Alanine aminotransferase

Overview
NameAlanine aminotransferase
Smed IDSMED30021348
Length (bp)2198
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Alanine aminotransferase (SMED30021348) t-SNE clustered cells

Violin plots show distribution of expression levels for Alanine aminotransferase (SMED30021348) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Alanine aminotransferase (SMED30021348) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Alanine aminotransferase (SMED30021348) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021348

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30021348SMESG000007248.1 Contig1130uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30021348SMESG000007248.1 Contig1130newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30021348SMESG000063458.1 Contig1130uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30021348SMESG000063458.1 Contig1130newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30021348SMESG000007253.1 SMESG000007248.1 dd_Smed_v4_2988_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021348SMESG000007253.1 SMESG000007248.1 dd_Smed_v4_2988_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30021348SMESG000007253.1 SMESG000007248.1 dd_Smed_v4_2988_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30021348SMESG000007253.1 SMESG000007248.1 dd_Smed_v4_2988_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30021348SMESG000007253.1 SMESG000007248.1 dd_Smed_v6_2988_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Alanine aminotransferase vs. Ensembl Human
Match: GPT2 (glutamic--pyruvic transaminase 2 [Source:HGNC Symbol;Acc:HGNC:18062])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 267/470 (56.81%), Postives = 349/470 (74.26%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFHL 2002
            +T+++MNP  K +EYAVRGPIV +A E+E EL++G   PF EVI+ NIGD  AMGQ+PITF+RQV AL   P + + P+FP DAK+RA+RIL++CGG S+GSYS S GV  IR+D A +I+ RDG +P++  +I+++ GAS+ I +IL+IL +   GK R GVMIPIPQYPLYSA  +E +A Q+ Y+L+E+  W L+  EL RA+ EAKD C P+ + IINPGNPTGQV +R  IE VI FA +  L ++ADEVYQ N+Y+ +  F S KK L+EMG EY+ +V LASF STSKGYMGECG+RGGY E+IN   E+K QL K LS RLC  V GQ  +D+VVN P  GE S+E F +EK  VL +L  K KL  + FN +PG  CN +QGAMYAFP+I +P K + AA+A     D FYC+ LLE+TG+CVVPGSGFGQ+EGT+HFR+TILPPVEK++TV++ +K+FH+
Sbjct:   48 LTLESMNPQVKAVEYAVRGPIVLKAGEIELELQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPNLLDSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAYITRRDGGVPADPDNIYLTTGASDGISTILKILVS-GGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHI 516          

HSP 2 Score: 120.939 bits (302), Expect = 3.598e-28
Identity = 60/108 (55.56%), Postives = 79/108 (73.15%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVS---SQG 592
            +T+++MNP V+ +EYAVRGPIV +A E+E E+ +G   PF EVI+ NIGD  AMGQ+PITF+RQV AL   P L + P+ P DAK+RA+ IL  CGG+S+ S   SQG
Sbjct:   48 LTLESMNPQVKAVEYAVRGPIVLKAGEIELELQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPNLLDSPSFPEDAKKRARRILQACGGNSLGSYSASQG 155          
BLAST of Alanine aminotransferase vs. Ensembl Human
Match: GPT (glutamic--pyruvic transaminase [Source:HGNC Symbol;Acc:HGNC:4552])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 264/469 (56.29%), Postives = 350/469 (74.63%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T+D MNP  +R+EYAVRGPIVQRALELE EL++G   PF EVI+ NIGD  AMGQ+PITF+RQV AL   P++ + PNFP DAK+RA+RIL++CGG S+G+YS S+G+++IR+D A++I  RDG IP++  ++F+S GAS+AI ++L++L    +G  R GV+IPIPQYPLYSAT AE  A Q+ Y+L+E++ W L   EL RA+ +A+D C PRA+ +INPGNPTGQV TR+ IE VIRFA +  L ++ADEVYQ N+YA    F S KK L EMG  Y     LASF STSKGYMGECGFRGGY E++N D  V+ Q+ K +S RLC  V GQ +LD+VV+ P   +PS+  F+ EK  VL++L AK KL  + FN  PG  CN VQGAMY+FP+++LPP+ +  A+ L    D F+CL LLE+TG+CVVPGSGFGQ+EGT+HFR+TILPP+EK++ +++ +  FH
Sbjct:   21 LTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLL-VAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPYAGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQLPPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFH 488          

