ++ C+   +G V GSK Y +A      K  +  ++I+  IL   ++  +    TKWW  KG     +  +       L++ N++G+F  L  GI+L+ ++ + + +++ H I +K
Sbjct:  353 KYQHGRSLIDNIVHNDLHGLSGDLRRLNGHPLKSNFSMRIQLLGYSGRLDDIGFWEPATNVHVNMSGDSKAQLQRNVQVSDELKPH-FRVTTIMERPYVMLKKNHYELDANS--KFEGFCIDLLAELSKDLGFTYTIHAVKDGKYGNDKYGNGSWDGMMGEILRGEAEMAVAPLTVNYRRSEAVDFTKPFLSLGISILYKVPDDQQPDLFSFLNPLSWQIWTAIATSIITVTLGMYFVANVTPYEWNLNFSCCTAHEPHPAAAFATNQEAPIVMSNNYSFWNTVWYVLSTMLKGGCDFGPRAVSTRLLGGTWWVFYLVIISAYTANLAAVLTVSRPYIPIKNLDDLANQTT--ISYGTIRGGSTMQFFQESRIAAHVKMWQYM-KDKDVFVTSNGKGVERALSMN--YAYLMESTSLEYETQQN-CNLTQIGGVLGSKGYGIALA----KKSEWTDRISRQILLYAKRGIIEMKKTKWWRSKGAACASTASAVKHDRFALSMYNVAGLFITLGVGIVLAAIVVIFELIHRCHHIAKK 876          
BLAST of Glutamate receptor vs. Ensembl Fly
Match: GluRIA (gene:FBgn0004619 transcript:FBtr0076982)

HSP 1 Score: 337.806 bits (865), Expect = 9.479e-101
Identity = 243/820 (29.63%), Postives = 400/820 (48.78%), Query Frame = 1
Query:  307 SRNISIPFIT-WSPLYNLPNVAGNQNSETCRIFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLY-GHETSEDLLDVTPIYLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRI-MQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLL-----------GDEELSSV----AFILDAFRVLQSLFNN------NRFRNPSAPNRE-----------IDCTSFFTFFNTSVK--VKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLK----NRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKEND----TWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWK---RDEA------------------------------FNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYK 2532
            S    +PF+T W P   L   +G  +       S++PD    +I+ +  + W   +Y+Y       R+  +   L  G+ET    + V  I          HTL    + + + ++++IV+D       E +++ ++ + + R+ YHYL+    +    P    +   +NITGF I+D   +  R F     RL            G   L ++    A + DA  VL   FN       ++FR+     R             + +S     NTS         G+ +   ++ +   G +G I FD +   R N T+ + + +     + +A+   D     + ++    +  S        +R+H   V ++L  P++ L   +   S +G    EGYC DLA+ +   +   YEI LV+D  YGA   EN      W+GMVGELIR +ADI I+ +T+++ R + I F++PFMT G+S+++KKPV+  PGVFSF+ P+S  +WI    + + ++  L  +    PYEW+   R +A                              F M NSFW+S AA ++QG +I P S   RI A++WW F+++ I+ YTANLAAFL+V  +++PI    DL  + D  +  GTL  GST E+F  S    +NK++E M  N      T DEG++RVR+ +GKY  ++ES  NEY N + PCDTM VG    +K + VAT         +++++ +A+L L+E   L ++  KWW  K EC ++   S    L+L+N++G++YIL  G++L++++ + +F  +
Sbjct:  121 SNTFQMPFVTPWFPEKVLAPSSGLLDFA----ISMRPDYHQAIIDTIQYYGWQSIIYLYDSHDGLLRLQQIYQELKPGNETFRVQM-VKRIANVTMAIEFLHTL----EDLGRFSKKRIVLDCPAEMAKEIIVQHVRDIKLGRRTYHYLLSGLVMDNHWPSDVVEFGAINITGFRIVDSNRRAVRDFHDSRKRLEPSGQSQSQNAGGPNSLPAISAQAALMYDAVFVLVEAFNRILRKKPDQFRSNHLQRRSHGGSSSSSATGTNESSALLDCNTSKGWVTPWEQGEKISRVLRKVEIDGLSGEIRFD-EDGRRINYTLHVVEMSVNSTLQQVAEWRDDAGLLPLHSHNYASSSRSASASTGDYDRNHTYIVSSLLEEPYLSLKQYTYGESLVGNDRFEGYCKDLADMLAAQLGIKYEIRLVQDGNYGA---ENQYAPGGWDGMVGELIRKEADIAISAMTITAERERVIDFSKPFMTLGISIMIKKPVKQTPGVFSFLNPLSQEIWISVILSYVGVSFVLYFVTRFPPYEWRIVRRPQADSTAQQPPGIIGGATLSEPQAHVPPVPPNEFTMLNSFWYSLAAFMQQGCDITPPSIAGRIAAAVWWFFTIILISSYTANLAAFLTVERMVAPIKTPEDLTMQTD--VNYGTLLYGSTWEFFRRSQIGLHNKMWEYMNANQHHSVHTYDEGIRRVRQSKGKYALLVESPKNEYVNARPPCDTMKVGRNIDTKGFGVATPIGS----PLRKRLNEAVLTLKENGELLRIRNKWWFDKTECNLDQETSTPNELSLSNVAGIYYILIGGLLLAVIVAIMEFFCR 921          
BLAST of Glutamate receptor vs. Ensembl Fly
Match: KaiR1D (gene:FBgn0038837 transcript:FBtr0083987)

HSP 1 Score: 316.62 bits (810), Expect = 3.792e-94
Identity = 226/749 (30.17%), Postives = 371/749 (49.53%), Query Frame = 1
Query:  418 LTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWT----RLLGDEELSSV----AFILDAFRVLQSLFNNNRFRNPSAPNREIDCTSFFTFFNTSVKVKS--NDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNN--------EKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEW---------KRDEAFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKK---GECIVES--GGSASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLS 2565
            L+   ++ +  W W  F  IY       R+  +L   +G         +TP  +   +       R L ++I    E  IV+D      + E+L+  + +GM+   + YL+ +  +  + L  ++    NITGF +++   +     + QW+     LL    L++V    A + DA  +     +            ++D +        S   +S    G  LI+Y+K +   G T  I FD++   R +  + + +    G  +I        TW+  L +         +   E   +LKN++ V  V TIL+NP+ M     S     G    EGY +DL  EI   +  +Y+I LV D  YG+  K    WNGM+ EL+   AD+ IA LT++  R + + FT PFM  G+S++ +KP++  P +FSF+ P+S +VWI   +A L +++ L ++A  +PYEW         K +  F + N  WF+  ++++QG +  PK+   R++A IWW F+L+ I+ YTANLAAFL+V  + SPI    DL   K   IK G L  GST  +F  S    Y +++  M+   PSV+T +  EGV+RV + +G Y F++ES   EY   ++ C+   VG +  +K+Y +AT  N       +  I   IL+L+E+  L  L TKWW +K   G+C VE+    SA+  L LAN+ GVF +L  G+ ++ V+ + +F++K  ++  + +LS
Sbjct:  144 LSKAYVDIVRHWGWKTFTIIYENNDGIVRLQELL-KAHG---------MTPFPITVRQLSDSGDYRPLLKQIKNSAEAHIVLDCS-TERIHEVLKQAQQIGMMSDYHSYLVTSLDLHTVNLDEFRYGGTNITGFRLIN--EKIVSDVVRQWSIDEKGLLRSANLTTVRSETALMYDAVHLFAKALH------------DLDTSQQIDIHPISCDGQSTWQHGFSLINYMKIVEMKGLTNVIKFDHQG-FRTDFMLDIVELTPAGIRKI-------GTWNSTLPDGINFTRTFSQKQQEIEANLKNKTLV--VTTILSNPYCM--RKESAIPLSGNDQFEGYAVDLIHEISKSLGFNYKIQLVPDGSYGSLNKLTGEWNGMIRELLEQRADLAIADLTITFEREQAVDFTTPFMNLGVSILYRKPIKQPPNLFSFLSPLSLDVWIYMATAYLGVSVLLFILAKFTPYEWPAYTDAHGEKVESQFTLLNCMWFAIGSLMQQGCDFLPKALSTRMVAGIWWFFTLIMISSYTANLAAFLTVERMDSPIESAEDLA--KQTRIKYGALKGGSTAAFFRDSKISTYQRMWSFMESARPSVFTASNGEGVERVAKGKGSYAFLMESTSIEYVTERN-CELTQVGGMLDTKSYGIATPPNS----PYRTAINSVILKLQEEGKLHILKTKWWKEKRGGGKCRVETSKSSSAANELGLANVGGVFVVLMGGMGVACVIAVCEFVWKSRKVAVEERLS 848          
BLAST of Glutamate receptor vs. Ensembl Fly
Match: Grik (gene:FBgn0038840 transcript:FBtr0335016)

HSP 1 Score: 290.812 bits (743), Expect = 2.993e-84
Identity = 190/634 (29.97%), Postives = 317/634 (50.00%), Query Frame = 1
Query:  733 EYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEE----------LSSVAFILDAFRVLQSLFNNNRFRNPSAPNREIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKR-----------DEAFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKK--GECIVESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLS 2565
            +Y Y++ N     + L  Y+ +  NITG  ++    ++    + +  + L + E           +S+A + D  ++L   + +  FR P A    + C     +         + G  L++Y+KS+   G TGPI FD +  +R +  + + +    G  +I   S  D   +       +   +   L N+S V  V+T ++ P+ ML   S K         EG+ I+L +E+   +  SY   L +DN YG    +   WNGM+ E+I   AD+ I  LT++S R   + FT PFM+ G+ ++ +KP++  P +FSFM P S  VW+  G A + ++I + V+  +SP EW             +  F+  N  WFS  A+++QG+E+ PK+   R +A+ WW F+L+ ++ YTANLAAFL+V +L++PI    DL + K  G+  G    G+T  +F  S +  Y ++YE M+ NP   T T  EGV RV  E   Y F++ES   EY   +  C    VG++   K Y +A R N       ++ ++ A+L+++E+  L K+ TKWW +K  G    E+  S +  L  ANL GV+ ++F G     + GL + +  ++   ++ K+S
Sbjct:  239 DYRYIIGNLDWHTMDLEPYQHAGTNITGLRLVSPDSEQ----VQEVAKALYESEEPFQNVSCPLTNSMALVYDGVQLLAETYKHVNFR-PVA----LSCNDDSAW---------DKGYTLVNYMKSLTLNGLTGPIRFDYEG-LRTDFKLEVIELAVSGMQKIGQWSGEDGFQENRPAPAHSLEPDMRSLVNKSFV--VITAISEPYGMLKETSEKLEGND--QFEGFGIELIDELSKKLGFSYTWRLQEDNKYGGIDPKTGEWNGMLREIIDSRADMGITDLTMTSERESGVDFTIPFMSLGIGILFRKPMKEPPKLFSFMSPFSGEVWLWLGLAYMGVSISMFVLGRLSPAEWDNPYPCIEEPTELENQFSFANCLWFSIGALLQQGSELAPKAYSTRAVAASWWFFTLILVSSYTANLAAFLTVESLVTPINDADDLSKNKG-GVNYGAKIGGATFNFFKESNYPTYQRMYEFMRDNPQYMTNTNQEGVDRV--ENSNYAFLMESTTIEYITERR-CTLTQVGALLDEKGYGIAMRKN----WPYRDTLSQAVLEMQEQGLLTKMKTKWWQEKRGGGACSEAPDSDASSLGFANLGGVYLVMFVGSCFGSIYGLVNCVVSVYLRARENKVS 841          
BLAST of Glutamate receptor vs. Ensembl Fly
Match: Grik (gene:FBgn0038840 transcript:FBtr0335015)

HSP 1 Score: 288.5 bits (737), Expect = 1.991e-83
Identity = 193/627 (30.78%), Postives = 315/627 (50.24%), Query Frame = 1
Query:  733 EYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEE----------LSSVAFILDAFRVLQSLFNNNRFRNPSAPNREIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKR-----------DEAFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKK---GECIVESGGSASKPLALANLSGVFYIL----FFGIMLSL---VLGLTD 2520
            +Y Y++ N     + L  Y+ +  NITG  ++    ++    + +  + L + E           +S+A + D  ++L   + +  FR P A    + C     +         + G  L++Y+KS+   G TGPI FD +  +R +  + + +    G  +I   S  D   +       +   +   L N+S V  V+T ++ P+ ML   S K         EG+ I+L +E+   +  SY   L +DN YG    +   WNGM+ E+I   AD+ I  LT++S R   + FT PFM+ G+ ++ +KP++  P +FSFM P S  VW+  G A + ++I + V+  +SP EW             +  F+  N  WFS  A+++QG+E+ PK+   R +A+ WW F+L+ ++ YTANLAAFL+V +L++PI    DL + K  G+  G    G+T  +F  S +  Y ++YE M+ NP   T T  EGV RV  E   Y F++ES   EY   +  C    VG++   K Y +A R N       ++ ++ A+L+++E+  L K+ TKWW +K   G C      S +  L ++NL GVF ++    FFGI +SL   VLG+ +
Sbjct:  239 DYRYIIGNLDWHTMDLEPYQHAGTNITGLRLVSPDSEQ----VQEVAKALYESEEPFQNVSCPLTNSMALVYDGVQLLAETYKHVNFR-PVA----LSCNDDSAW---------DKGYTLVNYMKSLTLNGLTGPIRFDYEG-LRTDFKLEVIELAVSGMQKIGQWSGEDGFQENRPAPAHSLEPDMRSLVNKSFV--VITAISEPYGMLKETSEKLEGND--QFEGFGIELIDELSKKLGFSYTWRLQEDNKYGGIDPKTGEWNGMLREIIDSRADMGITDLTMTSERESGVDFTIPFMSLGIGILFRKPMKEPPKLFSFMSPFSGEVWLWLGLAYMGVSISMFVLGRLSPAEWDNPYPCIEEPTELENQFSFANCLWFSIGALLQQGSELAPKAYSTRAVAASWWFFTLILVSSYTANLAAFLTVESLVTPINDADDLSKNKG-GVNYGAKIGGATFNFFKESNYPTYQRMYEFMRDNPQYMTNTNQEGVDRV--ENSNYAFLMESTTIEYITERR-CTLTQVGALLDEKGYGIAMRKN----WPYRDTLSQAVLEMQEQGLLTKMKTKWWQEKRGGGACSDADEDSGAVALEISNLGGVFLVMGVGSFFGIFVSLLEMVLGVKE 834          
BLAST of Glutamate receptor vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0333701)

HSP 1 Score: 278.87 bits (712), Expect = 5.370e-80
Identity = 192/610 (31.48%), Postives = 312/610 (51.15%), Query Frame = 1
Query:  778 LSSYKSSRVNITGFHILDYLHQETRVFITQWTRLL--GDEELSSVAFILDA----FRVLQSLFNNNRFRNPSAPN----REIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVV-TILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKR-----------DEAFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQ-QNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGE-CIVESGGSASKPLALA--NLSGVFYILFFGIMLSLVLGLTDFLY 2529
            L  ++ + VNIT F ++D   +     I Q  +L   G + ++   +I       F  + +  N   F N         + + CTS  T+         NDG  L + I +  T G TG + F      R+N   +      Q   + +   +PD+  +I        +  + +  N +++  VV T    P+VM+  D + +  +     EG+CIDL + I   +   Y+I LV DN+YG Y+ E ++WNG+V EL+   AD+ +A +T++ +R   I FT+PFM  G+ ++ K P      +FSFM P++  +W+   +A + ++  L V+A  SPYEWK            +  F++ NSFWF     +RQG+ + PK+   RI+   W+ F L+ I+ YTANLAAFL+V  +ISPI    DL E+ +  I  GTL+ GST  +F  S    Y K++  M+ +  +V+ KT ++G++RV E  G Y F++ES M +Y   +  C+   +G +  SK Y +AT     K    +++I+ AIL+L+EK  +  LY KWW   G+ C  +     SK  AL   N+ GVF +L  G+ L++V+ + +F +
Sbjct:  264 LEDFRYNSVNITAFRLVDVDSKRYLEVINQMQKLQHNGLDTINGSPYIQTESALMFDSVYAFANGLHFLNLDNHQNFYIKNLSCTSDQTW---------NDGISLYNQINAAITDGLTGTVQFVEG---RRNIFKLDILKLKQEKIQKVGYWHPDDGVNI-------SDPTAFYDSNIANITLVVMTREERPYVMVKEDKNLTGNL---RFEGFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETNSWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLNPKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERMISPIESASDLAEQTE--ISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYEDGIKRVME--GSYAFLMESTMLDYAVQRD-CNLTQIGGLLDSKGYGIATP----KGSPWRDKISLAILELQEKGIIQILYDKWWKNTGDVCNRDDKSKESKANALGVENIGGVFVVLLCGLALAVVVAIFEFCW 842          
BLAST of Glutamate receptor vs. Ensembl Zebrafish
Match: gria2b (glutamate receptor, ionotropic, AMPA 2b [Source:ZFIN;Acc:ZDB-GENE-020125-4])

HSP 1 Score: 415.616 bits (1067), Expect = 8.637e-131
Identity = 262/778 (33.68%), Postives = 421/778 (54.11%), Query Frame = 1
Query:  316 ISIPFITWSPLYNLPNVAGNQNSETCRIFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLP--PDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLL------GDEELS-SVAFILDAFRVLQSLFN--NNRFRNPSAPNREIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE-------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQ-QNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK--PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLSQ 2568
            + + FIT  P + L    GNQ      I  ++PD+  PL++ +  +KW+ F Y+Y  +     +  VL        +E    VT I +    DE+      R L Q +    ER++++D + + +V++++  +  +G   + YHY++ N   +   LS  +    N++GF I+D+       F  +W  L        D ++  + A   DA +V+   F   + +  + S      DC +       +  V    G ++   +K +   G TG I FD +   R N T+ + +    G  +I   +  D+   ++  ++  PN+ +M L+N++ +  V TIL  P+VML    +    +  +  EGYC+DLA EI       Y++ +V D  YGA   E   WNGMVGEL+ G ADI +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E              F + NS WFS  A +RQG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    ++K++  M+   PSV+ KT  EGV RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT    +    ++  +  A+L+L E+ TL KL  KWW  KGEC  +  GS  K   L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K+++
Sbjct:  106 LHVSFIT--PSFPLD---GNQQF----IIQMRPDIKGPLLSLIEYYKWDKFAYLYDSDRGLTTLQVVLDT-----AAEKKWQVTAINVGNMKDERKD-EAYRSLFQDLENKKERRVILDCE-QDKVKDIMEQVITIGRHVKGYHYIIANLGFVDGDLSKIQYGGANVSGFQIVDFDDPLVSKFDQRWEALEEKEYPGADSKIRYTSALTYDAVQVMTEAFRYLHKQRIDISRRANNGDCLA-------NPAVPWAQGVEIERALKQVRVDGLTGNIQFD-QYGKRVNYTVNVMELKSNGAVKIGYWNEVDKM--VVTKSDLFPND-TMGLENKTVI--VTTILEAPYVML--KKNADLFMDNERYEGYCVDLAAEIAKHCGFKYQLKIVGDGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEYEDGQIQTNESTNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLDSGSTKEFFRRSKIALFDKMWTYMKGAEPSVFVKTTAEGVMRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSS----LRTPVNLAVLKLSEQGTLDKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALVEFCYKSRAEAKRMKVAK 846          
BLAST of Glutamate receptor vs. Ensembl Zebrafish
Match: gria3a (glutamate receptor, ionotropic, AMPA 3a [Source:ZFIN;Acc:ZDB-GENE-020125-5])