HSP 2 Score: 138.658 bits (348), Expect = 3.217e-34
Identity = 64/100 (64.00%), Postives = 77/100 (77.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV 577
            +T+D MNP VRR+EYAVRGPIVQRA+ELE E+ QG   PF EVI+ NIGD  AMGQ+PITF+RQV AL   P+L + PN P DAK+RA+ IL  CGG S+
Sbjct:   21 LTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSL 120          
BLAST of Alanine aminotransferase vs. Ensembl Human
Match: GPT (glutamic--pyruvic transaminase [Source:HGNC Symbol;Acc:HGNC:4552])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 264/469 (56.29%), Postives = 350/469 (74.63%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T+D MNP  +R+EYAVRGPIVQRALELE EL++G   PF EVI+ NIGD  AMGQ+PITF+RQV AL   P++ + PNFP DAK+RA+RIL++CGG S+G+YS S+G+++IR+D A++I  RDG IP++  ++F+S GAS+AI ++L++L    +G  R GV+IPIPQYPLYSAT AE  A Q+ Y+L+E++ W L   EL RA+ +A+D C PRA+ +INPGNPTGQV TR+ IE VIRFA +  L ++ADEVYQ N+YA    F S KK L EMG  Y     LASF STSKGYMGECGFRGGY E++N D  V+ Q+ K +S RLC  V GQ +LD+VV+ P   +PS+  F+ EK  VL++L AK KL  + FN  PG  CN VQGAMY+FP+++LPP+ +  A+ L    D F+CL LLE+TG+CVVPGSGFGQ+EGT+HFR+TILPP+EK++ +++ +  FH
Sbjct:   21 LTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQLIREDVARYIERRDGGIPADPNNVFLSTGASDAIVTVLKLL-VAGEGHTRTGVLIPIPQYPLYSATLAELGAVQVDYYLDEERAWALDVAELHRALGQARDHCRPRALCVINPGNPTGQVQTRECIEAVIRFAFEERLFLLADEVYQDNVYAAGSQFHSFKKVLMEMGPPYAGQQELASFHSTSKGYMGECGFRGGYVEVVNMDAAVQQQMLKLMSVRLCPPVPGQALLDLVVSPPAPTDPSFAQFQAEKQAVLAELAAKAKLTEQVFNEAPGISCNPVQGAMYSFPRVQLPPRAVERAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPLEKLRLLLEKLSRFH 488          

HSP 2 Score: 138.658 bits (348), Expect = 3.217e-34
Identity = 64/100 (64.00%), Postives = 77/100 (77.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV 577
            +T+D MNP VRR+EYAVRGPIVQRA+ELE E+ QG   PF EVI+ NIGD  AMGQ+PITF+RQV AL   P+L + PN P DAK+RA+ IL  CGG S+
Sbjct:   21 LTLDGMNPRVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSL 120          
BLAST of Alanine aminotransferase vs. Ensembl Human
Match: GPT2 (glutamic--pyruvic transaminase 2 [Source:HGNC Symbol;Acc:HGNC:18062])

HSP 1 Score: 504.212 bits (1297), Expect = 4.096e-173
Identity = 237/417 (56.83%), Postives = 309/417 (74.10%), Query Frame = 2
Query:  755 MGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFHL 2002
            MGQ+PITF+RQV AL   P + + P+FP DAK+RA+RIL++CGG S+GSYS S GV  IR+D A +I+ RDG +P++  +I+++ GAS+ I +IL+IL +   GK R GVMIPIPQYPLYSA  +E +A Q+ Y+L+E+  W L+  EL RA+ EAKD C P+ + IINPGNPTGQV +R  IE VI FA +  L ++ADEVYQ N+Y+ +  F S KK L+EMG EY+ +V LASF STSKGYMGECG+RGGY E+IN   E+K QL K LS RLC  V GQ  +D+VVN P  GE S+E F +EK  VL +L  K KL  + FN +PG  CN +QGAMYAFP+I +P K + AA+A     D FYC+ LLE+TG+CVVPGSGFGQ+EGT+HFR+TILPPVEK++TV++ +K+FH+
Sbjct:    1 MGQQPITFLRQVMALCTYPNLLDSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAYITRRDGGVPADPDNIYLTTGASDGISTILKILVS-GGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYEMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQAHQMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVEKLKTVLQKVKDFHI 416          

HSP 2 Score: 61.6178 bits (148), Expect = 2.811e-9
Identity = 31/55 (56.36%), Postives = 39/55 (70.91%), Query Frame = 2
Query:  437 MGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVS---SQG 592
            MGQ+PITF+RQV AL   P L + P+ P DAK+RA+ IL  CGG+S+ S   SQG
Sbjct:    1 MGQQPITFLRQVMALCTYPNLLDSPSFPEDAKKRARRILQACGGNSLGSYSASQG 55          
BLAST of Alanine aminotransferase vs. Ensembl Human
Match: GPT2 (glutamic--pyruvic transaminase 2 [Source:HGNC Symbol;Acc:HGNC:18062])

HSP 1 Score: 205.297 bits (521), Expect = 1.827e-61
Identity = 95/178 (53.37%), Postives = 130/178 (73.03%), Query Frame = 2
Query:  689 LKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERD-GIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEA 1219
            +++G   PF EVI+ NIGD  AMGQ+PITF+RQV AL   P + + P+FP DAK+RA+RIL++CGG S+GSYS S GV  IR+D A +I+ RD G+P++  +I+++ GAS+ I +IL+IL     GK R GVMIPIPQYPLYSA  +E +A Q+ Y+L+E+  W L+  EL RA+ EA
Sbjct:    1 MQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPNLLDSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAYITRRDGGVPADPDNIYLTTGASDGISTILKIL-VSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEENCWALNVNELRRAVQEA 177          

HSP 2 Score: 85.1149 bits (209), Expect = 1.914e-18
Identity = 43/77 (55.84%), Postives = 53/77 (68.83%), Query Frame = 2
Query:  371 MNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVS---SQG 592
            M +G   PF EVI+ NIGD  AMGQ+PITF+RQV AL   P L + P+ P DAK+RA+ IL  CGG+S+ S   SQG
Sbjct:    1 MQRGIKKPFTEVIRANIGDAQAMGQQPITFLRQVMALCTYPNLLDSPSFPEDAKKRARRILQACGGNSLGSYSASQG 77          
BLAST of Alanine aminotransferase vs. Ensembl Celegans
Match: C32F10.8 (pep chromosome:WBcel235:I:5822841:5825231:-1 gene:WBGene00016333.1 transcript:C32F10.8a.4 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C32F10.8)