HSP 1 Score: 413.69 bits (1062), Expect = 4.868e-130
Identity = 259/752 (34.44%), Postives = 399/752 (53.06%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSS--------VAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE---------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK--PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLSQ 2568
            +  ++P L   L++ L  +KW  FVY+Y  +  F  +  ++ +   +        V  I  P + +      RI+++ + +  E++ ++D +    +  +L  + + G   + YHY++ N     + L    S   NITGF I++      + F+ +W RL   E   S         A   DA  V+   F   R +      R    DC +       +  V  + G D+   +K +   G TG I FD+    R N T+ + +    GG   I   N  E +  ++  E+    ES  ++NR+  I V TI+  P+VM     +     G    EGYC+DLA EI   +   Y++ +V D  YGA   E  TWNGMVGEL+ G ADI +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  D+                F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    Y K++  M+   PSV+ KT  +GV RVR+ +GK+ F+LES MNEY   + PCDTM VG    SK Y VAT     K   ++  +  A+L+L E+  L KL  KWW  KGEC  +  GS  K   L+L+N++GVFYIL  G+ L++ + L +F YK HQ  ++ KL++
Sbjct:  131 VLQMRPSLRGALLSLLAHYKWEKFVYLYDTDRGFSILQAIMESAVMNNWQVTARSVGNIVDPLEYR------RIIEE-MDRRQEKRFLIDCE-VERINSILEQVVIAGKNSRGYHYILANLGFTNMSLDKVFSGGANITGFQIINPDSPIVQQFLQRWERLDEREFPESRSSPLKYTSALTHDAILVIAEAFRYLRRQRVDISRRGSAGDCLA-------NPAVPWSQGIDIERALKMVQVQGMTGNIQFDS-FGRRSNYTVDVYEMK-PGGARKIGYWNEFEKFVYIV--EQQVTNESSSVENRT--IVVTTIMEAPYVMY--KRNYMQLEGNDRYEGYCVDLASEIAKHVGIKYKLSIVADGKYGARDPETKTWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLDDNEETKDPQTPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFVKTTPDGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVAT----PKGSALRTPVNLAVLKLSEQGILDKLKNKWWYDKGECGTKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMTVALVEFCYKSHQETKRLKLAK 853          
BLAST of Glutamate receptor vs. Ensembl Zebrafish
Match: gria2b (glutamate receptor, ionotropic, AMPA 2b [Source:ZFIN;Acc:ZDB-GENE-020125-4])

HSP 1 Score: 413.69 bits (1062), Expect = 5.864e-130
Identity = 262/778 (33.68%), Postives = 420/778 (53.98%), Query Frame = 1
Query:  313 NISIPFITWSPLYNLPNVAGNQNSETCRIFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLP--PDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLL------GDEELS-SVAFILDAFRVLQSLFN--NNRFRNPSAPNREIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE-------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQ-QNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK--PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLS 2565
             + + FIT  P + L    GNQ      I  ++PD+  PL++ +  +KW+ F Y+Y  +     +  VL        +E    VT I +    DE+      R L Q +    ER++++D + + +V++++  +  +G   + YHY++ N   +   LS  +    N++GF I+D+       F  +W  L        D ++  + A   DA +V+   F   + +  + S      DC +       +  V    G ++   +K +   G TG I FD +   R N T+ + +    G  +I   +  D+   ++  ++  PN+ +M L+N++ +  V TIL  P+VML    +    +  +  EGYC+DLA EI       Y++ +V D  YGA   E   WNGMVGEL+ G ADI +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E              F + NS WFS  A +RQG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    ++K++  M+   PSV+ KT  EGV RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT    +    ++  +  A+L+L E+ TL KL  KWW  KGEC  +  GS  K   L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K++
Sbjct:  105 TLHVSFIT--PSFPLD---GNQQF----IIQMRPDIKGPLLSLIEYYKWDKFAYLYDSDRGLTTLQVVLDT-----AAEKKWQVTAINVGNMKDERKD-EAYRSLFQDLENKKERRVILDCE-QDKVKDIMEQVITIGRHVKGYHYIIANLGFVDGDLSKIQYGGANVSGFQIVDFDDPLVSKFDQRWEALEEKEYPGADSKIRYTSALTYDAVQVMTEAFRYLHKQRIDISRRANNGDCLA-------NPAVPWAQGVEIERALKQVRVDGLTGNIQFD-QYGKRVNYTVNVMELKSNGAVKIGYWNEVDKM--VVTKSDLFPND-TMGLENKTVI--VTTILEAPYVML--KKNADLFMDNERYEGYCVDLAAEIAKHCGFKYQLKIVGDGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEYEDGQIQTNESTNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLDSGSTKEFFRRSKIALFDKMWTYMKGAEPSVFVKTTAEGVMRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSS----LRTPVNLAVLKLSEQGTLDKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALVEFCYKSRAEAKRMKVT 845          
BLAST of Glutamate receptor vs. Ensembl Zebrafish
Match: gria4b (glutamate receptor, ionotropic, AMPA 4b [Source:ZFIN;Acc:ZDB-GENE-030131-8013])

HSP 1 Score: 413.69 bits (1062), Expect = 8.226e-130
Identity = 257/758 (33.91%), Postives = 405/758 (53.43%), Query Frame = 1
Query:  382 SETCRIFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSS-------VAFILDAFRVLQSLFNNNRFRNPSAPNREI--DCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKN--PNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDEA---------------FNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGS---ASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLS 2565
             E+  +  ++P +   L++ L  + WN FV++Y  +  +  +  ++      +  ++   V+ I +   E     + R L + + +  E+  V+DL+    +  +L  +  +G   + YHY+M N     + L  +     N+TGF ++D+ +      + +W +L   E   S        A   D   V+   F N R +      R I  DC +       +     N G D+   +K ++  G TG + FD+    R N T+ + +    G   I   ++ D+   ++L  +    PNE S  ++NR+  + V TI+  P+VML    +     G +  EGYC+DLA EI   I   Y+I +V D  YGA   E   WNGMVGEL+ G A+I +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E                F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ D  I  GTLD+GSTKE+F  S    Y K++  M+   P+V+TKT  EGV RVR+ +GKY F+LES MNEY   + PCDTM VG    SK Y VAT     K   ++  +  A+L+L E   L KL  KWW  KGEC  +  GS   +S+ L+L+N++GVFYIL  G+ L++++ L +F YK     ++ KL+
Sbjct:  126 GESQFVLQLRPSIRGALLSLLDHYDWNRFVFLYDTDRGYSILQAIME-----KAGQNGWQVSAICV---ENFNDASYRQLLEDLDRRQEKTFVIDLEAE-RLNNMLEQIVSVGKHVKGYHYIMANLGFKDINLERFMHGGANVTGFQLVDFSNPMVIKLMQRWNKLDQREYPGSDAPPKYTSALTYDGVMVMAEAFRNLRRQKVDISRRGIAGDCLA-------NPAAPWNQGIDMERTLKQVHLQGLTGNVQFDHYG-RRVNYTMDVFELKSNGPRRIGYWNDADK---LVLTQDHALLPNETS-GMENRT--VIVTTIMEGPYVML--KKNWEMYEGNEQYEGYCVDLASEIAKHIGFKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGTDGLPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTD--IAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGVAT----PKGSQLRTPVNLAVLKLSESGILDKLKNKWWYDKGECGPKDSGSKDKSSQALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRNEAKRMKLT 852          
BLAST of Glutamate receptor vs. Ensembl Zebrafish
Match: gria2b (glutamate receptor, ionotropic, AMPA 2b [Source:ZFIN;Acc:ZDB-GENE-020125-4])

HSP 1 Score: 411.764 bits (1057), Expect = 2.602e-129
Identity = 263/780 (33.72%), Postives = 421/780 (53.97%), Query Frame = 1
Query:  316 ISIPFITWSPLYNLPNVAGNQNSETCRIFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLP--PDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLL------GDEELS-SVAFILDAFRVLQSLFN--NNRFRNPSAPNREIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE-------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQ-QNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK----PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLSQ 2568
            + + FIT  P + L    GNQ      I  ++PD+  PL++ +  +KW+ F Y+Y  +     +  VL        +E    VT I +    DE+      R L Q +    ER++++D + + +V++++  +  +G   + YHY++ N   +   LS  +    N++GF I+D+       F  +W  L        D ++  + A   DA +V+   F   + +  + S      DC +       +  V    G ++   +K +   G TG I FD +   R N T+ + +    G  +I   +  D+   ++  ++  PN+ +M L+N++ +  V TIL  P+VML    +    +  +  EGYC+DLA EI       Y++ +V D  YGA   E   WNGMVGEL+ G ADI +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E              F + NS WFS  A +RQG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    ++K++  M+   PSV+ KT  EGV RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT    +    ++  +  A+L+L E+  L KL  KWW  KGEC   SGG  SK     L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K+++
Sbjct:  106 LHVSFIT--PSFPLD---GNQQF----IIQMRPDIKGPLLSLIEYYKWDKFAYLYDSDRGLTTLQVVLDT-----AAEKKWQVTAINVGNMKDERKD-EAYRSLFQDLENKKERRVILDCE-QDKVKDIMEQVITIGRHVKGYHYIIANLGFVDGDLSKIQYGGANVSGFQIVDFDDPLVSKFDQRWEALEEKEYPGADSKIRYTSALTYDAVQVMTEAFRYLHKQRIDISRRANNGDCLA-------NPAVPWAQGVEIERALKQVRVDGLTGNIQFD-QYGKRVNYTVNVMELKSNGAVKIGYWNEVDKM--VVTKSDLFPND-TMGLENKTVI--VTTILEAPYVML--KKNADLFMDNERYEGYCVDLAAEIAKHCGFKYQLKIVGDGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEYEDGQIQTNESTNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLDSGSTKEFFRRSKIALFDKMWTYMKGAEPSVFVKTTAEGVMRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSS----LRNAVNLAVLKLNEQGLLDKLKNKWWYDKGEC--GSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALVEFCYKSRAEAKRMKVAK 846          
BLAST of Glutamate receptor vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 423.32 bits (1087), Expect = 1.863e-133
Identity = 254/755 (33.64%), Postives = 403/755 (53.38%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPI-YLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGR------SEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELS--------SVAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE--------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLS 2565
            +  ++P+L   LI+ +  +KW  FVYIY  +     +  VL        +E    VT +  L   E+G     R+L Q + K  +R+IV+D +        ++V E              YHY++ N   M + +  +K +  N+TGF +++Y        + QW    G E+          + A   D  RV+   F + R +      R    DC +       +  V    G D+   ++ +   G +G + F+ K   R N T+ + +   +G   I A  N D+   I L  +     +++ ++NR+++  V TIL  P+VML    +     G    EGYC++LA EI   +   Y++ +VKD  YGA   +   WNGMVGEL+ G AD+ +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    + K++  M+   PSV+ KT +EG+ RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT     K   ++  +  A+L+L E+  L KL +KWW  KGEC  +  GS +  L+L+N++GVFYIL  G+ L++++ L +F YK     +K K++
Sbjct:  119 VLQLRPELQDALISVIEYYKWKKFVYIYDADRGLSVLQKVLDT-----AAEKNWQVTAVNILTTTEEG----YRLLFQDLDKSKDRQIVIDCESERLNAILTQVLEKNIIG---------YHYILANLGFMDIDMQKFKEAGANVTGFQLVNYTDTMVSRIMQQWKNYDGREQPRVDWKKPKYTSALTYDGVRVMAEAFQSLRKQRIDISRRGNAGDCLA-------NPAVPWGQGIDIQRALQQVRLEGLSGNVQFNEKG-RRTNYTLHVLELKHEGIRHI-AHWNEDDKL-IPLATDAQAGNDTIGVQNRTYI--VTTILEAPYVML--KKNADQLEGNDRFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPTTDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTE--IAYGTLDSGSTKEFFKRSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT----PKGSPLRGAVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKKMKVA 835          
BLAST of Glutamate receptor vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 420.239 bits (1079), Expect = 1.314e-132
Identity = 258/756 (34.13%), Postives = 408/756 (53.97%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPI-YLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQE---YHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEE------LSSV----AFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE--------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK--PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLS 2565
            +  ++P+L   LI+ +  +KW  FVYIY  +     +  VL        +E    VT +  L   E+G     R+L Q + K  +R+IV+D     E E L   L  +  L +    YHY++ N   M + +  +K +  N+TGF +++Y        + QW    G E+       S++    A   D  RV+   F + R +      R    DC +       +  V    G D+   ++ +   G +G + F+ K   R N T+ + +   +G   I A  N D+   I L  +     +++ ++NR+++  V TIL  P+VML  ++ +         EGYC++LA EI   +   Y++ +VKD  YGA   +   WNGMVGEL+ G AD+ +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    + K++  M+   PSV+ KT +EG+ RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT     K   ++  +  A+L+L E+  L KL +KWW  KGEC  +  GS  K   L+L+N++GVFYIL  G+ L++++ L +F YK     +K K++
Sbjct:  120 VLQLRPELQDALISVIEYYKWKKFVYIYDADRGLSVLQKVLDT-----AAEKNWQVTAVNILTTTEEG----YRLLFQDLDKSKDRQIVID----CESERLNAILTQVVKLEKNIIGYHYILANLGFMDIDMQKFKEAGANVTGFQLVNYTDTMVSRIMQQWKNYDGREQPHLGSNTSTIKYTSALTYDGVRVMAEAFQSLRKQRIDISRRGNAGDCLA-------NPAVPWGQGIDIQRALQQVRLEGLSGNVQFNEKG-RRTNYTLHVLELKHEGIRHI-AHWNEDDKL-IPLATDAQAGNDTIGVQNRTYI--VTTILEAPYVMLKKNADQLEGND--RFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPTTDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTE--IAYGTLDSGSTKEFFKRSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT----PKGSPLRGAVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKKMKVA 842          
BLAST of Glutamate receptor vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 419.083 bits (1076), Expect = 1.857e-132
Identity = 261/758 (34.43%), Postives = 407/758 (53.69%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPI-YLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQE---YHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEE------LSSV----AFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE--------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK----PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLS 2565
            +  ++P+L   LI+ +  +KW  FVYIY  +     +  VL        +E    VT +  L   E+G     R+L Q + K  +R+IV+D     E E L   L  +  L +    YHY++ N   M + +  +K +  N+TGF +++Y        + QW    G E+       S++    A   D  RV+   F + R +      R    DC +       +  V    G D+   ++ +   G +G + F+ K   R N T+ + +   +G   I A  N D+   I L  +     +++ ++NR+++  V TIL  P+VML    +     G    EGYC++LA EI   +   Y++ +VKD  YGA   +   WNGMVGEL+ G AD+ +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    + K++  M+   PSV+ KT +EG+ RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT     K   ++  +  A+L+L E+  L KL  KWW  KGEC   SGG  SK     L+L+N++GVFYIL  G+ L++++ L +F YK     +K K++
Sbjct:   97 VLQLRPELQDALISVIEYYKWKKFVYIYDADRGLSVLQKVLDT-----AAEKNWQVTAVNILTTTEEG----YRLLFQDLDKSKDRQIVID----CESERLNAILTQVVKLEKNIIGYHYILANLGFMDIDMQKFKEAGANVTGFQLVNYTDTMVSRIMQQWKNYDGREQPHLGSNTSTIKYTSALTYDGVRVMAEAFQSLRKQRIDISRRGNAGDCLA-------NPAVPWGQGIDIQRALQQVRLEGLSGNVQFNEKG-RRTNYTLHVLELKHEGIRHI-AHWNEDDKL-IPLATDAQAGNDTIGVQNRTYI--VTTILEAPYVML--KKNADQLEGNDRFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPTTDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTE--IAYGTLDSGSTKEFFKRSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT----PKGSPLRNPVNLAVLKLNEQGLLDKLKNKWWYDKGEC--GSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKKMKVA 819          
BLAST of Glutamate receptor vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 417.542 bits (1072), Expect = 8.716e-132
Identity = 260/754 (34.48%), Postives = 403/754 (53.45%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPI-YLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQE---YHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELS--------SVAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE--------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK----PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRK 2559
            +  ++P+L   LI+ +  +KW  FVYIY  +     +  VL        +E    VT +  L   E+G     R+L Q + K  +R+IV+D     E E L   L  +  L +    YHY++ N   M + +  +K +  N+TGF +++Y        + QW    G E+          + A   D  RV+   F + R +      R    DC +       +  V    G D+   ++ +   G +G + F+ K   R N T+ + +   +G   I A  N D+   I L  +     +++ ++NR+++  V TIL  P+VML    +     G    EGYC++LA EI   +   Y++ +VKD  YGA   +   WNGMVGEL+ G AD+ +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    + K++  M+   PSV+ KT +EG+ RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT     K   ++  +  A+L+L E+  L KL  KWW  KGEC   SGG  SK     L+L+N++GVFYIL  G+ L++++ L +F YK     +K K
Sbjct:   70 VLQLRPELQDALISVIEYYKWKKFVYIYDADRGLSVLQKVLDT-----AAEKNWQVTAVNILTTTEEG----YRLLFQDLDKSKDRQIVID----CESERLNAILTQVVKLEKNIIGYHYILANLGFMDIDMQKFKEAGANVTGFQLVNYTDTMVSRIMQQWKNYDGREQPRVDWKKPKYTSALTYDGVRVMAEAFQSLRKQRIDISRRGNAGDCLA-------NPAVPWGQGIDIQRALQQVRLEGLSGNVQFNEKG-RRTNYTLHVLELKHEGIRHI-AHWNEDDKL-IPLATDAQAGNDTIGVQNRTYI--VTTILEAPYVML--KKNADQLEGNDRFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPTTDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTE--IAYGTLDSGSTKEFFKRSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT----PKGSPLRNPVNLAVLKLNEQGLLDKLKNKWWYDKGEC--GSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKKMK 788          
BLAST of Glutamate receptor vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 417.927 bits (1073), Expect = 3.118e-131
Identity = 257/751 (34.22%), Postives = 401/751 (53.40%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPI-YLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELS--------SVAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE--------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK----PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRK 2559
            +  ++P+L   LI+ +  +KW  FVYIY  +     +  VL        +E    VT +  L   E+G     R+L Q + K  +R+IV+D +       L + +  L      YHY++ N   M + +  +K +  N+TGF +++Y        + QW    G E+          + A   D  RV+   F + R +      R    DC +       +  V    G D+   ++ +   G +G + F+ K   R N T+ + +   +G   I A  N D+   I L  +     +++ ++NR+++  V TIL  P+VML    +     G    EGYC++LA EI   +   Y++ +VKD  YGA   +   WNGMVGEL+ G AD+ +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    + K++  M+   PSV+ KT +EG+ RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT     K   ++  +  A+L+L E+  L KL  KWW  KGEC   SGG  SK     L+L+N++GVFYIL  G+ L++++ L +F YK     +K K
Sbjct:  122 VLQLRPELQDALISVIEYYKWKKFVYIYDADRGLSVLQKVLDT-----AAEKNWQVTAVNILTTTEEG----YRLLFQDLDKSKDRQIVIDCESERLNAILTQVVVKLEKNIIGYHYILANLGFMDIDMQKFKEAGANVTGFQLVNYTDTMVSRIMQQWKNYDGREQPRVDWKKPKYTSALTYDGVRVMAEAFQSLRKQRIDISRRGNAGDCLA-------NPAVPWGQGIDIQRALQQVRLEGLSGNVQFNEKG-RRTNYTLHVLELKHEGIRHI-AHWNEDDKL-IPLATDAQAGNDTIGVQNRTYI--VTTILEAPYVML--KKNADQLEGNDRFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPTTDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTE--IAYGTLDSGSTKEFFKRSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT----PKGSPLRNPVNLAVLKLNEQGLLDKLKNKWWYDKGEC--GSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKKMK 841          
BLAST of Glutamate receptor vs. Ensembl Mouse
Match: Gria1 (glutamate receptor, ionotropic, AMPA1 (alpha 1) [Source:MGI Symbol;Acc:MGI:95808])

HSP 1 Score: 412.535 bits (1059), Expect = 4.596e-130
Identity = 253/749 (33.78%), Postives = 400/749 (53.40%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPI-YLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQW--------TRLLGDEELSSVAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE--------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK--PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRK 2559
            +  ++P+L   LI+ +  +KW  FVYIY  +     +  VL        +E    VT +  L   E+G     R+L Q + K  ER +VVD +    +  +L  +  L      YHY++ N   M + L+ +K S  N+TGF +++Y        + QW        TR+       + A   D  +V+   F + R +      R    DC +       +  V    G D+   ++ +   G TG + F+ K   R N T+ + +     G   I   N D+ + +    +     ++  ++NR+++  V TIL +P+VML    + +   G    EGYC++LA EI   +  SY + +V D  YGA   +   WNGMVGEL+ G AD+ +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTL+AGSTKE+F  S    + K++  M+   PSV+ +T +EG+ RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT     K   ++  +  A+L+L E+  L KL +KWW  KGEC  +  GS  K   L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K
Sbjct:   53 VLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDT-----AAEKNWQVTAVNILTTTEEG----YRMLFQDLEKKKERLVVVDCESE-RLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLA-------NPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKG-RRTNYTLHVIEMK-HDGIRKIGYWNEDDKF-VPAATDAQAGGDNSSVQNRTYI--VTTILEDPYVML--KKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT----PKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK 771          
BLAST of Glutamate receptor vs. Ensembl Mouse
Match: Gria1 (glutamate receptor, ionotropic, AMPA1 (alpha 1) [Source:MGI Symbol;Acc:MGI:95808])

HSP 1 Score: 412.149 bits (1058), Expect = 4.063e-129
Identity = 253/749 (33.78%), Postives = 400/749 (53.40%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPI-YLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQW--------TRLLGDEELSSVAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE--------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK--PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRK 2559
            +  ++P+L   LI+ +  +KW  FVYIY  +     +  VL        +E    VT +  L   E+G     R+L Q + K  ER +VVD +    +  +L  +  L      YHY++ N   M + L+ +K S  N+TGF +++Y        + QW        TR+       + A   D  +V+   F + R +      R    DC +       +  V    G D+   ++ +   G TG + F+ K   R N T+ + +     G   I   N D+ + +    +     ++  ++NR+++  V TIL +P+VML    + +   G    EGYC++LA EI   +  SY + +V D  YGA   +   WNGMVGEL+ G AD+ +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTL+AGSTKE+F  S    + K++  M+   PSV+ +T +EG+ RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT     K   ++  +  A+L+L E+  L KL +KWW  KGEC  +  GS  K   L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K
Sbjct:  122 VLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDT-----AAEKNWQVTAVNILTTTEEG----YRMLFQDLEKKKERLVVVDCESE-RLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLA-------NPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKG-RRTNYTLHVIEMK-HDGIRKIGYWNEDDKF-VPAATDAQAGGDNSSVQNRTYI--VTTILEDPYVML--KKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT----PKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK 840          
BLAST of Glutamate receptor vs. Ensembl Mouse
Match: Gria1 (glutamate receptor, ionotropic, AMPA1 (alpha 1) [Source:MGI Symbol;Acc:MGI:95808])

HSP 1 Score: 410.223 bits (1053), Expect = 2.044e-128
Identity = 255/751 (33.95%), Postives = 400/751 (53.26%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPI-YLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQW--------TRLLGDEELSSVAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE--------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK----PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRK 2559
            +  ++P+L   LI+ +  +KW  FVYIY  +     +  VL        +E    VT +  L   E+G     R+L Q + K  ER +VVD +    +  +L  +  L      YHY++ N   M + L+ +K S  N+TGF +++Y        + QW        TR+       + A   D  +V+   F + R +      R    DC +       +  V    G D+   ++ +   G TG + F+ K   R N T+ + +     G   I   N D+ + +    +     ++  ++NR+++  V TIL +P+VML    + +   G    EGYC++LA EI   +  SY + +V D  YGA   +   WNGMVGEL+ G AD+ +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTL+AGSTKE+F  S    + K++  M+   PSV+ +T +EG+ RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT     K   ++  +  A+L+L E+  L KL  KWW  KGEC   SGG  SK     L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K
Sbjct:  122 VLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDT-----AAEKNWQVTAVNILTTTEEG----YRMLFQDLEKKKERLVVVDCESE-RLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLA-------NPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKG-RRTNYTLHVIEMK-HDGIRKIGYWNEDDKF-VPAATDAQAGGDNSSVQNRTYI--VTTILEDPYVML--KKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT----PKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGEC--GSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK 840          
BLAST of Glutamate receptor vs. Ensembl Mouse
Match: Gria2 (glutamate receptor, ionotropic, AMPA2 (alpha 2) [Source:MGI Symbol;Acc:MGI:95809])

HSP 1 Score: 409.068 bits (1050), Expect = 3.027e-128
Identity = 254/754 (33.69%), Postives = 404/754 (53.58%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLPP---DEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSS--------VAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE--------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK--PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLSQ 2568
            +  ++PDL   L++ +  ++W+ F Y+Y  +     +  VL +      +E    VT I +     D+K    T R L Q +    ER++++D + R +V +++  +  +G   + YHY++ N       L   +    N++GF I+DY       FI +W+ L   E   +         A   DA +V+   F N R +      R    DC +       +  V    G ++   +K +   G +G I FD +   R N TI + +    G  +I   S  D+   ++   E     ++  L+N++ V  V TIL +P+VM+    +     G +  EGYC+DLA EI       Y++ +V D  YGA   +   WNGMVGEL+ G ADI IAPLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    ++K++  M+   PSV+ +T  EGV RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT    +    ++  +  A+L+L E+  L KL  KWW  KGEC  +  GS  K   L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K+++
Sbjct:  125 VIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDS-----AAEKKWQVTAINVGNINNDKKD--ETYRSLFQDLELKKERRVILDCE-RDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLA-------NPAVPWGQGVEIERALKQVQVEGLSGNIKFD-QNGKRINYTINIMELKTNGPRKIGYWSEVDKM--VVTLTELPSGNDTSGLENKTVV--VTTILESPYVMM--KKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTE--IAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSS----LRTPVNLAVLKLSEQGVLDKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAK 850          
BLAST of Glutamate receptor vs. Ensembl Mouse
Match: Gria2 (glutamate receptor, ionotropic, AMPA2 (alpha 2) [Source:MGI Symbol;Acc:MGI:95809])

HSP 1 Score: 408.297 bits (1048), Expect = 5.802e-128
Identity = 256/756 (33.86%), Postives = 405/756 (53.57%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLPP---DEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSS--------VAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE--------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK----PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLSQ 2568
            +  ++PDL   L++ +  ++W+ F Y+Y  +     +  VL +      +E    VT I +     D+K    T R L Q +    ER++++D + R +V +++  +  +G   + YHY++ N       L   +    N++GF I+DY       FI +W+ L   E   +         A   DA +V+   F N R +      R    DC +       +  V    G ++   +K +   G +G I FD +   R N TI + +    G  +I   S  D+   ++   E     ++  L+N++ V  V TIL +P+VM+    +     G +  EGYC+DLA EI       Y++ +V D  YGA   +   WNGMVGEL+ G ADI IAPLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    ++K++  M+   PSV+ +T  EGV RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT    +    ++  +  A+L+L E+  L KL  KWW  KGEC   SGG  SK     L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K+++
Sbjct:  125 VIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDS-----AAEKKWQVTAINVGNINNDKKD--ETYRSLFQDLELKKERRVILDCE-RDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLA-------NPAVPWGQGVEIERALKQVQVEGLSGNIKFD-QNGKRINYTINIMELKTNGPRKIGYWSEVDKM--VVTLTELPSGNDTSGLENKTVV--VTTILESPYVMM--KKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTE--IAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSS----LRNAVNLAVLKLNEQGLLDKLKNKWWYDKGEC--GSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAK 850          
BLAST of Glutamate receptor vs. UniProt/SwissProt
Match: sp|P23818|GRIA1_MOUSE (Glutamate receptor 1 OS=Mus musculus OX=10090 GN=Gria1 PE=1 SV=1)

HSP 1 Score: 412.149 bits (1058), Expect = 2.842e-128
Identity = 253/749 (33.78%), Postives = 400/749 (53.40%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPI-YLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQW--------TRLLGDEELSSVAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE--------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK--PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRK 2559
            +  ++P+L   LI+ +  +KW  FVYIY  +     +  VL        +E    VT +  L   E+G     R+L Q + K  ER +VVD +    +  +L  +  L      YHY++ N   M + L+ +K S  N+TGF +++Y        + QW        TR+       + A   D  +V+   F + R +      R    DC +       +  V    G D+   ++ +   G TG + F+ K   R N T+ + +     G   I   N D+ + +    +     ++  ++NR+++  V TIL +P+VML    + +   G    EGYC++LA EI   +  SY + +V D  YGA   +   WNGMVGEL+ G AD+ +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTL+AGSTKE+F  S    + K++  M+   PSV+ +T +EG+ RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT     K   ++  +  A+L+L E+  L KL +KWW  KGEC  +  GS  K   L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K
Sbjct:  122 VLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDT-----AAEKNWQVTAVNILTTTEEG----YRMLFQDLEKKKERLVVVDCESE-RLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLA-------NPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKG-RRTNYTLHVIEMK-HDGIRKIGYWNEDDKF-VPAATDAQAGGDNSSVQNRTYI--VTTILEDPYVML--KKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT----PKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK 840          
BLAST of Glutamate receptor vs. UniProt/SwissProt
Match: sp|P19491|GRIA2_RAT (Glutamate receptor 2 OS=Rattus norvegicus OX=10116 GN=Gria2 PE=1 SV=2)

HSP 1 Score: 409.838 bits (1052), Expect = 1.093e-127
Identity = 257/759 (33.86%), Postives = 406/759 (53.49%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLPP---DEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSS--------VAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE--------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK----PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLSQYPE 2577
            +  ++PDL   L++ +  ++W+ F Y+Y  +     +  VL +      +E    VT I +     D+K    T R L Q +    ER++++D + R +V +++  +  +G   + YHY++ N       L   +    N++GF I+DY       FI +W+ L   E   +         A   DA +V+   F N R +      R    DC +       +  V    G ++   +K +   G +G I FD +   R N TI + +    G  +I   S  D+   ++   E     ++  L+N++ V  V TIL +P+VM+    +     G +  EGYC+DLA EI       Y++ +V D  YGA   +   WNGMVGEL+ G ADI IAPLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    ++K++  M+   PSV+ +T  EGV RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT    +    +   +  A+L+L E+  L KL  KWW  KGEC   SGG  SK     L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K+++ P+
Sbjct:  125 VIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDS-----AAEKKWQVTAINVGNINNDKKD--ETYRSLFQDLELKKERRVILDCE-RDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLA-------NPAVPWGQGVEIERALKQVQVEGLSGNIKFD-QNGKRINYTINIMELKTNGPRKIGYWSEVDKM--VVTLTELPSGNDTSGLENKTVV--VTTILESPYVMM--KKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTE--IAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSS----LGNAVNLAVLKLNEQGLLDKLKNKWWYDKGEC--GSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAKNPQ 853          
BLAST of Glutamate receptor vs. UniProt/SwissProt
Match: sp|P19490|GRIA1_RAT (Glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Gria1 PE=1 SV=2)

HSP 1 Score: 410.223 bits (1053), Expect = 1.301e-127
Identity = 255/751 (33.95%), Postives = 400/751 (53.26%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPI-YLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQW--------TRLLGDEELSSVAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE--------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK----PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRK 2559
            +  ++P+L   LI+ +  +KW  FVYIY  +     +  VL        +E    VT +  L   E+G     R+L Q + K  ER +VVD +    +  +L  +  L      YHY++ N   M + L+ +K S  N+TGF +++Y        + QW        TR+       + A   D  +V+   F + R +      R    DC +       +  V    G D+   ++ +   G TG + F+ K   R N T+ + +     G   I   N D+ + +    +     ++  ++NR+++  V TIL +P+VML    + +   G    EGYC++LA EI   +  SY + +V D  YGA   +   WNGMVGEL+ G AD+ +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTL+AGSTKE+F  S    + K++  M+   PSV+ +T +EG+ RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT     K   ++  +  A+L+L E+  L KL  KWW  KGEC   SGG  SK     L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K
Sbjct:  122 VLQLRPELQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDT-----AAEKNWQVTAVNILTTTEEG----YRMLFQDLEKKKERLVVVDCESE-RLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDSRDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLA-------NPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKG-RRTNYTLHVIEMK-HDGIRKIGYWNEDDKF-VPAATDAQAGGDNSSVQNRTYI--VTTILEDPYVML--KKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT----PKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGEC--GSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK 840          
BLAST of Glutamate receptor vs. UniProt/SwissProt
Match: sp|Q38PU8|GRIA1_MACFA (Glutamate receptor 1 OS=Macaca fascicularis OX=9541 GN=GRIA1 PE=2 SV=1)

HSP 1 Score: 410.223 bits (1053), Expect = 1.471e-127
Identity = 255/751 (33.95%), Postives = 400/751 (53.26%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPI-YLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQW--------TRLLGDEELSSVAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE--------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK----PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRK 2559
            +  ++P+L   LI+ +  +KW  FVYIY  +     +  VL        +E    VT +  L   E+G     R+L Q + K  ER +VVD +    +  +L  +  L      YHY++ N   M + L+ +K S  N+TGF +++Y        + QW        TR+       + A   D  +V+   F + R +      R    DC +       +  V    G D+   ++ +   G TG + F+ K   R N T+ + +     G   I   N D+ + +    +     ++  ++NR+++  V TIL +P+VML    + +   G    EGYC++LA EI   +  SY + +V D  YGA   +   WNGMVGEL+ G AD+ +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTL+AGSTKE+F  S    + K++  M+   PSV+ +T +EG+ RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT     K   ++  +  A+L+L E+  L KL  KWW  KGEC   SGG  SK     L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K
Sbjct:  122 VLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDT-----AAEKNWQVTAVNILTTTEEG----YRMLFQDLEKKKERLVVVDCESE-RLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLA-------NPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKG-RRTNYTLHVIEMK-HDGIRKIGYWNEDDKF-VPAATDAQAGGDNSSVQNRTYI--VTTILEDPYVML--KKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT----PKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGEC--GSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK 840          
BLAST of Glutamate receptor vs. UniProt/SwissProt
Match: sp|P42261|GRIA1_HUMAN (Glutamate receptor 1 OS=Homo sapiens OX=9606 GN=GRIA1 PE=1 SV=2)

HSP 1 Score: 410.223 bits (1053), Expect = 1.471e-127
Identity = 255/751 (33.95%), Postives = 400/751 (53.26%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPI-YLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQW--------TRLLGDEELSSVAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE--------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK----PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRK 2559
            +  ++P+L   LI+ +  +KW  FVYIY  +     +  VL        +E    VT +  L   E+G     R+L Q + K  ER +VVD +    +  +L  +  L      YHY++ N   M + L+ +K S  N+TGF +++Y        + QW        TR+       + A   D  +V+   F + R +      R    DC +       +  V    G D+   ++ +   G TG + F+ K   R N T+ + +     G   I   N D+ + +    +     ++  ++NR+++  V TIL +P+VML    + +   G    EGYC++LA EI   +  SY + +V D  YGA   +   WNGMVGEL+ G AD+ +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTL+AGSTKE+F  S    + K++  M+   PSV+ +T +EG+ RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT     K   ++  +  A+L+L E+  L KL  KWW  KGEC   SGG  SK     L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K
Sbjct:  122 VLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDT-----AAEKNWQVTAVNILTTTEEG----YRMLFQDLEKKKERLVVVDCESE-RLNAILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLA-------NPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKG-RRTNYTLHVIEMK-HDGIRKIGYWNEDDKF-VPAATDAQAGGDNSSVQNRTYI--VTTILEDPYVML--KKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT----PKGSALRNPVNLAVLKLNEQGLLDKLKNKWWYDKGEC--GSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK 840          
BLAST of Glutamate receptor vs. TrEMBL
Match: A0A068Y848 (Glutamate receptor 2 OS=Echinococcus multilocularis OX=6211 PE=3 SV=1)