HSP 1 Score: 527.709 bits (1358), Expect = 0.000e+0
Identity = 255/479 (53.24%), Postives = 338/479 (70.56%), Query Frame = 2
Query:  569 SSVVSSQGPITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPE-MQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            + +++S   +   N+NP+  ++EYAVRGPIV RA+ELE EL  G   PF  VIK NIGD HAMGQKPITFIRQ+ A +  PE M+ D + PSD  + A   L SCGG S G+YSQSTGVEI+R+  A++I  RDG IP  S+D+ +S GASE+I+++L++     + K + GVMIPIPQYPLYSAT  E+   Q+GY+L E   W + E ELER+ N+   +   R + IINPGNPTGQ L+R++IE +I+FA+K NL +MADEVYQ N+YA+   F S KK L EMG  YNK + LASF S SKGYMGECG RGGY E +N D EV     K +SA+LCS+V+GQ ++D VVN PK+G+ SY L+++EK+ VL+ LK +  LV + ++S+ G  CN VQGAMYAFP+I +P + +  A++LN   DFFY + LLE TG+C+VPGSGFGQK+GT+HFR TILP  E  + ++    +FH
Sbjct:   20 TRIMASGKTLNTSNINPNVIKMEYAVRGPIVIRAVELEKELATGAQKPFPNVIKANIGDAHAMGQKPITFIRQLLACIVNPEIMKTDKSIPSDVIEHANAFLGSCGGKSAGAYSQSTGVEIVRKHVAEYIKRRDGGIPCNSEDVCLSGGASESIRNVLKLFINHNNAK-KVGVMIPIPQYPLYSATIEEFGLGQVGYYLSESSNWSMDEAELERSFNDHCKEYDIRVLCIINPGNPTGQALSRENIETIIKFAQKKNLFLMADEVYQDNVYAQGSQFHSFKKVLVEMGEPYNK-MELASFHSVSKGYMGECGMRGGYVEFLNLDPEVYVLFKKMISAKLCSTVLGQAVIDAVVNPPKEGDASYALWKQEKDAVLASLKERATLVEKAYSSIDGISCNPVQGAMYAFPQITIPQRAVEKAQSLNQQPDFFYAMQLLETTGICIVPGSGFGQKDGTYHFRTTILPQPELFKDMLSRFTDFH 496          

HSP 2 Score: 118.242 bits (295), Expect = 8.518e-28
Identity = 57/100 (57.00%), Postives = 71/100 (71.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPE-LQNDPNIPRDAKERAQSILGNCGGSS 574
            +   N+NP+V ++EYAVRGPIV RA+ELE E+  G   PF  VIK NIGD HAMGQKPITFIRQ+ A +  PE ++ D +IP D  E A + LG+CGG S
Sbjct:   29 LNTSNINPNVIKMEYAVRGPIVIRAVELEKELATGAQKPFPNVIKANIGDAHAMGQKPITFIRQLLACIVNPEIMKTDKSIPSDVIEHANAFLGSCGGKS 128          
BLAST of Alanine aminotransferase vs. Ensembl Celegans
Match: C32F10.8 (pep chromosome:WBcel235:I:5822841:5826147:-1 gene:WBGene00016333.1 transcript:C32F10.8a.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C32F10.8)

HSP 1 Score: 527.709 bits (1358), Expect = 0.000e+0
Identity = 255/479 (53.24%), Postives = 338/479 (70.56%), Query Frame = 2
Query:  569 SSVVSSQGPITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPE-MQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            + +++S   +   N+NP+  ++EYAVRGPIV RA+ELE EL  G   PF  VIK NIGD HAMGQKPITFIRQ+ A +  PE M+ D + PSD  + A   L SCGG S G+YSQSTGVEI+R+  A++I  RDG IP  S+D+ +S GASE+I+++L++     + K + GVMIPIPQYPLYSAT  E+   Q+GY+L E   W + E ELER+ N+   +   R + IINPGNPTGQ L+R++IE +I+FA+K NL +MADEVYQ N+YA+   F S KK L EMG  YNK + LASF S SKGYMGECG RGGY E +N D EV     K +SA+LCS+V+GQ ++D VVN PK+G+ SY L+++EK+ VL+ LK +  LV + ++S+ G  CN VQGAMYAFP+I +P + +  A++LN   DFFY + LLE TG+C+VPGSGFGQK+GT+HFR TILP  E  + ++    +FH
Sbjct:   20 TRIMASGKTLNTSNINPNVIKMEYAVRGPIVIRAVELEKELATGAQKPFPNVIKANIGDAHAMGQKPITFIRQLLACIVNPEIMKTDKSIPSDVIEHANAFLGSCGGKSAGAYSQSTGVEIVRKHVAEYIKRRDGGIPCNSEDVCLSGGASESIRNVLKLFINHNNAK-KVGVMIPIPQYPLYSATIEEFGLGQVGYYLSESSNWSMDEAELERSFNDHCKEYDIRVLCIINPGNPTGQALSRENIETIIKFAQKKNLFLMADEVYQDNVYAQGSQFHSFKKVLVEMGEPYNK-MELASFHSVSKGYMGECGMRGGYVEFLNLDPEVYVLFKKMISAKLCSTVLGQAVIDAVVNPPKEGDASYALWKQEKDAVLASLKERATLVEKAYSSIDGISCNPVQGAMYAFPQITIPQRAVEKAQSLNQQPDFFYAMQLLETTGICIVPGSGFGQKDGTYHFRTTILPQPELFKDMLSRFTDFH 496          