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 329/799 (41.18%), Postives = 463/799 (57.95%), Query Frame = 1
Query:  325 PFITWSPLYNLPNVAGNQNSETCRIFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLH-------------------NLYGHETSEDLLDVTPIYLPPDEKGIFHT-LRILDQKISKMNERKIVVDL---------DGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSSVAFILDAFRVLQSL--FNNNRFRNPSAPNREIDCTSFF-TFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETW-------------DIMLNNEKNPNEESMHLKN-------RSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDEA-----FNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQ 2550
            P+ITW  + +   +        CR+FSV+PD+T PL++FL+ W W  F Y+Y    +F R+  +                     N     T   L  +   Y+  D + + HT L+ +D  +S   ER +V+DL          GR  +E L+   + +GM+R EY+YL+V+F I +L L  +  S VN TGFH LDY  +    F  +W  +     L ++A I+DA  V  SL     N       PN    C +   T  + S   +   G  +  ++ S   VGQTG I FD +TC R +  ++L+   G+    IIAK +    W              I  +  K    E +   N       R+  ++VVT+L+ PF+M A+     +  G+ N  GYC DLA+ IF  +N +YEIHLVKD  +G        WNGMVGE++R +AD++IAPLT+++ RAKFI F+EPFM FGL+LI++KP +TKPG+FSF+ P+++ VW+    A + +++GLR+IA ISP E  R  A     FN+GN  WF+ A+ V QG +IFP SPGAR+ ASIW    LV +AYYTANLAA LSV  LISPI  I D  E++DL I++GTLD+G+TK++FA +    Y  V+  M+++PSVY  T+  G +RVR +   Y F+ ESKM EY N++ PCDTMMVGS FGSKAYAV   +N  +M  +KE +TDAIL+LRE Q LAKLY +WWI+KGEC+   G   S+PLAL NLSGVFYIL  G++L++ +G+  F++KL + KQ
Sbjct:  114 PYITWDEIPSTFKLPFEAEDSRCRLFSVRPDVTQPLMDFLITWNWKTFAYLYGSMDAFRRLQFISQKVSDVEISISRSSGGASPRNFQEKTTRRVLPPIMSGYVDVDNEDVMHTTLKSVDAYLSTKAERNVVIDLGKPKTSLSLSGRDRLETLVTWFRRMGMMRSEYNYLLVDFDIYELSLEEFLRSGVNFTGFHFLDYQDEVVLKFAEEWESI--QIPLHNIASIMDALEVGWSLKKATENGLWKSRDPNLRSKCFTLSGTLVSASFVQQWQPGDRVKSWLTSTEIVGQTGLIRFDERTCQRADYNLLLSSAFGEKRDRIIAKWSRHSGWVLPSLSTHLGYFHQIAFSGLKEKILEPLDYNNLLDIYRLRNKTLRVVTVLSKPFIMFANPEVTGATSGRDNFVGYCKDLADHIFYYLNLNYEIHLVKDGKFGTIDAATGEWNGMVGEVLRDEADLIIAPLTMNTIRAKFIDFSEPFMNFGLALIIRKPGKTKPGMFSFLSPLTNAVWLRMVGATIVVSLGLRLIAAISPKE--RAPANPALGFNLGNCIWFAVASFVHQGIDIFPVSPGARVFASIWRYVCLVVMAYYTANLAAALSVERLISPINSIKDFAEREDLPIQIGTLDSGATKDFFAHAEDSLYKTVFNRMERDPSVYVPTLAAGFERVRTK--PYAFVAESKMIEYINHRQPCDTMMVGSTFGSKAYAVGLPANKPEMRILKEHVTDAILRLRENQKLAKLYKEWWIEKGECMQGGGQQTSEPLALINLSGVFYILIGGMVLAMAVGVIVFVFKLRKTKQ 906          
BLAST of Glutamate receptor vs. TrEMBL
Match: W6UAG0 (Glutamate receptor OS=Echinococcus granulosus OX=6210 GN=EGR_09711 PE=3 SV=1)

HSP 1 Score: 578.17 bits (1489), Expect = 0.000e+0
Identity = 327/799 (40.93%), Postives = 464/799 (58.07%), Query Frame = 1
Query:  325 PFITWSPLYNLPNVAGNQNSETCRIFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLH-------------------NLYGHETSEDLLDVTPIYLPPDEKGIFHT-LRILDQKISKMNERKIVVDL---------DGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSSVAFILDAFRVLQSL--FNNNRFRNPSAPNREIDCTSFF-TFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETW-------------DIMLNNEKNPNEESMHLKN-------RSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDEA-----FNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQ 2550
            P+ITW  + +   +  +     CR+FSV+PD+T PL++FL+ W W  F Y+Y    +F R+  +                     N     T   L  +   Y+  D + + HT L+ +D  +S   ER +V+DL          GR  +E L+   + +GM+R EY+YL+V+F I +L L  +  S VN TGFH LDY  +    F  +W  +     L ++A I+DA  V  SL     N       PN    C +   T  + S   +   G  +  ++ S   VGQTG I FD +TC R +  ++L+   G+    IIAK +    W              I  +  K    E +   N       R+  ++VVT+L+ PF+M A+     +  G+ N  GYC DLA+ IF  +N +YEIHLVKD  +G        WNGMVGE++R +AD++IAPLT+++ RAKFI F+EPFM FGL+LI++KP +TKPG+FSF+ P+++ VW+    A + +++GLR+IA ISP E  R  A     FN+GN  WF+ A+ V QG +IFP SPGAR+ ASIW    LV +AYYTANLAA LSV  LISPI  I D  E++DL I++GTLD+G+TK++FA +    Y  V+  M+++PSVY  T+  G +R+R +   Y F+ ESKM EY N++ PCDTMMVGS FGSKAYAV   +N  +M  +KE +TDAIL+LRE Q LAKLY +WWI+KGEC+   G   S+PLAL NLSGVFYIL  G++L++ +G+  F++KL + K+
Sbjct:  138 PYITWDEIPSTFKLPFDAEDSRCRLFSVRPDVTQPLMDFLITWNWKTFAYLYGSMDAFRRLQFISQKVSDVEISIGRSSGGASPRNFQEKTTRRVLPPIMSGYVDVDNEEVMHTTLKSVDAYLSTKAERNVVIDLGKPKTSLSLSGRERLEALVTWFRRMGMMRSEYNYLLVDFDIYELSLEEFLRSGVNFTGFHFLDYQDEVVLKFAEEWESI--QIPLHNIASIMDALEVGWSLKKATENGLWKSRDPNLRSKCFTLSGTLVSASFVQQWQPGDRVKSWLTSTEIVGQTGLIRFDERTCQRTDYNLLLSSAFGEKRDRIIAKWSRHSGWVLPSLSTHLGFFHQIAFSGLKEKILEPLDYNNLLDIYRLRNKTLRVVTVLSKPFIMFANPEVTGATSGRDNFVGYCKDLADHIFYYLNLNYEIHLVKDGKFGTIDAATGEWNGMVGEVLRDEADLIIAPLTMNTIRAKFIDFSEPFMNFGLALIIRKPGKTKPGMFSFLSPLTNAVWLRMAGATIVVSLGLRLIAAISPKE--RAPANPALGFNLGNCIWFAVASFVHQGIDIFPVSPGARVFASIWRYVCLVVMAYYTANLAAALSVERLISPINSIKDFAEREDLPIQIGTLDSGATKDFFAHAEDSLYKTVFNRMERDPSVYVPTLAAGFERIRTK--PYAFVAESKMIEYINHRQPCDTMMVGSTFGSKAYAVGLPANKPEMRILKEHVTDAILRLRENQKLAKLYKEWWIEKGECMQGGGQQTSEPLALINLSGVFYILIGGMVLAMAVGVIVFVFKLRKTKR 930          
BLAST of Glutamate receptor vs. TrEMBL
Match: A0A068WKI3 (Glutamate receptor 2 OS=Echinococcus granulosus OX=6210 GN=EgrG_000587400 PE=3 SV=1)

HSP 1 Score: 577.015 bits (1486), Expect = 0.000e+0
Identity = 327/799 (40.93%), Postives = 464/799 (58.07%), Query Frame = 1
Query:  325 PFITWSPLYNLPNVAGNQNSETCRIFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLH-------------------NLYGHETSEDLLDVTPIYLPPDEKGIFHT-LRILDQKISKMNERKIVVDL---------DGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSSVAFILDAFRVLQSL--FNNNRFRNPSAPNREIDCTSFF-TFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETW-------------DIMLNNEKNPNEESMHLKN-------RSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDEA-----FNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQ 2550
            P+ITW  + +   +  +     CR+FSV+PD+T PL++FL+ W W  F Y+Y    +F R+  +                     N     T   L  +   Y+  D + + HT L+ +D  +S   ER +V+DL          GR  +E L+   + +GM+R EY+YL+V+F I +L L  +  S VN TGFH LDY  +    F  +W  +     L ++A I+DA  V  SL     N       PN    C +   T  + S   +   G  +  ++ S   VGQTG I FD +TC R +  ++L+   G+    IIAK +    W              I  +  K    E +   N       R+  ++VVT+L+ PF+M A+     +  G+ N  GYC DLA+ IF  +N +YEIHLVKD  +G        WNGMVGE++R +AD++IAPLT+++ RAKFI F+EPFM FGL+LI++KP +TKPG+FSF+ P+++ VW+    A + +++GLR+IA ISP E  R  A     FN+GN  WF+ A+ V QG +IFP SPGAR+ ASIW    LV +AYYTANLAA LSV  LISPI  I D  E++DL I++GTLD+G+TK++FA +    Y  V+  M+++PSVY  T+  G +R+R +   Y F+ ESKM EY N++ PCDTMMVGS FGSKAYAV   +N  +M  +KE +TDAIL+LRE Q LAKLY +WWI+KGEC+   G   S+PLAL NLSGVFYIL  G++L++ +G+  F++KL + K+
Sbjct:  114 PYITWDEIPSTFKLPFDAEDSRCRLFSVRPDVTQPLMDFLITWNWKTFAYLYGSMDAFRRLQFISQKVSDVEISIGRSSGGASPRNFQEKTTRRVLPPIMSGYVDVDNEEVMHTTLKSVDAYLSTKAERNVVIDLGKPKTSLSLSGRERLEALVTWFRRMGMMRSEYNYLLVDFDIYELSLEEFLRSGVNFTGFHFLDYQDEVVLKFAEEWESI--QIPLHNIASIMDALEVGWSLKKATENGLWKSRDPNLRSKCFTLSGTLVSASFVQQWQPGDRVKSWLTSTEIVGQTGLIRFDERTCQRTDYNLLLSSAFGEKRDRIIAKWSRHSGWVLPSLSTHLGFFHQIAFSGLKEKILEPLDYNNLLDIYRLRNKTLRVVTVLSKPFIMFANPEVTGATSGRDNFVGYCKDLADHIFYYLNLNYEIHLVKDGKFGTIDAATGEWNGMVGEVLRDEADLIIAPLTMNTIRAKFIDFSEPFMNFGLALIIRKPGKTKPGMFSFLSPLTNAVWLRMAGATIVVSLGLRLIAAISPKE--RAPANPALGFNLGNCIWFAVASFVHQGIDIFPVSPGARVFASIWRYVCLVVMAYYTANLAAALSVERLISPINSIKDFAEREDLPIQIGTLDSGATKDFFAHAEDSLYKTVFNRMERDPSVYVPTLAAGFERIRTK--PYAFVAESKMIEYINHRQPCDTMMVGSTFGSKAYAVGLPANKPEMRILKEHVTDAILRLRENQKLAKLYKEWWIEKGECMQGGGQQTSEPLALINLSGVFYILIGGMVLAMAVGVIVFVFKLRKTKR 906          
BLAST of Glutamate receptor vs. TrEMBL
Match: A0A0R3U5H3 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS1973 PE=3 SV=1)

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 314/784 (40.05%), Postives = 461/784 (58.80%), Query Frame = 1
Query:  325 PFITWSPLYNLPNVAGNQNSETCRIFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPI----YLPPDEKGIFH-TLRILDQKISKMNERKIVVDL---------DGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSSVAFILDAFRV---LQSLFNNNRFRNPSAPNREIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPN--------------EESMHLKN-------RSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE---AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQK 2553
            P+ITW  +  L       +   C++FSV+PD+T  L++FLV W W  F Y+Y    +F R+  +   +   +   D     P+    Y+  ++  + H TL+ +D  +S   ER +++D+          GR  +E +   L  +GM+R EY+YL+V+F I +L L  Y+   VN+TGFH LDY +   R F  +W        L  +AF++DA  V   L+   +   + N  A  +    TS     +     +   G  +  ++   +  GQTG +  D +TC R +  ++L+   G+    IIAK +   +W ++     NP                ES++  N       ++  ++VV++L+ PF+M A+     +  G+ N  GYC DLA+ IF  +N +YEIHLVKD  +G        WNGMVGE++R +AD++IAPLT++  RA FI F+EPFM FGLSL+++KP +TKPG+FSF+ P+++ VW+    A + + +GLR+IA ISP E    +    FN+GN  WFS A+ V QG +IFP SPGAR+ ASIW    LV +AYYTANLAA LSV  LISPI  I D  E+ DL I++GTLD+G+TK++FA +    +  +Y+ M+++PSVY  T+  G +RVR +   Y F+ ESKM EY N++ PCDTMMVG+ FGSKAYAV   SN  +M  +KE +TDAIL+LRE Q LAKLY +WW++KGEC+       S+PLAL NLSGVFYIL  G++LS+ +G+  F+Y+LH  K++
Sbjct:  112 PYITWDAI-TLSFEPPASSPRDCKMFSVRPDVTQALVDFLVTWNWKTFAYLYGSANAFKRLQYISQRVAPQQVQGDNDRTLPLMTSGYVGVEDPEVIHKTLKAVDTFLSTKAERNVIIDIGRSVMDQGRSGRDRLETIFMWLSRMGMMRTEYNYLLVDFNIFELSLDDYQRGGVNVTGFHFLDYQNDAVRKFAARWND--SKLPLHDIAFMMDALEVAWGLKKATDRGLWNNRDADAKSTCFTSSGALVSEPSIQRWQPGDRIKSWLTQTDISGQTGLVRLDRQTCQRTDYNLLLSSAFGKLPDRIIAKWSRHSSW-VLPTQSTNPGFFHLNVFPTLKEKIAESVNYNNLLEIFRLQNRTLRVVSVLSKPFIMYANPEVVGATSGRHNFVGYCKDLADHIFARLNLNYEIHLVKDGKFGTIDPATGEWNGMVGEVLRDEADLIIAPLTMNIIRATFIDFSEPFMNFGLSLMLRKPGKTKPGMFSFLSPLTNAVWLRMAGATIVVGLGLRLIAAISPKERSPADPSLGFNLGNCMWFSVASFVHQGIDIFPVSPGARVFASIWRYVCLVVMAYYTANLAAALSVERLISPINSIKDFAERDDLPIQIGTLDSGATKDFFAHAEGSFFKTIYQKMERDPSVYVPTMAAGFERVRTK--PYAFVAESKMIEYINHRQPCDTMMVGNTFGSKAYAVGLPSNRPEMRILKEHVTDAILRLRENQVLAKLYKEWWVEKGECVEGGEQQTSEPLALINLSGVFYILIVGMVLSVTIGVIVFIYQLHNSKKR 889          
BLAST of Glutamate receptor vs. TrEMBL
Match: A0A0R3WBX1 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS8163 PE=3 SV=1)

HSP 1 Score: 572.007 bits (1473), Expect = 0.000e+0
Identity = 327/797 (41.03%), Postives = 467/797 (58.59%), Query Frame = 1
Query:  325 PFITWSPLYNLPNVAGNQNSETCRIFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHN------LYGHE-------------TSEDLLDVTPIYLPPDEKGIFHT-LRILDQKISKMNERKIVVDL---------DGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSSVAFILDAFRVLQSL--FNNNRFRNPSAPNREIDCTSFF-TFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETW-------------DIMLNNEKNPNEESMHLKN-------RSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEW---KRDEAFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQ 2550
            P+ITW  + ++  +  +     CR+FSV+PD+T PL++FL+ W W  F Y+Y    +F R+  V         L G               T   L  +   Y+  D++ + HT L+ +D  +S   ER +V+DL          GR  ++ L+   + +GM+R EY+YL+V+F I +L L  +  S VN TGFH LDY  +    F  +W  +     L ++A I+DA  V  SL     N       PN +  C +   T  + S+      G  +  ++ S   VGQTG I FD +TC R N  ++L+   G+    IIAK +    W              I  +  K    E +   N       R+  ++VVT+L+ PF+MLA+     +  G+ N  GYC DLA+ IF  +N +YEIHLVKD  +G        WNGMVGE++R +AD++IAPLT+++ RAK I F+EPFM FGL+LI++KP +TKPG+FSF+ P+++ VW+    A + +++GLR+IA ISP E      +  FN+GN  WFS A+ V QG +IFP SPGAR+ ASIW    LV +AYYTANLAA LSV  LISPI  I D  E++DL I++GTLD+G+TK++FA +    Y  V++ M+++PSVY  T+  G +RVR +   Y F+ ESKM EY N++ PCDTMMVGS FGSKAYAV   +N  +M  +KE +TDAIL+LRE Q LAKLY +WWI+KGEC+       S+PLAL NLSGVFYIL  G++L++ +G+  F+++L + K+
Sbjct:  114 PYITWDEIPSVFKLPFDAEDSRCRLFSVRPDVTQPLMDFLITWNWKTFAYLYGSMDAFRRLQFVSQKVSDTGFLMGRSSGGASPRFFQEKGTRRVLPSIMSGYVDVDDEEVMHTTLKSIDAYLSTKAERNVVIDLGKPKTSQSMSGRKRLDALVTWFRRMGMMRSEYNYLLVDFDIYELSLDEFLRSGVNFTGFHFLDYQDEVVLKFAEEWKGV--HIPLHNIASIMDALEVGWSLKKATENGLWKSWDPNVKSKCFTLSGTLVSASLVQHWQLGGRVKSWLTSTEIVGQTGLIRFDERTCQRTNYNLLLSSAFGEKKDRIIAKWSRHSGWVLPSLSTHLGFFHQITFSGLKEKIFEPLGYNNLLDVYRLRNKTLRVVTVLSKPFIMLANPEVTGATSGRDNFVGYCKDLADHIFYHLNLNYEIHLVKDGKFGTIDPATGEWNGMVGEVLRDEADLIIAPLTMNTIRAKVIDFSEPFMNFGLALIIRKPGKTKPGMFSFLSPLTNAVWLRMAGATVAVSLGLRLIAAISPKEGDPANPELGFNLGNCIWFSVASFVHQGIDIFPVSPGARVFASIWRYVCLVVMAYYTANLAAALSVERLISPIDSIKDFAEREDLPIQIGTLDSGATKDFFAHAEDSLYKTVFKRMERDPSVYVPTLAAGFERVRVK--PYAFVAESKMIEYINHRQPCDTMMVGSTFGSKAYAVGLPANKPEMRILKEHVTDAILRLRENQKLAKLYKEWWIEKGECMEGGEQQTSEPLALINLSGVFYILIGGMVLAMAVGVIVFVFQLRKAKR 906          
BLAST of Glutamate receptor vs. Ensembl Cavefish
Match: gria3a (glutamate receptor 3 [Source:NCBI gene;Acc:103044872])

HSP 1 Score: 412.149 bits (1058), Expect = 7.721e-130
Identity = 255/753 (33.86%), Postives = 398/753 (52.86%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSSV---------AFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDEA---------------FNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK--PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLSQ 2568
            +  ++P L   L++ L  ++W+ FVY+Y  E  F  +  ++ +   +        V  I  P +        R + +++ +  E++ ++D +    +  ++  +   G   + YHY++ N     + +    S   NITGF I++  +   + F+ +W RL  + E             A   DA  V+   F   R +      R    DC +       +  V  + G D+   +K +   G TG I FD+    R N TI + +    GG   I   N  E +  ++  E     ES  ++NR+  I V TI+  P+VM     +     G +  EGYC+DLA EI   +   Y++ +V D  YGA   E  TWNGMVGEL+ G ADI +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  D++               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    Y K++  M+   PSV+ KT  +GV RVR+ +GK+ F+LES MNEY   + PCDTM VG    SK Y VAT     K   ++  +  A+L+L E+  L KL  KWW  KGEC  +  GS  K   L+L+N++GVFYIL  G+ L++ + L +F YK  Q  ++ KL++
Sbjct:   98 VLQMRPSLKGALLSLLGHYRWDRFVYLYDTERGFSMLQAIMESAVANNWQVTARSVGNIVDPLE-------FRRIIEEMDRRQEKRFLIDCE-VERINAIMEQVVTSGKNSRGYHYILANLGFSNMSVDKVFSGGANITGFQIINPENPIVQQFLQRWDRL-DEREFPDAKNTPLKYTSALTHDAILVIAEAFRYLRRQRVDISRRGSAGDCLA-------NPAVPWSQGIDIERALKMVQVQGMTGNIQFDS-FGRRSNYTIDVYEMK-PGGARKIGYWNEYEKFVYIV--ELQVTNESSSVENRT--IVVTTIMEAPYVMY--KRNYMQLEGNERYEGYCVDLASEIAKHVGIKYKLSIVADGKYGARDPETRTWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLDDSDEAKDPQSPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFAKTTPDGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVAT----PKGSALRTPVNLAVLKLSEQGILDKLKNKWWYDKGECGTKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMTVALVEFCYKSRQETKRLKLAK 820          
BLAST of Glutamate receptor vs. Ensembl Cavefish
Match: gria3a (glutamate receptor 3 [Source:NCBI gene;Acc:103044872])

HSP 1 Score: 412.535 bits (1059), Expect = 1.108e-129
Identity = 255/753 (33.86%), Postives = 398/753 (52.86%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSSV---------AFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDEA---------------FNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK--PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLSQ 2568
            +  ++P L   L++ L  ++W+ FVY+Y  E  F  +  ++ +   +        V  I  P +        R + +++ +  E++ ++D +    +  ++  +   G   + YHY++ N     + +    S   NITGF I++  +   + F+ +W RL  + E             A   DA  V+   F   R +      R    DC +       +  V  + G D+   +K +   G TG I FD+    R N TI + +    GG   I   N  E +  ++  E     ES  ++NR+  I V TI+  P+VM     +     G +  EGYC+DLA EI   +   Y++ +V D  YGA   E  TWNGMVGEL+ G ADI +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  D++               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    Y K++  M+   PSV+ KT  +GV RVR+ +GK+ F+LES MNEY   + PCDTM VG    SK Y VAT     K   ++  +  A+L+L E+  L KL  KWW  KGEC  +  GS  K   L+L+N++GVFYIL  G+ L++ + L +F YK  Q  ++ KL++
Sbjct:  131 VLQMRPSLKGALLSLLGHYRWDRFVYLYDTERGFSMLQAIMESAVANNWQVTARSVGNIVDPLE-------FRRIIEEMDRRQEKRFLIDCE-VERINAIMEQVVTSGKNSRGYHYILANLGFSNMSVDKVFSGGANITGFQIINPENPIVQQFLQRWDRL-DEREFPDAKNTPLKYTSALTHDAILVIAEAFRYLRRQRVDISRRGSAGDCLA-------NPAVPWSQGIDIERALKMVQVQGMTGNIQFDS-FGRRSNYTIDVYEMK-PGGARKIGYWNEYEKFVYIV--ELQVTNESSSVENRT--IVVTTIMEAPYVMY--KRNYMQLEGNERYEGYCVDLASEIAKHVGIKYKLSIVADGKYGARDPETRTWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLDDSDEAKDPQSPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFAKTTPDGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVAT----PKGSALRTPVNLAVLKLSEQGILDKLKNKWWYDKGECGTKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMTVALVEFCYKSRQETKRLKLAK 853          
BLAST of Glutamate receptor vs. Ensembl Cavefish
Match: gria3a (glutamate receptor 3 [Source:NCBI gene;Acc:103044872])

HSP 1 Score: 412.149 bits (1058), Expect = 1.802e-129
Identity = 255/753 (33.86%), Postives = 398/753 (52.86%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSSV---------AFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDEA---------------FNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK--PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLSQ 2568
            +  ++P L   L++ L  ++W+ FVY+Y  E  F  +  ++ +   +        V  I  P +        R + +++ +  E++ ++D +    +  ++  +   G   + YHY++ N     + +    S   NITGF I++  +   + F+ +W RL  + E             A   DA  V+   F   R +      R    DC +       +  V  + G D+   +K +   G TG I FD+    R N TI + +    GG   I   N  E +  ++  E     ES  ++NR+  I V TI+  P+VM     +     G +  EGYC+DLA EI   +   Y++ +V D  YGA   E  TWNGMVGEL+ G ADI +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  D++               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    Y K++  M+   PSV+ KT  +GV RVR+ +GK+ F+LES MNEY   + PCDTM VG    SK Y VAT     K   ++  +  A+L+L E+  L KL  KWW  KGEC  +  GS  K   L+L+N++GVFYIL  G+ L++ + L +F YK  Q  ++ KL++
Sbjct:  132 VLQMRPSLKGALLSLLGHYRWDRFVYLYDTERGFSMLQAIMESAVANNWQVTARSVGNIVDPLE-------FRRIIEEMDRRQEKRFLIDCE-VERINAIMEQVVTSGKNSRGYHYILANLGFSNMSVDKVFSGGANITGFQIINPENPIVQQFLQRWDRL-DEREFPDAKNTPLKYTSALTHDAILVIAEAFRYLRRQRVDISRRGSAGDCLA-------NPAVPWSQGIDIERALKMVQVQGMTGNIQFDS-FGRRSNYTIDVYEMK-PGGARKIGYWNEYEKFVYIV--ELQVTNESSSVENRT--IVVTTIMEAPYVMY--KRNYMQLEGNERYEGYCVDLASEIAKHVGIKYKLSIVADGKYGARDPETRTWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLDDSDEAKDPQSPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFAKTTPDGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVAT----PKGSALRTPVNLAVLKLSEQGILDKLKNKWWYDKGECGTKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMTVALVEFCYKSRQETKRLKLAK 854          
BLAST of Glutamate receptor vs. Ensembl Cavefish
Match: gria3a (glutamate receptor 3 [Source:NCBI gene;Acc:103044872])

HSP 1 Score: 410.994 bits (1055), Expect = 1.888e-129
Identity = 257/755 (34.04%), Postives = 399/755 (52.85%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSSV---------AFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDEA---------------FNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK----PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLSQ 2568
            +  ++P L   L++ L  ++W+ FVY+Y  E  F  +  ++ +   +        V  I  P +        R + +++ +  E++ ++D +    +  ++  +   G   + YHY++ N     + +    S   NITGF I++  +   + F+ +W RL  + E             A   DA  V+   F   R +      R    DC +       +  V  + G D+   +K +   G TG I FD+    R N TI + +    GG   I   N  E +  ++  E     ES  ++NR+  I V TI+  P+VM     +     G +  EGYC+DLA EI   +   Y++ +V D  YGA   E  TWNGMVGEL+ G ADI +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  D++               F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    Y K++  M+   PSV+ KT  +GV RVR+ +GK+ F+LES MNEY   + PCDTM VG    SK Y VAT     K   ++  +  A+L+L E+  L KL  KWW  KGEC   SGG  SK     L+L+N++GVFYIL  G+ L++ + L +F YK  Q  ++ KL++
Sbjct:   98 VLQMRPSLKGALLSLLGHYRWDRFVYLYDTERGFSMLQAIMESAVANNWQVTARSVGNIVDPLE-------FRRIIEEMDRRQEKRFLIDCE-VERINAIMEQVVTSGKNSRGYHYILANLGFSNMSVDKVFSGGANITGFQIINPENPIVQQFLQRWDRL-DEREFPDAKNTPLKYTSALTHDAILVIAEAFRYLRRQRVDISRRGSAGDCLA-------NPAVPWSQGIDIERALKMVQVQGMTGNIQFDS-FGRRSNYTIDVYEMK-PGGARKIGYWNEYEKFVYIV--ELQVTNESSSVENRT--IVVTTIMEAPYVMY--KRNYMQLEGNERYEGYCVDLASEIAKHVGIKYKLSIVADGKYGARDPETRTWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLDDSDEAKDPQSPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFAKTTPDGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVAT----PKGSALRSAVNLAVLKLNEQGLLDKLKNKWWYDKGEC--GSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMTVALVEFCYKSRQETKRLKLAK 820          
BLAST of Glutamate receptor vs. Ensembl Cavefish
Match: GRIA2 (glutamate ionotropic receptor AMPA type subunit 2 [Source:NCBI gene;Acc:103039282])

HSP 1 Score: 410.223 bits (1053), Expect = 2.636e-129
Identity = 256/753 (34.00%), Postives = 407/753 (54.05%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLP--PDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLL------GDEELS-SVAFILDAFRVLQSLFN--NNRFRNPSAPNREIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE-------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK----PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLSQ 2568
            I  ++PD+  PL++ +  +KW+ F Y+Y  +     +  VL        +E    VT I +    DE+      R L Q +    ER++++D + + +V++++  +  +G   + YHY++ N   +   LS  +    N++GF I+D+       F  +W  L        D ++  + A   DA +V+   F   N +  + S      DC +       +  V    G ++   +K +   G TG I FD +   R N T+ + +    G  +I   +  D+    +  ++  PN+ +M L+N++ +  V TIL  P+VML  ++           EGYC+DLA EI       Y + +V D  YGA   E   WNGMVGEL+ G ADI +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E              F + NS WFS  A +RQG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    ++K++  M+   PSV+ KT  EGV RVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT    +    ++  +  A+L+L E+  L KL  KWW  KGEC   SGG  SK     L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K+++
Sbjct:   78 IIQMRPDIKGPLLSLIEYYKWDKFAYLYDSDRGLTTLQVVLDT-----AAERKWQVTAINVGNMKDERKD-EAYRSLFQDLENKKERRVILDCE-QDKVKDIMEQIITIGRHVKGYHYIIANLGFVDGDLSKIQYGGANVSGFQIVDFEDPLVSKFDQRWEALEEKEYPGADSKIRYTSALTYDAVQVMTEAFRYLNKQHIDISRRANNGDCLA-------NPAVPWAQGVEIERALKQVRVEGLTGNIQFD-QYGRRVNYTVNVMELKNNGPVKIGYWNEVDKM--AVTKSDLFPND-TMGLENKTVI--VTTILEAPYVMLKKNADLFMDNE--RYEGYCVDLAAEIAKHCGFKYRLKIVGDGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEYEDGQIQTNESTNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLDSGSTKEFFRRSKIALFDKMWTYMRSAEPSVFVKTTAEGVLRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSS----LRNAVNLAVLKLNEQGLLDKLKNKWWYDKGEC--GSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALVEFCYKSRAEAKRMKVAK 800          
BLAST of Glutamate receptor vs. Ensembl Sea Lamprey
Match: gria1b (glutamate receptor, ionotropic, AMPA 1b [Source:ZFIN;Acc:ZDB-GENE-020125-2])

HSP 1 Score: 338.961 bits (868), Expect = 1.512e-106
Identity = 190/488 (38.93%), Postives = 275/488 (56.35%), Query Frame = 1
Query: 1225 IMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE-------------------------------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK----PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKL 2562
            ++ N E      S    NR+ +  V TIL  P+ ML    +     G    EGYC+DL +EI       Y+  +V D  YGA   +   WNGMVGEL+ G ADI IAPLT+S  R + I F++PFM+ G+S+++KKP ++KPGV SF+ P++  +W+C   A + +++ L +++  SPYEW+RD+                                      F + NS WFS  A ++QG EI P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    Y K++  M+   P V+ +T  +GV RVR+ +GKY ++LES  NEY   + PCDTM VG    SK Y +AT     K   +++ +  A+L+L E+  L KL  KWW  KGEC   SGG  SK     L+L+N++GVFYIL  G+ L++++ L +F YK     ++ KL
Sbjct:   13 VITNQEMLGRNGSGKTGNRTVI--VTTILDAPYFML--KKNHEQFEGNDKYEGYCVDLGQEIAIHEQFEYKWSVVPDGAYGARNPDTKVWNGMVGELVYGRADIAIAPLTISLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVISFLDPLAYEIWMCIIFAYIGVSVVLFLVSRFSPYEWQRDDDTDVEPNGNGGAGGGGGGGGSGGGAGGGSGGGGEPPNEFGIFNSLWFSLGAFMQQGCEISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTE--IAYGTLDSGSTKEFFQRSKIGVYEKMWLFMKDAEPKVFVRTNADGVSRVRKSKGKYAYLLESTTNEYTEQRKPCDTMKVGGNLDSKGYGIAT----PKGSALRDAVNLAVLKLNEQGLLDKLKNKWWYDKGEC--GSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRTEAKRMKL 488          
BLAST of Glutamate receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 218.009 bits (554), Expect = 4.390e-64
Identity = 124/332 (37.35%), Postives = 184/332 (55.42%), Query Frame = 1
Query: 1528 ADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKR-----------DEAFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASKPLALANLSGVFYILFFGI 2490
            AD+ +APLT++  R K I F++PFMT G+S++ +KP  T PG+FSF+ P+S ++W+    A L ++  L VIA  SPYEW             +  F M NSFWF   A+++QG+E+ PK+   RI+  IWW F+L+ I+ YTANLAAFL+V  + SPI+   DL   K   I+ G +  GST  +F  S    Y K++  M    +   K  +EG+QRV      Y  ++ES   EY   ++ C+   +G +  +K Y + T          +++IT AILQL+E+  L  +  KWW   G C  E    AS  L + N+ G+F +L  G+
Sbjct:   10 ADLAVAPLTINYMREKAIDFSKPFMTLGISILYRKPNGTNPGIFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTMLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPISSADDLA--KQTRIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQTALIKNNEEGIQRVLTTD--YAMLMESTNIEYVTQRN-CNLTQIGGLIDNKGYGIGTPLGS----PYRDKITIAILQLQEEGKLHMMKEKWWRGNG-CPEEDSNEASA-LGVQNIGGIFIVLAAGL 330          
BLAST of Glutamate receptor vs. Ensembl Sea Lamprey
Match: GRIA4 (glutamate ionotropic receptor AMPA type subunit 4 [Source:HGNC Symbol;Acc:HGNC:4574])

HSP 1 Score: 160.229 bits (404), Expect = 1.271e-40
Identity = 181/778 (23.26%), Postives = 338/778 (43.44%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTR-----LLGDEEL-----SSVAF-----ILDAFRVL-QSLFNNNRFRNPSAPNREIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEI--IAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMK---PISDNVWICTGSACLFIAIGLRVIANISPY-----EWKRDE-------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTF------YPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEY--KNNKHPCDTM-MVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK--PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLSQYPEA 2580
            +  +QP L  PL++ + +++W  FVY+Y  +   + + +V+        +   L +  +     E+     LR L + ++   ER IV+D +    V   L  +  +G   + +HY++ N   + + L  ++    N++GF ++D +  +   F+ +W +       G + L     S++A+     I  AFR L +  F+ +R  N        DC +       +  V    G D+   +K+++  G T  I F N+   R N T+ + +    G  ++  I   +P     I++ ++    +      +++  + V TIL  P+ M     +     G    EGYC DL EEI   +  +Y   LV D  YG+   E   WNGMVGEL+ G A+  + PL    + + ++           +  +K   +  P V  F+    P+S    +CT   C++    L V     PY      W  ++             A  + +  WF   AV ++     P+    R + +I+   +++ ++ +   +  F ++ ++    +          +   VG L + ST E+    T+      + +N+V      +P++ +K+    V  VR+E G    +L+   N++   + +  CD +  VG+ F +K Y +            + ++  A+L+L E  TL KL  KWW  KGEC  +   S  K   L+L+N++GVFYIL  G+ L++++ L +F  K  + + +R    + EA
Sbjct:  105 LIELQPPLGWPLLHLIDRYEWGKFVYLYDTDRGLWLLQSVVQEATRRGWAMMALSIEGL----SEEA----LRQLLRDLAVRGERNIVLDCE-TYRVTSTLLQVVNVGNHVKGFHYIIANLGFLDVDLDVFRYGGANVSGFQMVDRMAPQVIAFLDKWHKQSPHVYPGSDSLHFKYTSALAYDGVFVISQAFRALYKQRFDLHREGNAG------DCLA-------NPAVPWGKGVDIQRALKNVHINGLTNNIQF-NELGQRSNYTLGVMELRPTGPTKLGSIMCVHPG---GILVRHQALGEDGINSSLHQNKTVIVTTILDAPYFMY--RKNYEQLTGNDRFEGYCADLGEEIARHVGFNYRWKLVPDGAYGSRDTETKIWNGMVGELVYGHAEQTVDPLCAILAFSVYVDLICSLTELASTAFIKAIQKASPNVSMFLHRVLPLS----VCT---CMYFLHLLSVCVFGKPYWRTYESWTAEQVSGSRGDGGGRTRAHALFSLAWFH--AVCQERRNYIPQVSVRRAVQAIYAFINMLLVSSFLPGIVFFFTLWSMSYQFSGCKSC--NNYIADAVG-LRSSSTXEWPRKVTYPHCLNPWHFNRVL-----SPNIRSKSTAGQVNGVRKETGWIARLLDGCCNQWVQPHQRERCDPIKKVGNYF-NKTYGIYF----THFSTPRTRVNLAVLKLSELGTLDKLKNKWWYDKGECGAKDAQSKDKTSALSLSNVAGVFYILVGGLGLAMLVALVEFCCK-SRAEARRYQVSFAEA 831          
BLAST of Glutamate receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007790.1 (pep scaffold:Pmarinus_7.0:GL476616:796957:798868:-1 gene:ENSPMAG00000007047.1 transcript:ENSPMAT00000007790.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.117 bits (344), Expect = 3.987e-35
Identity = 92/329 (27.96%), Postives = 163/329 (49.54%), Query Frame = 1
Query: 1579 IAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEW-----------KRDEAFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKG-ECIVESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTDFLY 2529
            +A + P +  G  +IMK     +P +F F++P++  +WI   SAC  I++ L V++ + P EW           ++ ++FN+ NSFWF F+A+V+QG++  P S   +I+   WW F LV  + YTANLAAFL+     S I  + DL  + D   + GT        +  +S   PY  V+  ++ N ++   +  +G+++   E+  Y+FI E+    +   K  CD ++    F     A+           +  +++ A+ +L +   LA+L  +W+ ++G EC+   G S    + + +  GVFY L  GI     +   + L+
Sbjct:    4 LALSPPILENGYHIIMKGKEVNEPRIFQFLEPLNTLLWISMLSACAGISVVLFVLSLLHPDEWYHLAKRKLVSREQGQSFNLVNSFWFVFSAMVKQGSDPLPLSMAGKIIVYTWWCFVLVVCSTYTANLAAFLTAEGQTS-IRSLKDLTRQMD--ARYGTYSGYRIVGFLNSSARDPYMTVWRHIRDNRTM-VASPKKGLEQA--EKAGYIFIGEASA-VFTAKKDHCDLIISDRRFFRHRLALPFPPGSR----LAAEVSRAVTELEDSGQLAELERQWFAQEGQECV---GLSNEHQIEMKDFKGVFYFLMMGIAAGCGVCFVECLW 318          
BLAST of Glutamate receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010716.1 (pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1 gene:ENSPMAG00000009705.1 transcript:ENSPMAT00000010716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 134.806 bits (338), Expect = 1.340e-32
Identity = 107/416 (25.72%), Postives = 205/416 (49.28%), Query Frame = 1
Query: 1378 EGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVET-KPGVFSFMKPISDNVWICTGSACLFIA-IGLRVIANISPYEWKRD---------EAFNMGNSFWFSFAAVVRQGAEIF-PKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDL----GIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKY-VFILESKMNEYKNNK-HPCDTMMVGS--VFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTD-FLYKL--HQIKQKR 2556
            +G+CID+ +++   +  +Y+++LV +  +G+  K N  WNGM+GE++   A + +  LT++  R++ + F+ PF+  G+S+++ +   T  P   +F++P S +VW+     CL ++ I + +    SP  + R           AF +G S W  +A V      +  P+   ++ + S+W  F+++ +A YTANLAAF+   + I  ++ + D   +  L      + GT+  GST+     +    Y +++  M +    + K++++ +  ++   GK   FI ++ +  Y   K   C  + +GS  VF +  Y +A + +       K  I  A+LQ      + +L   W    G C  E     S  L + N++GVFY+L   + LS ++ + + F Y +  H +K K 
Sbjct:  397 KGFCIDILKKLSKTVKFTYDLYLVTNGKHGS--KINGVWNGMIGEVVNMRAHMAVGSLTINEERSEVVDFSVPFVETGISVMVPRSNGTVSPS--AFLEPFSADVWVMMFILCLLVSGIAVFIFEYFSPVGYNRQLSAGKEFGGPAFTIGKSIWLLWAIVFNNSVPVENPRGTTSKFMVSVWAFFAVIFLASYTANLAAFMIQEDYIDQVSGLSDKKFQSPLEHSPPFRFGTVPNGSTERNIRNN----YLQMHGYMSK---FHQKSVEDALMSLK--AGKLDAFIYDAAVLNYMAGKDEGCRLVTIGSGKVFVATGYGIALQKSSR----WKRAIDLALLQFIGDGEMDELEMIWL--TGICHGERNDVMSSQLDIDNMAGVFYMLLVAMGLSFIVFVCEHFFYHVGRHCVKNKE 793          
BLAST of Glutamate receptor vs. Ensembl Nematostella
Match: EDO41291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J5])

HSP 1 Score: 211.846 bits (538), Expect = 1.076e-60
Identity = 122/391 (31.20%), Postives = 219/391 (56.01%), Query Frame = 1
Query: 1381 GYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWK---------RDEAFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLI-SPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIV-ESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTD 2520
            G+  DL E +   +N  YEI + K++ YG+ V+    W G++GEL+R +ADI + P+T+++ R + I F++PF+ F +++I+++P   +  +F+F+ P  + +W+ T      +++ +  +   SP  +K           + F++ NS WF+ A++++QG +  P+S   R+LA+ +W+F+L+ I+ YTANLAA+ +    I S I  + DLV +    +K G  + GS   +F+ S    Y  +++ M+   +    T   GV + R +   + ++ +    +Y N + PC+TM+V ++  +K+YA+A R N     +    I+ AIL+LRE+  + K   +WW    EC    S  S+ + L L +L+GVF IL  G  +SLVL L +
Sbjct:   29 GFSKDLMELLSRKLNFRYEICISKESSYGSKVE--GQWQGLIGELVREEADIALGPITITAEREEVIDFSKPFLDFRIAMILQQPTGEEVNLFAFLLPFDEKLWLTTLGVVGLVSLIVWFLDRFSPQGYKTQAEKSGEGEGDEFSLSNSLWFAVASILQQGGDNTPRSTSGRVLAAAFWLFTLILISTYTANLAAYFTGERGIRSKINSLEDLVSQST--VKYGVQEGGSLFTFFSESKVDIYATMFQQMKSQETFVNGT-QYGVLKARTQ--PFAYLTDQPSLDYYNMRKPCNTMLVKNLLDAKSYALAMRRNS----EWTNLISVAILELREEGEIEKSRLRWWDDSSECPTGPSTDSSPQRLELHSLAGVFIILGGGATISLVLLLVE 408          
BLAST of Glutamate receptor vs. Ensembl Nematostella
Match: EDO30203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G4])

HSP 1 Score: 206.068 bits (523), Expect = 2.588e-55
Identity = 147/539 (27.27%), Postives = 265/539 (49.17%), Query Frame = 1
Query: 1009 FTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGG-EIIAKSNPDETWDIMLNNEKN----------PNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEW-----------------KRDEAFNMGNSFWFSFAAVVRQGAE-IFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEY-KNNKHPCDTMMV-GSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK-PLALANLSGVFYILFFGIMLSLVLGLTDFLY 2529
            F F++        DG  L+DYI  +NT G    + FD+    R    +     N +  G + +   N +E   + L+N+K           P + +  L+NR+  +KVVTI   PF+  A   +      +  +EGYCI+L  ++  M+   +E++LV DN +GA       WNG+V E++ G AD+ +  LT+S  R K I FT+P+M  GL++++K     +   F+ ++P   ++W+  G   + +   L + +  SP+ +                 K  +  ++  + W +    V Q ++ + P S   RI  +++W   L+ ++ YTANLAAFL++    SPI+ + DL  +KD  I  GT+     + +F +++   +  +++ M+ + + +     EG+++V  E   Y FI +S + E+  +N+  C T++  GSVFG   Y      +        +Q+++AILQLR    +  L  KW     +C   +  + S+  L   +LSGVF +L  GI +S V+ + ++++
Sbjct:  348 FGFYDGLSTEPRPDGATLLDYISQVNTTGVMNQLGFDSN---RSPVDVAFDVVNLRAFGFQKVGYWNVEE--GLHLDNKKEIVWPSGRVYVPTDSTHILENRT--LKVVTIAEAPFI-FAQTQTNGQGETRVIIEGYCIELLRKLSEMLRFKFEVYLVPDNNFGAQDPVTKEWNGVVREVLNGRADLAVTSLTISPERQKVIDFTQPYMDLGLTVLIKPDPTEEKNPFAILRPFRYDLWMAIGGTMIIVGFFLWLFSTFSPFGFYGRCVQKCHTKIEPRYLKLHDTLSLVRALWSTVVYYVGQSSDHLHPVSSSGRITVAVYWFAMLIVMSTYTANLAAFLTIKRFTSPISSVDDLARQKD--ISYGTVLNSQPQAFFESASVPSFVTMWQYMRYHHT-FVNNSAEGIEKVMNE--NYAFIWDSAVLEFVAHNQISCGTLITSGSVFGRIGYGFGLAKDS----PYTKQLSNAILQLRHAGYMEFLDRKWLKANDKCAEAAEKAKSENQLTFEDLSGVFIVLIAGIGVSCVVLVLEWIW 869          
BLAST of Glutamate receptor vs. Ensembl Nematostella
Match: EDO41293 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J7])

HSP 1 Score: 157.532 bits (397), Expect = 7.371e-43
Identity = 92/300 (30.67%), Postives = 162/300 (54.00%), Query Frame = 1
Query: 1654 VFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRD---------EAFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASKPLALA--NLSGVFYILFFGIMLSLVLGLTD 2520
            +F+F+ P   ++W C       + I + ++   SPY ++ +         + F++ NS WF+  ++++QG +  P+S   R+LA+ +W+F+L+ I+ YTANLAAF +  N  S I  + DLV +     K G    GS   +F  S    Y K++  M    + + K  DEGV R R     + ++ +    +Y N + PC+TM+V ++  +K+YA+  + N     +  + I+ AILQLRE+  + ++  KWW    EC ++    +++P++L   +L+GVF IL  G  +SLV+ L +
Sbjct:    1 LFAFLMPFQKDLWACCCLVVGAVTILMWILDRFSPYGFRAEAKNTGEGEGDEFSLPNSLWFATGSILQQGGDNTPRSGSGRVLAASFWLFTLILISTYTANLAAFFTAQNSKSTINSLEDLVAQDVF--KYGVQQGGSLFSFFEKSKVRIYKKMFGKM-STLNTFVKGTDEGVNRSRTT--PFAYLTDQPSLDYYNQRKPCNTMLVKNLLDAKSYALGLQRNS----EWTDGISVAILQLREEGEVERIRYKWWDAMSECNLKDAVVSNQPMSLELHHLAGVFIILGGGAGISLVILLME 291          
BLAST of Glutamate receptor vs. Ensembl Nematostella
Match: EDO35545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL56])

HSP 1 Score: 162.155 bits (409), Expect = 6.880e-41
Identity = 159/597 (26.63%), Postives = 275/597 (46.06%), Query Frame = 1
Query:  877 LLGDEELSSV--AFILDAFRVLQSLFNNNR-FRNPSAPNREIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSIN-TVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNE------KNPNEESMHLKNRSHVIKVVTILANPFVML---------------AXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDT----WNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPY-------EWKRDEAFNMGNSFWFSFAAVVRQG-AEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDL-VEKKDLGIKVGTLDAGSTKEYF----ATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQ 2541
            L G+ E+S +  A ++ A   LQ+L N  +    P+A  RE    S               G++L + + +++   G TGPI F N    RKNA   L     Q   + +      E   + +N         N     + L N    ++VVT++  PFV +                +     +        G+C+DL   +   +N +Y + L +D  YG+  + N +    WNGMVGE+I+G AD+++A LT+++ RA++I F++PF   GL++++KK  E    + SF++P   ++W+    +   +A+ L ++   SP+       + K + A N+ ++ WFS+  ++  G  E  P+S  AR+L  +W  F+++ +A YTANLAAFL +    + ++ I D  +          T+   S   YF      S+ Y + + Y +         KT  EG+++V+  + K  FI +S +  Y+ +K  C     G +FG   Y +       K       I+ AIL   E   + +L T  WI   +C  E+   A+  L L ++ GVF ++  GI   +V+ + + LY  H+
Sbjct:  268 LHGNSEISQLKDATVISA-TALQNLANAGKTLTTPTASCRETQQWS--------------SGQELFNALVNVSLPRGTTGPIAF-NSDGDRKNAVYRLMN-RRQSSSDAVDVVGLYENGHVSINESIIWPGNLNTTPTGVFLSNH---LRVVTLVGEPFVYVKPIPTSGRCSDLDTNTAKHVLCTGTVSDTDSGFCMDLLIRLGEKVNFTYSVSLSEDGSYGSLRRVNGSDTKQWNGMVGEVIQGKADLIVAALTINNERAEWIEFSKPFKYQGLTILVKKN-EQSNSLDSFLRPFQIHLWLLVLLSVHIVAVILYLLDRFSPFGRFKLARKEKEETALNLSSAMWFSWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPKAVVSGIDDPNLRNPSKQFIYATVANSSVDAYFRRQVELSSMYTFMEGYNV---------KTAKEGIEKVKNGELK-AFIWDSPVLYYEASKD-CTLTTAGELFGRSGYGIGMP----KGSPWSNAISLAILNFHESGVMEELETT-WIDASKCNTENTSPAT--LGLQHMLGVFIMVAAGIGAGIVIIILEILYHKHR 825          
BLAST of Glutamate receptor vs. Ensembl Nematostella
Match: EDO46633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPU4])

HSP 1 Score: 159.844 bits (403), Expect = 3.284e-40
Identity = 141/554 (25.45%), Postives = 253/554 (45.67%), Query Frame = 1
Query: 1042 SNDGKDLIDYIKSINTVGQTGPIMFDNK----------TCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEW-----------------KRDEAFNMGNSFWFSFAAVVRQGAEI-FPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTM-MVGS----VFGSKAY--AVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIV-------ESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTD-FLYKLHQIKQ-KRKLSQY 2571
            S  G  L  YI+ + T G  G + F               V++N    + ++N + G  ++  S+    W  M      P +    L +R+  I+VV+   +PF M       +        EG  IDL + +  +++ +Y I++  D   G        W+G++ ELI+  AD+ + P+T++S R K I FT+PFMT G+ ++M      KP  F F++P   ++WI    A L + +   + + +SP+ +                 K+  + +  NS W S A  + QG +   P S   R   ++WW    +  A YTAN+AAFL+   + +PI +I DL  + +  I  G ++   T+ +F +S+   Y  ++E M+   S+   T    ++R    +GKY FI ++ + EY   K  C  + ++G      FG+  Y  A+  +S    +L ++      IL+L +      +  +W I++  C         ++  S +  + + N+ GVF  +  GI +  VL L + F+     +K+ KRK +++
Sbjct:  295 SISGITLNKYIQKVQTAGFMGFLSFSQDGFLANPSIDIINVKENEFDKVGEWNTKDG--LMMDSDKTVVW--MSGGPGTPRDSENVLADRT--IRVVSFKGSPFTM----PVGNVSSSVDRFEGAVIDLLDRLSEILHFNYTIYMSPDGRVGVENPVTGNWDGVINELIQERADLAVGPITITSHRWKVIDFTQPFMTSGIGVVMGTENSPKP-YFRFLEPFKSDLWITIFGAVLGMGVVNWLFSVVSPFGFYGRCVQSINKRVKKSYLKQKYSLSFLNSIWSSAAYYLGQGPDGNHPVSASGRAAVAVWWFVITILGATYTANMAAFLTTTRMQTPIRRIEDLSSQTE--IAYGCVENSLTQNFFQSSSVQRYQMMWEYMKLRRSLQPDTY-TAIERTL--KGKYAFIHDAPILEYLARKTYCGRIKLIGGYDTRTFGNAHYGFALPKKSPYTNLLSVE------ILKLVQSGIAKTMIEEWMIERTPCAPLDEAEEQDAKSSDTSKMGINNMLGVFIFMVAGIAIGGVLLLLEWFVAAYSDVKRDKRKRNKF 826          
BLAST of Glutamate receptor vs. Ensembl Medaka
Match: gria2b (glutamate ionotropic receptor AMPA type subunit 2 [Source:NCBI gene;Acc:101168274])

HSP 1 Score: 412.535 bits (1059), Expect = 1.669e-129
Identity = 260/778 (33.42%), Postives = 414/778 (53.21%), Query Frame = 1
Query:  316 ISIPFITWSPLYNLPNVAGNQNSETCRIFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLP--PDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSS-------VAFILDAFRVLQSLF---NNNRFRNPSAPNREIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE-------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK--PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLS 2565
            + + FIT  P + L    GNQ      I  ++PD+  PL++ +  +KW+ F Y+Y  +     +  VL        +E    VT I +    DE+      R L Q +    ER++++D + + +V++++  +  +G   + YHY++ N   +   LS  +    N++GF I+D+       F  +W  L   E   +        A   DA +V+   F   +  R       N   DC +       +  V    G ++   +K +   G TG I FD     R N ++ + +    G  +I   +  D+   ++L     P+ ++  ++N++ +  V TIL  P+VML    +    +  +  EGYC+DLA EI       Y++ +V D  YGA   E   WNGMVGEL+ G ADI +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E              F + NS WFS  A +RQG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    ++K++  M+   PSV+ KT  EGVQRVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT    +    ++  +  A+L+L E+  L KL  KWW  KGEC  +  GS  K   L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K++
Sbjct:  106 LHVSFIT--PSFPLD---GNQQF----IIQMRPDIKGPLLSLIEYYKWDKFAYLYDSDRGLTTLQVVLDT-----AAEKKWQVTAINVGNLKDERKD-EAYRSLFQDLENKKERRVILDCE-QDKVKDIMDQVITIGRHVKGYHYIIANLGFVDGDLSKIQYGGANVSGFQIVDFDDPLVSKFDQRWEALEEKEYPGADSKIRYTSALTYDAVQVMTEAFRYLHKQRIDFTRRANTG-DCLA-------NPAVPWAQGVEIERALKQVRVEGLTGNIQFDQHG-KRVNYSVNIMELKNNGPVKIGYWNEVDK---MVLTKLGEPSNDTTGMENKTVI--VTTILEAPYVML--KKNADLFVDNERYEGYCVDLAAEIAKHCGFKYQLKIVGDGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEYEDGQIQTNESTNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLDSGSTKEFFRRSKIALFDKMWTYMRSAEPSVFVKTTAEGVQRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSS----LRTPVNLAVLKLSEQGVLDKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKMT 845          
BLAST of Glutamate receptor vs. Ensembl Medaka
Match: gria2b (glutamate ionotropic receptor AMPA type subunit 2 [Source:NCBI gene;Acc:101168274])

HSP 1 Score: 411.379 bits (1056), Expect = 2.733e-129
Identity = 262/781 (33.55%), Postives = 418/781 (53.52%), Query Frame = 1
Query:  316 ISIPFITWSPLYNLPNVAGNQNSETCRIFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLP--PDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLL------GDEELS-SVAFILDAFRVLQSLF---NNNRFRNPSAPNREIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDE-------------AFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASK----PLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLSQ 2568
            + + FIT  P + L    GNQ      I  ++PD+  PL++ +  +KW+ F Y+Y  +     +  VL        +E    VT I +    DE+      R L Q +    ER++++D + + +V++++  +  +G   + YHY++ N   +   LS  +    N++GF I+D+       F  +W  L        D ++  + A   DA +V+   F   +  R       N   DC +       +  V    G ++   +K +   G TG I FD     R N ++ + +    G  +I   +  D+   ++L     P+ ++  ++N++ +  V TIL  P+VML    +    +  +  EGYC+DLA EI       Y++ +V D  YGA   E   WNGMVGEL+ G ADI +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E              F + NS WFS  A +RQG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    ++K++  M+   PSV+ KT  EGVQRVR+ +GKY ++LES MNEY   + PCDTM VG    SK Y +AT    +    ++  +  A+L+L E+  L KL  KWW  KGEC   SGG  SK     L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K+++
Sbjct:  106 LHVSFIT--PSFPLD---GNQQF----IIQMRPDIKGPLLSLIEYYKWDKFAYLYDSDRGLTTLQVVLDT-----AAEKKWQVTAINVGNLKDERKD-EAYRSLFQDLENKKERRVILDCE-QDKVKDIMDQVITIGRHVKGYHYIIANLGFVDGDLSKIQYGGANVSGFQIVDFDDPLVSKFDQRWEALEEKEYPGADSKIRYTSALTYDAVQVMTEAFRYLHKQRIDFTRRANTG-DCLA-------NPAVPWAQGVEIERALKQVRVEGLTGNIQFDQHG-KRVNYSVNIMELKNNGPVKIGYWNEVDK---MVLTKLGEPSNDTTGMENKTVI--VTTILEAPYVML--KKNADLFVDNERYEGYCVDLAAEIAKHCGFKYQLKIVGDGKYGARDAETKIWNGMVGELVYGKADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEYEDGQIQTNESTNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLDSGSTKEFFRRSKIALFDKMWTYMRSAEPSVFVKTTAEGVQRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSS----LRNAVNLAVLKLNEQGLLDKLKNKWWYDKGEC--GSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAK 846          
BLAST of Glutamate receptor vs. Ensembl Medaka
Match: gria4b (glutamate receptor 4 [Source:NCBI gene;Acc:101175340])

HSP 1 Score: 408.297 bits (1048), Expect = 1.719e-128
Identity = 250/756 (33.07%), Postives = 399/756 (52.78%), Query Frame = 1
Query:  382 SETCRIFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSS-------VAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDEA---------------FNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGS---ASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLS 2565
             E+     ++P +   L++ L  + WN FV++Y  +  +  +  ++      +  ++   ++ I +   E       R L + + +  E+K V+DL+    ++ +L  +  +G   + YHY+M N     + L  +     N+TGF ++D+ +      + +W +L   E   S        A   D   V+   F N R +      R    DC +       +     N G D+   +K +   G TG + FD+    R N T+ + +    G   I   ++ D+   +++ +      ++  ++NR+ +  V TI+  P+VML  +            EGYC+DLA EI   I   Y+I +V D  YGA   E   WNGMVGEL+ G A+I +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E                F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ D  I  GTLD+GSTKE+F  S    Y K++  M+   P+V+TKT  EGV RVR+ +GKY F+LES MNEY   + PCDTM VG    SK Y VAT     K   ++  +  A+L+L E   L KL  KWW  KGEC  +  GS   +S+ L+L+N++GVFYIL  G+ L++++ L +F YK     ++ KL+
Sbjct:   64 GESQFTLQLRPPIRGALLSLLDHYDWNKFVFLYDTDRGYAILQAIME-----KAGQNNWQISAICV---ENFNDANYRRLLEDLDRRQEKKFVIDLEAE-RLQNMLEQIVSVGKHVKGYHYIMANLGFKDINLERFMHGGANVTGFQLVDFSNPMVIKLMQRWNKLDQREYPGSDAPPKYTSALTYDGVMVMAEAFRNLRRQKVDISRRGNAGDCLA-------NPAAPWNQGIDMERTLKQVRLQGLTGNVQFDHYG-RRVNYTMDVFELKNNGPRRIGYWNDADKL--VLIQDSPLLPNDTTGIENRTVI--VTTIMEGPYVMLKKNWEMYEGND--QYEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGTDGQPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTD--IAYGTLDSGSTKEFFRRSKIAVYEKMWGYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGVAT----PKGSQLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKDKSSQALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRNEAKRMKLT 790          
BLAST of Glutamate receptor vs. Ensembl Medaka
Match: gria4a (glutamate receptor 4 [Source:NCBI gene;Acc:101163507])

HSP 1 Score: 409.453 bits (1051), Expect = 2.060e-128
Identity = 250/750 (33.33%), Postives = 397/750 (52.93%), Query Frame = 1
Query:  400 FSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSS-------VAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDEA----------------FNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGS---ASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKL 2562
              ++P +   L++ L  + WN FV++Y  +  +  +  ++         ++   V+ I +       +   R L + + +  ERK V+DL+    ++ +L     +G   + YHY++ N     + L  +     N+TGF ++D+        + +W +L   E   S        +   D   V+   F + R +      R    DC +       +     N G D+   +K +   G TG I FD+    R N T+ + +    G  +I   ++ D+   +++ NE +   +S  ++NR+ V  V TI+  P+VML    +     G    EGYC+DLA EI   I   Y+I +V D  YGA   E   WNGMVGEL+ G A+I +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E                 F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    Y K++  M+   P+V+TKT  EGV RVR+ +GKY F+LES MNEY   + PCDTM VG    SK Y +AT     K   ++  +  A+L+L E   L KL  KWW  KGEC  +  GS   +S+ L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K+
Sbjct:  138 LQLRPSIRGALLSLLDHYDWNRFVFLYDTDRGYAILQAIME-----RAGQNAWQVSAICVESFNDAAY---RRLLEDLDRRQERKYVIDLE-PERLQSILDQAVSVGKHVKGYHYIIANLGFKDISLERFMHGGANVTGFQLVDFSKPIVIKLMQRWNKLDQREYPGSESPPKYTSSLTYDGVLVMAEAFRSLRRQKIDISRRGNAGDCLA-------NPAAPWNQGIDMERALKQVRIQGLTGNIQFDHYG-RRVNYTMDVFELRSNGPRKIGYWNDIDKL--VLVQNENSLLNDSSAMENRTVV--VTTIMEGPYVML--KKNWELYEGNDQFEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHAEEPEEGATEPGPTDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGIAT----PKGSQLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKDKSSQALSLSNVAGVFYILVGGLGLAMLVALVEFCYKSRAEAKRMKV 858          
BLAST of Glutamate receptor vs. Ensembl Medaka
Match: gria4a (glutamate receptor 4 [Source:NCBI gene;Acc:101163507])

HSP 1 Score: 409.068 bits (1050), Expect = 2.763e-128
Identity = 250/750 (33.33%), Postives = 397/750 (52.93%), Query Frame = 1
Query:  400 FSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSS-------VAFILDAFRVLQSLFNNNRFRNPSAPNR--EIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDEA----------------FNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQ-NPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGS---ASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKL 2562
              ++P +   L++ L  + WN FV++Y  +  +  +  ++         ++   V+ I +       +   R L + + +  ERK V+DL+    ++ +L     +G   + YHY++ N     + L  +     N+TGF ++D+        + +W +L   E   S        +   D   V+   F + R +      R    DC +       +     N G D+   +K +   G TG I FD+    R N T+ + +    G  +I   ++ D+   +++ NE +   +S  ++NR+ V  V TI+  P+VML    +     G    EGYC+DLA EI   I   Y+I +V D  YGA   E   WNGMVGEL+ G A+I +APLT++  R + I F++PFM+ G+S+++KKP ++KPGVFSF+ P++  +W+C   A + +++ L +++  SPYEW  +E                 F + NS WFS  A ++QG +I P+S   RI+  +WW F+L+ I+ YTANLAAFL+V  ++SPI    DL ++ +  I  GTLD+GSTKE+F  S    Y K++  M+   P+V+TKT  EGV RVR+ +GKY F+LES MNEY   + PCDTM VG    SK Y +AT     K   ++  +  A+L+L E+  L KL  KWW  KGEC    G S   +S+ L+L+N++GVFYIL  G+ L++++ L +F YK     ++ K+
Sbjct:  138 LQLRPSIRGALLSLLDHYDWNRFVFLYDTDRGYAILQAIME-----RAGQNAWQVSAICVESFNDAAY---RRLLEDLDRRQERKYVIDLE-PERLQSILDQAVSVGKHVKGYHYIIANLGFKDISLERFMHGGANVTGFQLVDFSKPIVIKLMQRWNKLDQREYPGSESPPKYTSSLTYDGVLVMAEAFRSLRRQKIDISRRGNAGDCLA-------NPAAPWNQGIDMERALKQVRIQGLTGNIQFDHYG-RRVNYTMDVFELRSNGPRKIGYWNDIDKL--VLVQNENSLLNDSSAMENRTVV--VTTIMEGPYVML--KKNWELYEGNDQFEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHAEEPEEGATEPGPTDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE--IAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGIAT----PKGSQLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKSSQALSLSNVAGVFYILVGGLGLAMLVALVEFCYKSRAEAKRMKV 858          
BLAST of Glutamate receptor vs. Planmine SMEST
Match: SMESG000069665.1 (SMESG000069665.1)

HSP 1 Score: 1509.58 bits (3907), Expect = 0.000e+0
Identity = 752/759 (99.08%), Postives = 758/759 (99.87%), Query Frame = 1
Query:  307 SRNISIPFITWSPLYNLPNVAGNQNSETCRIFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSSVAFILDAFRVLQSLFNNNRFRNPSAPNREIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDEAFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLSQYPEAR 2583
            +++ +IPFITWSPLYNLPNVAGNQNSETCRIFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEELLRCLKLLGMLRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSSVAFILDAFRVLQSLFNNNRFRNPSAPNREIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEES+HLKNRSHVI+VVTILANPFVMLASDSSKSSKIGKKNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDEAFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLSQYPEAR
Sbjct:   96 TKHFNIPFITWSPLYNLPNVAGNQNSETCRIFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDLLDVTPIYLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEELLRCLKLLGMLRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSSVAFILDAFRVLQSLFNNNRFRNPSAPNREIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESIHLKNRSHVIRVVTILANPFVMLASDSSKSSKIGKKNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDEAFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLSQYPEAR 854          

HSP 2 Score: 211.075 bits (536), Expect = 8.954e-57
Identity = 99/100 (99.00%), Postives = 100/100 (100.00%), Query Frame = 3
Query:   24 MILRKPLINWTIFLGLSQLCDCRFALLWSNESFEFNKVLEYVSNDWNLKQYFTKYAVNTSNPGKFQKELCEIAQSNERPIIGRLDLEGRLIVESFTKHFN 323
            MILRKPLINWTIFLGLSQLCDCRFALLWSNESFEFNKVLEYVSNDWNLKQYFTKYAVNTSNPGKFQKELCEI+QSNERPIIGRLDLEGRLIVESFTKHFN
Sbjct:    1 MILRKPLINWTIFLGLSQLCDCRFALLWSNESFEFNKVLEYVSNDWNLKQYFTKYAVNTSNPGKFQKELCEISQSNERPIIGRLDLEGRLIVESFTKHFN 100          
BLAST of Glutamate receptor vs. Planmine SMEST
Match: SMESG000014610.1 (SMESG000014610.1)

HSP 1 Score: 485.723 bits (1249), Expect = 2.351e-157
Identity = 290/764 (37.96%), Postives = 446/764 (58.38%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDL-LDVTPIYLPPDEKGIFHTLRILDQKISKMNERK-IVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSSV---AFILDAF--------RVLQSLFNNNRFRNPSAPN----REIDCTSFFTFFNTSVKVK-SNDGKDLIDYIKS-INTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVK----ENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDEA----------FNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQI--KQKRKLSQYPEAR 2583
            IF +    T PL+ FL+Q KW  F YI       +R+  ++  ++  +   +L +DV  I    D +     LR L+  +  +++ K I++D+D +  +E LL  + L+GM R EY+Y++ N  +  L L+ +K S VNITGF I++   +  R F  +W        L +V   A + DA         ++LQS        NP+  N    R  D    + + + + ++K S  GK + + I S     G TG I F ++   RKN  +         G  +I   + ++   + L+N          +KN++  I+VV+I++ PF+ L    +  +  G    EG+C+D+  +   M+   Y IHLV DN +G  ++    + + WNG+VGE++ G AD+ +APLT++ +RA+ ++F+EP++TFG+S+++KKP    PG+FSFM+P++DNVW    +ACL ++ GL VI  +SPYEW   E           F   NS WFSFAA+V+QG ++ PKSPGARIL+S+WW F+L+  AYYTANL AFL+++ +I+PI    DL+ K  +GI+ G+LD+GSTKE+F T++  P+ ++  IM++NP V+TKT+DEGV+RV + +GKY F+LES+MNEY NN+ PC+TM+VGS FG K Y +AT  +      MK++I DA+L+LRE Q L  LY  WWI+KG C  ES  S  +PL L N++GVFYIL  G+  +L+  L +F Y   +   KQ    S++   R
Sbjct:  134 IFQLSFPTTDPLVEFLIQQKWVTFSYICNCGQCLHRLQRLIEKIHSRKDYIELNVDVRYI---SDVRLASKDLRNLNAYLDSVSQHKRILIDMDTQENLELLLYRIVLMGMNRPEYYYVITNVELEDLDLTDFKYSGVNITGFKIINREEKAFRSFHNEWNSQSKSTNLRTVTQAALMQDAMDLFTGTIEKMLQSPSLRKALLNPNYMNCYTLRMPDKRKIYGYQSGTYEIKRSTVGKMIAEAILSGTRKEGLTGNIEFTDQG-YRKNFNVTFMTMEMDVG--LIPIGHWNDKVGLNLSNRDGNKVTVEMIKNQT--IRVVSIISPPFLQLKQPKNGETLEGNDRFEGFCVDMLNQTAQMLGFKYSIHLVNDNSFGQVIRYLSNKTEIWNGIVGEILNGTADMAVAPLTINLARARVVSFSEPYLTFGISVMIKKPGRKNPGIFSFMRPLADNVWGSYFAACLIVSCGLYVITRLSPYEWITYETETDGVRIKRNFTFYNSVWFSFAALVQQGVDLAPKSPGARILSSVWWFFTLIMTAYYTANLVAFLTISLMITPINDFGDLI-KPGIGIEFGSLDSGSTKEFFLTTSLEPFRQMGIIMKRNPMVFTKTVDEGVKRVLKSKGKYAFLLESRMNEYYNNREPCETMVVGSPFGDKGYGIATSLD----YPMKDEINDAVLKLRENQYLDTLYKHWWIQKGGCSDESTQSKLRPLTLINVAGVFYILTAGLTFALLTSLFEFYYNARRSFKKQTDSFSEFMHQR 884          
BLAST of Glutamate receptor vs. Planmine SMEST
Match: SMESG000014610.1 (SMESG000014610.1)

HSP 1 Score: 485.337 bits (1248), Expect = 2.434e-157
Identity = 290/764 (37.96%), Postives = 446/764 (58.38%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDL-LDVTPIYLPPDEKGIFHTLRILDQKISKMNERK-IVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSSV---AFILDAF--------RVLQSLFNNNRFRNPSAPN----REIDCTSFFTFFNTSVKVK-SNDGKDLIDYIKS-INTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVK----ENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDEA----------FNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQI--KQKRKLSQYPEAR 2583
            IF +    T PL+ FL+Q KW  F YI       +R+  ++  ++  +   +L +DV  I    D +     LR L+  +  +++ K I++D+D +  +E LL  + L+GM R EY+Y++ N  +  L L+ +K S VNITGF I++   +  R F  +W        L +V   A + DA         ++LQS        NP+  N    R  D    + + + + ++K S  GK + + I S     G TG I F ++   RKN  +         G  +I   + ++   + L+N          +KN++  I+VV+I++ PF+ L    +  +  G    EG+C+D+  +   M+   Y IHLV DN +G  ++    + + WNG+VGE++ G AD+ +APLT++ +RA+ ++F+EP++TFG+S+++KKP    PG+FSFM+P++DNVW    +ACL ++ GL VI  +SPYEW   E           F   NS WFSFAA+V+QG ++ PKSPGARIL+S+WW F+L+  AYYTANL AFL+++ +I+PI    DL+ K  +GI+ G+LD+GSTKE+F T++  P+ ++  IM++NP V+TKT+DEGV+RV + +GKY F+LES+MNEY NN+ PC+TM+VGS FG K Y +AT  +      MK++I DA+L+LRE Q L  LY  WWI+KG C  ES  S  +PL L N++GVFYIL  G+  +L+  L +F Y   +   KQ    S++   R
Sbjct:  129 IFQLSFPTTDPLVEFLIQQKWVTFSYICNCGQCLHRLQRLIEKIHSRKDYIELNVDVRYI---SDVRLASKDLRNLNAYLDSVSQHKRILIDMDTQENLELLLYRIVLMGMNRPEYYYVITNVELEDLDLTDFKYSGVNITGFKIINREEKAFRSFHNEWNSQSKSTNLRTVTQAALMQDAMDLFTGTIEKMLQSPSLRKALLNPNYMNCYTLRMPDKRKIYGYQSGTYEIKRSTVGKMIAEAILSGTRKEGLTGNIEFTDQG-YRKNFNVTFMTMEMDVG--LIPIGHWNDKVGLNLSNRDGNKVTVEMIKNQT--IRVVSIISPPFLQLKQPKNGETLEGNDRFEGFCVDMLNQTAQMLGFKYSIHLVNDNSFGQVIRYLSNKTEIWNGIVGEILNGTADMAVAPLTINLARARVVSFSEPYLTFGISVMIKKPGRKNPGIFSFMRPLADNVWGSYFAACLIVSCGLYVITRLSPYEWITYETETDGVRIKRNFTFYNSVWFSFAALVQQGVDLAPKSPGARILSSVWWFFTLIMTAYYTANLVAFLTISLMITPINDFGDLI-KPGIGIEFGSLDSGSTKEFFLTTSLEPFRQMGIIMKRNPMVFTKTVDEGVKRVLKSKGKYAFLLESRMNEYYNNREPCETMVVGSPFGDKGYGIATSLD----YPMKDEINDAVLKLRENQYLDTLYKHWWIQKGGCSDESTQSKLRPLTLINVAGVFYILTAGLTFALLTSLFEFYYNARRSFKKQTDSFSEFMHQR 879          
BLAST of Glutamate receptor vs. Planmine SMEST
Match: SMESG000013939.1 (SMESG000013939.1)

HSP 1 Score: 459.914 bits (1182), Expect = 2.421e-147
Identity = 277/755 (36.69%), Postives = 432/755 (57.22%), Query Frame = 1
Query:  385 ETCRIFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDL-LDVTPIYLPPDEKGIFHTLRILDQKISKMNERKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQW-------TRLLGDEELSSVAFILDAFRVLQSLFNNNRFRNP-------SAPNREIDCTSFFTFFNTSVK------------VKSNDGKDLIDYIKSIN-TVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVKEN----DTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEW----------KRDEAFNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTDF 2523
            +T  +  + P +   ++++L++ +W  F YI       YR+   +  ++  +   +L +DV  I    D +     LR LD  +S  +E+++++D+D    ++ +L  + L+GM R EY ++++   + ++ L+ +K S V I GF IL    Q+   F   W         L+    +  VA ++DA ++  S  +     NP       S  N+E D T+ +T      +            + S+ G+ +++ I + N   G TG + F+ +  +RK+ ++ + K   + G   I   N      ++++N          +KN++  ++VVTI   PF+ L +        G +  EG+C+DL       +   YEIHLV DN +G  + +N    + WNG++GE++ G AD+V+APLT+S SRA+ + F+EPF+TFGLS+I+KKP + K G+FSF +P+S  VW C  +ACL ++ GL +IA +SPYEW          K    F   N  WFS AA V+QG ++ PKSPGARIL+S+WW F+L+ IAYYTANLAAFL+++ +I PI    DLV    +GI+ GT+++GSTK +F T+   P+  +   M+QNP V+ KTI+EGV++VR  +G Y F+LES+MNEY NN++PCDTMMVG+ +G   Y +AT  N      + E ITDAIL+LREKQ L KLY KWWI+KGEC  ++  S S  L L N++GVFYIL  G+  +++  L +F
Sbjct:  136 KTNYLIHMHPPILDSMVDYLIKHEWYTFSYICNTGQGLYRLQNTIKIIHSKKDYVELNVDVRYI---SDPRLATKDLRNLDAYLSSHHEKRVLIDIDTPKNLDLILHRIVLMGMNRPEYQFVILTASMDEIDLTEFKYSGVEIIGFKILIDQSQKYFNFKKIWLPWINNSRPLMSSYSMYEVALMVDALQIFTSAMDR-IIENPVSRKHLLSYLNKE-DTTNCYTVRTPGRRKIIGYHNRRYEIINSSLGQIILEKILNENYQSGLTGTLKFE-ENGLRKDFSVQILKVKLEKGPVKIG--NWSMKKGVVIDNLYEKVYTKEMIKNQT--VRVVTIALKPFLQLKTPKENEKLEGNERYEGFCVDLLNLTASFLGFKYEIHLVNDNSFGVKIGQNPNGTEIWNGLIGEILNGTADMVVAPLTISLSRARVVHFSEPFLTFGLSVIIKKPGKKKAGIFSFFRPLSYPVWGCYFAACLVVSCGLYIIARMSPYEWNINNPYDPHQKITRDFTFFNCVWFSIAAFVQQGVDVAPKSPGARILSSVWWFFTLIMIAYYTANLAAFLTISLMIPPINDWPDLVS-PGVGIEYGTINSGSTKNFFMTTNLEPFRTMGLFMKQNPHVFRKTIEEGVKKVRSSKGNYAFLLESRMNEYFNNRYPCDTMMVGTPYGDNGYGIATPKN----YSLNENITDAILKLREKQELTKLYKKWWIEKGECNDDNANSNSGALLLINVAGVFYILAAGLTFAMLTSLIEF 875          
BLAST of Glutamate receptor vs. Planmine SMEST
Match: SMESG000014610.1 (SMESG000014610.1)

HSP 1 Score: 457.603 bits (1176), Expect = 8.430e-147
Identity = 282/764 (36.91%), Postives = 434/764 (56.81%), Query Frame = 1
Query:  397 IFSVQPDLTVPLINFLVQWKWNHFVYIYRKEYSFYRINTVLHNLYGHETSEDL-LDVTPIYLPPDEKGIFHTLRILDQKISKMNE-RKIVVDLDGRSEVEEXXXXXXXXXXXRQEYHYLMVNFRIMQLPLSSYKSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSSV---AFILDAF--------RVLQSLFNNNRFRNPSAPN----REIDCTSFFTFFNTSVKVK-SNDGKDLIDYIKS-INTVGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNNEKNPNEESMHLKNRSHVIKVVTILANPFVMLAXXXXXXXXXXXXNLEGYCIDLAEEIFGMINQSYEIHLVKDNLYGAYVK----ENDTWNGMVGELIRGDADIVIAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNVWICTGSACLFIAIGLRVIANISPYEWKRDEA----------FNMGNSFWFSFAAVVRQGAEIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDLVEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDEGVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRSNDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASKPLALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQI--KQKRKLSQYPEAR 2583
            IF +    T PL+ FL+Q KW  F YI       +R+  ++  ++  +   +L +DV  I    D +     LR L+  +  +++ ++I++D+D +  +E LL  + L+GM R EY+Y++ N  +  L L+ +K S VNITGF I++   +  R F  +W        L +V   A + DA         ++LQS        NP+  N    R  D    + + + + ++K S  GK + + I S     G TG I F ++   RKN  +         G  +I   + ++   + L+N          +KN++  I+VV+I++ PF+ L    +  +  G    EG+C+D+  +   M+   Y IHLV DN +G  ++    + + WNG+VGE++ G AD+ +APLT++ +RA+ ++F+EP                 PG+FSFM+P++DNVW    +ACL ++ GL VI  +SPYEW   E           F   NS WFSFAA+V+QG ++ PKSPGARIL+S+WW F+L+  AYYTANL AFL+++ +I+PI    DL+ K  +GI+ G+LD+GSTKE+F T++  P+ ++  IM++NP V+TKT+DEGV+RV + +GKY F+LES+MNEY NN+ PC+TM+VGS FG K Y +AT  +      MK++I DA+L+LRE Q L  LY  WWI+KG C  ES  S  +PL L N++GVFYIL  G+  +L+  L +F Y   +   KQ    S++   R
Sbjct:  134 IFQLSFPTTDPLVEFLIQQKWVTFSYICNCGQCLHRLQRLIEKIHSRKDYIELNVDVRYI---SDVRLASKDLRNLNAYLDSVSQHKRILIDMDTQENLELLLYRIVLMGMNRPEYYYVITNVELEDLDLTDFKYSGVNITGFKIINREEKAFRSFHNEWNSQSKSTNLRTVTQAALMQDAMDLFTGTIEKMLQSPSLRKALLNPNYMNCYTLRMPDKRKIYGYQSGTYEIKRSTVGKMIAEAILSGTRKEGLTGNIEFTDQG-YRKNFNVTFMTMEMDVG--LIPIGHWNDKVGLNLSNRDGNKVTVEMIKNQT--IRVVSIISPPFLQLKQPKNGETLEGNDRFEGFCVDMLNQTAQMLGFKYSIHLVNDNSFGQVIRYLSNKTEIWNGIVGEILNGTADMAVAPLTINLARARVVSFSEP---------------KNPGIFSFMRPLADNVWGSYFAACLIVSCGLYVITRLSPYEWITYETETDGVRIKRNFTFYNSVWFSFAALVQQGVDLAPKSPGARILSSVWWFFTLIMTAYYTANLVAFLTISLMITPINDFGDLI-KPGIGIEFGSLDSGSTKEFFLTTSLEPFRQMGIIMKRNPMVFTKTVDEGVKRVLKSKGKYAFLLESRMNEYYNNREPCETMVVGSPFGDKGYGIATSLD----YPMKDEINDAVLKLRENQYLDTLYKHWWIQKGGCSDESTQSKLRPLTLINVAGVFYILTAGLTFALLTSLFEFYYNARRSFKKQTDSFSEFMHQR 869          
The following BLAST results are available for this feature:
BLAST of Glutamate receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIA14.086e-12933.78glutamate ionotropic receptor AMPA type subunit 1 ... [more]
GRIA14.624e-12933.82glutamate ionotropic receptor AMPA type subunit 1 ... [more]
GRIA11.580e-12833.64glutamate ionotropic receptor AMPA type subunit 1 ... [more]
GRIA13.062e-12833.95glutamate ionotropic receptor AMPA type subunit 1 ... [more]
GRIA14.651e-12833.82glutamate ionotropic receptor AMPA type subunit 1 ... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glr-21.251e-9328.89Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot... [more]
glr-19.836e-8730.59Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot... [more]
glr-22.861e-8527.56Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot... [more]
glr-31.171e-7636.21GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-56.936e-6827.93GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GluRIA9.479e-10129.63gene:FBgn0004619 transcript:FBtr0076982[more]
KaiR1D3.792e-9430.17gene:FBgn0038837 transcript:FBtr0083987[more]
Grik2.993e-8429.97gene:FBgn0038840 transcript:FBtr0335016[more]
Grik1.991e-8330.78gene:FBgn0038840 transcript:FBtr0335015[more]
CG111555.370e-8031.48gene:FBgn0039927 transcript:FBtr0333701[more]
back to top
BLAST of Glutamate receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria2b8.637e-13133.68glutamate receptor, ionotropic, AMPA 2b [Source:ZF... [more]
gria3a4.868e-13034.44glutamate receptor, ionotropic, AMPA 3a [Source:ZF... [more]
gria2b5.864e-13033.68glutamate receptor, ionotropic, AMPA 2b [Source:ZF... [more]
gria4b8.226e-13033.91glutamate receptor, ionotropic, AMPA 4b [Source:ZF... [more]
gria2b2.602e-12933.72glutamate receptor, ionotropic, AMPA 2b [Source:ZF... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf3ip21.863e-13333.64TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
traf3ip21.314e-13234.13TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
traf3ip21.857e-13234.43TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
traf3ip28.716e-13234.48TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
traf3ip23.118e-13134.22TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gria14.596e-13033.78glutamate receptor, ionotropic, AMPA1 (alpha 1) [S... [more]
Gria14.063e-12933.78glutamate receptor, ionotropic, AMPA1 (alpha 1) [S... [more]
Gria12.044e-12833.95glutamate receptor, ionotropic, AMPA1 (alpha 1) [S... [more]
Gria23.027e-12833.69glutamate receptor, ionotropic, AMPA2 (alpha 2) [S... [more]
Gria25.802e-12833.86glutamate receptor, ionotropic, AMPA2 (alpha 2) [S... [more]
back to top
BLAST of Glutamate receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P23818|GRIA1_MOUSE2.842e-12833.78Glutamate receptor 1 OS=Mus musculus OX=10090 GN=G... [more]
sp|P19491|GRIA2_RAT1.093e-12733.86Glutamate receptor 2 OS=Rattus norvegicus OX=10116... [more]
sp|P19490|GRIA1_RAT1.301e-12733.95Glutamate receptor 1 OS=Rattus norvegicus OX=10116... [more]
sp|Q38PU8|GRIA1_MACFA1.471e-12733.95Glutamate receptor 1 OS=Macaca fascicularis OX=954... [more]
sp|P42261|GRIA1_HUMAN1.471e-12733.95Glutamate receptor 1 OS=Homo sapiens OX=9606 GN=GR... [more]
back to top
BLAST of Glutamate receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A068Y8480.000e+041.18Glutamate receptor 2 OS=Echinococcus multiloculari... [more]
W6UAG00.000e+040.93Glutamate receptor OS=Echinococcus granulosus OX=6... [more]
A0A068WKI30.000e+040.93Glutamate receptor 2 OS=Echinococcus granulosus OX... [more]
A0A0R3U5H30.000e+040.05Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3WBX10.000e+041.03Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria3a7.721e-13033.86glutamate receptor 3 [Source:NCBI gene;Acc:1030448... [more]
gria3a1.108e-12933.86glutamate receptor 3 [Source:NCBI gene;Acc:1030448... [more]
gria3a1.802e-12933.86glutamate receptor 3 [Source:NCBI gene;Acc:1030448... [more]
gria3a1.888e-12934.04glutamate receptor 3 [Source:NCBI gene;Acc:1030448... [more]
GRIA22.636e-12934.00glutamate ionotropic receptor AMPA type subunit 2 ... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria1b1.512e-10638.93glutamate receptor, ionotropic, AMPA 1b [Source:ZF... [more]
ENSPMAT00000005084.14.390e-6437.35pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
GRIA41.271e-4023.26glutamate ionotropic receptor AMPA type subunit 4 ... [more]
ENSPMAT00000007790.13.987e-3527.96pep scaffold:Pmarinus_7.0:GL476616:796957:798868:-... [more]
ENSPMAT00000010716.11.340e-3225.72pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Glutamate receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO412911.076e-6031.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302032.588e-5527.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412937.371e-4330.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355456.880e-4126.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466333.284e-4025.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glutamate receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria2b1.669e-12933.42glutamate ionotropic receptor AMPA type subunit 2 ... [more]
gria2b2.733e-12933.55glutamate ionotropic receptor AMPA type subunit 2 ... [more]
gria4b1.719e-12833.07glutamate receptor 4 [Source:NCBI gene;Acc:1011753... [more]
gria4a2.060e-12833.33glutamate receptor 4 [Source:NCBI gene;Acc:1011635... [more]
gria4a2.763e-12833.33glutamate receptor 4 [Source:NCBI gene;Acc:1011635... [more]
back to top
BLAST of Glutamate receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069665.18.954e-5799.08SMESG000069665.1[more]
SMESG000014610.12.351e-15737.96SMESG000014610.1[more]
SMESG000014610.12.434e-15737.96SMESG000014610.1[more]
SMESG000013939.12.421e-14736.69SMESG000013939.1[more]
SMESG000014610.18.430e-14736.91SMESG000014610.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021366 ID=SMED30021366|Name=Glutamate receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=2733bp
CACTTTCATATTTCACTCTTTCTATGATTCTACGAAAGCCTCTCATAAAC
TGGACGATTTTCCTCGGTCTATCTCAACTTTGCGACTGTCGGTTTGCGCT
TCTCTGGTCAAATGAGTCGTTTGAATTCAACAAAGTCCTTGAGTATGTCA
GCAATGATTGGAATTTAAAACAATATTTCACCAAATATGCCGTAAACACT
TCCAATCCAGGGAAATTCCAGAAAGAACTCTGCGAAATTGCCCAATCGAA
TGAAAGACCGATTATCGGCCGGTTGGATTTAGAGGGTCGTTTGATTGTTG
AAAGCTTCACGAAACATTTCAATTCCATTTATTACATGGAGTCCGTTATA
TAATTTGCCGAATGTTGCTGGGAATCAAAACTCTGAGACTTGTAGGATAT
TTAGCGTTCAGCCCGACCTGACAGTTCCTTTAATAAATTTCCTTGTCCAA
TGGAAATGGAATCATTTTGTTTATATTTATCGAAAGGAATATAGTTTTTA
TCGAATCAACACCGTCTTACATAACCTTTACGGTCATGAGACGTCAGAGG
ATCTGCTTGACGTAACCCCGATTTATTTGCCGCCCGATGAAAAAGGAATA
TTTCATACTTTGAGGATATTGGATCAAAAGATATCGAAAATGAATGAGAG
AAAAATTGTCGTTGATTTAGATGGTAGAAGTGAGGTGGAAGAATTATTAC
GTTGCTTAAAGTTATTAGGTATGTTGCGCCAAGAATACCATTACTTGATG
GTGAACTTTCGAATAATGCAGCTGCCGTTAAGTTCTTACAAATCAAGCCG
AGTCAACATTACCGGATTTCATATTCTGGATTACTTGCATCAAGAGACCA
GAGTCTTCATTACTCAATGGACTCGACTGTTAGGCGATGAAGAGTTGTCC
AGTGTAGCATTCATTTTAGACGCCTTTAGAGTTCTCCAAAGTCTTTTCAA
TAATAACCGATTCCGAAACCCTTCGGCACCAAATAGAGAAATTGATTGCA
CTAGTTTTTTTACGTTTTTTAACACATCAGTCAAAGTGAAAAGCAACGAT
GGAAAAGATTTAATTGATTATATCAAATCTATTAATACAGTAGGACAAAC
TGGGCCAATAATGTTTGACAATAAAACCTGTGTCCGAAAGAATGCAACAA
TTATCTTGACAAAATTTAATGGCCAAGGAGGTGGAGAGATAATTGCAAAA
TCAAATCCAGACGAGACTTGGGATATAATGTTGAACAACGAAAAAAATCC
AAATGAAGAAAGCATGCATTTAAAGAATCGGTCTCATGTCATTAAGGTCG
TGACAATTTTAGCAAATCCCTTCGTTATGCTGGCGTCAGATTCTTCAAAA
AGCTCTAAAATCGGCAAAAAAAACCTTGAAGGCTATTGTATTGATCTTGC
GGAAGAGATATTTGGAATGATCAACCAGAGCTATGAAATCCACCTAGTGA
AAGACAATCTATATGGAGCTTATGTAAAAGAAAATGATACTTGGAATGGA
ATGGTTGGAGAACTAATTAGAGGTGACGCAGACATTGTAATTGCCCCTCT
AACAGTTAGCTCGAGTCGCGCAAAGTTTATAGCGTTTACCGAGCCATTTA
TGACATTTGGTTTGTCATTAATTATGAAAAAGCCTGTTGAAACTAAACCG
GGAGTTTTTAGTTTCATGAAACCTATCTCAGACAACGTGTGGATTTGTAC
CGGAAGTGCTTGTTTGTTTATTGCGATCGGATTGAGAGTAATTGCCAACA
TCAGCCCGTATGAATGGAAACGCGATGAAGCATTTAACATGGGAAATAGC
TTTTGGTTTAGTTTTGCTGCTGTTGTGCGACAAGGAGCGGAAATATTTCC
AAAGTCACCGGGAGCAAGAATTTTAGCCAGTATTTGGTGGATGTTTTCAT
TGGTTCACATTGCATATTATACGGCAAATCTAGCCGCATTTTTATCAGTA
GCAAATCTGATTTCTCCTATTACAAAGATTCACGATCTTGTGGAGAAGAA
AGATCTCGGAATCAAGGTTGGTACACTTGATGCTGGGTCAACGAAAGAAT
ATTTCGCTACTTCTACATTTTATCCATATAATAAAGTATACGAAATTATG
CAACAGAATCCATCGGTTTATACTAAAACAATAGATGAAGGCGTCCAACG
GGTTCGTGAAGAACAAGGTAAATATGTATTTATTCTTGAGTCAAAAATGA
ATGAATATAAAAATAACAAACACCCTTGTGACACTATGATGGTCGGCAGT
GTTTTTGGCAGTAAAGCCTACGCTGTGGCTACTCGATCAAATGACAACAA
AATGCTGGACATGAAAGAACAGATAACCGATGCTATTTTACAACTACGAG
AAAAACAAACCCTTGCAAAGCTTTACACCAAGTGGTGGATTAAAAAAGGT
GAATGTATAGTCGAGTCTGGCGGAAGTGCTTCCAAGCCTCTAGCGTTAGC
AAATTTATCCGGAGTGTTCTATATCCTCTTTTTTGGAATAATGTTATCCC
TTGTCCTTGGCCTAACGGACTTTCTCTATAAATTACATCAGATTAAACAA
AAAAGAAAATTAAGTCAATATCCAGAAGCCAGGAGTTAAATTTTTAATTA
TTCTTCAATTATTTTTTTTATCTTTTCTCTTTAAGTAGTTGGGATTCATA
TGTTTATGTATAAAGTTTTTATTTTTGTCAAATATTTTGCCTTGAGTTAT
TGTAGCAATATAAAAAACCTCACAAATAAAGGC
back to top

protein sequence of SMED30021366-orf-1

>SMED30021366-orf-1 ID=SMED30021366-orf-1|Name=SMED30021366-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=650bp
MNERKIVVDLDGRSEVEELLRCLKLLGMLRQEYHYLMVNFRIMQLPLSSY
KSSRVNITGFHILDYLHQETRVFITQWTRLLGDEELSSVAFILDAFRVLQ
SLFNNNRFRNPSAPNREIDCTSFFTFFNTSVKVKSNDGKDLIDYIKSINT
VGQTGPIMFDNKTCVRKNATIILTKFNGQGGGEIIAKSNPDETWDIMLNN
EKNPNEESMHLKNRSHVIKVVTILANPFVMLASDSSKSSKIGKKNLEGYC
IDLAEEIFGMINQSYEIHLVKDNLYGAYVKENDTWNGMVGELIRGDADIV
IAPLTVSSSRAKFIAFTEPFMTFGLSLIMKKPVETKPGVFSFMKPISDNV
WICTGSACLFIAIGLRVIANISPYEWKRDEAFNMGNSFWFSFAAVVRQGA
EIFPKSPGARILASIWWMFSLVHIAYYTANLAAFLSVANLISPITKIHDL
VEKKDLGIKVGTLDAGSTKEYFATSTFYPYNKVYEIMQQNPSVYTKTIDE
GVQRVREEQGKYVFILESKMNEYKNNKHPCDTMMVGSVFGSKAYAVATRS
NDNKMLDMKEQITDAILQLREKQTLAKLYTKWWIKKGECIVESGGSASKP
LALANLSGVFYILFFGIMLSLVLGLTDFLYKLHQIKQKRKLSQYPEARS*
back to top

protein sequence of SMED30021366-orf-2

>SMED30021366-orf-2 ID=SMED30021366-orf-2|Name=SMED30021366-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=117bp
LSYFTLSMILRKPLINWTIFLGLSQLCDCRFALLWSNESFEFNKVLEYVS
NDWNLKQYFTKYAVNTSNPGKFQKELCEIAQSNERPIIGRLDLEGRLIVE
SFTKHFNSIYYMESVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0038023signaling receptor activity
GO:0005216ion channel activity
GO:0004872receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
GO:0004970ionotropic glutamate receptor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001508Iono_rcpt_met
IPR019594Glu/Gly-bd
IPR001320Iontro_rcpt
IPR001828ANF_lig-bd_rcpt
IPR028082Peripla_BP_I
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
GO:0035235ionotropic glutamate receptor signaling pathway
GO:0060079excitatory postsynaptic potential
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0045202synapse
GO:0045211postsynaptic membrane