HSP 2 Score: 118.242 bits (295), Expect = 8.518e-28
Identity = 57/100 (57.00%), Postives = 71/100 (71.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPE-LQNDPNIPRDAKERAQSILGNCGGSS 574
            +   N+NP+V ++EYAVRGPIV RA+ELE E+  G   PF  VIK NIGD HAMGQKPITFIRQ+ A +  PE ++ D +IP D  E A + LG+CGG S
Sbjct:   29 LNTSNINPNVIKMEYAVRGPIVIRAVELEKELATGAQKPFPNVIKANIGDAHAMGQKPITFIRQLLACIVNPEIMKTDKSIPSDVIEHANAFLGSCGGKS 128          
BLAST of Alanine aminotransferase vs. Ensembl Celegans
Match: C32F10.8 (pep chromosome:WBcel235:I:5822841:5825074:-1 gene:WBGene00016333.1 transcript:C32F10.8a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C32F10.8)

HSP 1 Score: 527.709 bits (1358), Expect = 0.000e+0
Identity = 255/479 (53.24%), Postives = 338/479 (70.56%), Query Frame = 2
Query:  569 SSVVSSQGPITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPE-MQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            + +++S   +   N+NP+  ++EYAVRGPIV RA+ELE EL  G   PF  VIK NIGD HAMGQKPITFIRQ+ A +  PE M+ D + PSD  + A   L SCGG S G+YSQSTGVEI+R+  A++I  RDG IP  S+D+ +S GASE+I+++L++     + K + GVMIPIPQYPLYSAT  E+   Q+GY+L E   W + E ELER+ N+   +   R + IINPGNPTGQ L+R++IE +I+FA+K NL +MADEVYQ N+YA+   F S KK L EMG  YNK + LASF S SKGYMGECG RGGY E +N D EV     K +SA+LCS+V+GQ ++D VVN PK+G+ SY L+++EK+ VL+ LK +  LV + ++S+ G  CN VQGAMYAFP+I +P + +  A++LN   DFFY + LLE TG+C+VPGSGFGQK+GT+HFR TILP  E  + ++    +FH
Sbjct:   20 TRIMASGKTLNTSNINPNVIKMEYAVRGPIVIRAVELEKELATGAQKPFPNVIKANIGDAHAMGQKPITFIRQLLACIVNPEIMKTDKSIPSDVIEHANAFLGSCGGKSAGAYSQSTGVEIVRKHVAEYIKRRDGGIPCNSEDVCLSGGASESIRNVLKLFINHNNAK-KVGVMIPIPQYPLYSATIEEFGLGQVGYYLSESSNWSMDEAELERSFNDHCKEYDIRVLCIINPGNPTGQALSRENIETIIKFAQKKNLFLMADEVYQDNVYAQGSQFHSFKKVLVEMGEPYNK-MELASFHSVSKGYMGECGMRGGYVEFLNLDPEVYVLFKKMISAKLCSTVLGQAVIDAVVNPPKEGDASYALWKQEKDAVLASLKERATLVEKAYSSIDGISCNPVQGAMYAFPQITIPQRAVEKAQSLNQQPDFFYAMQLLETTGICIVPGSGFGQKDGTYHFRTTILPQPELFKDMLSRFTDFH 496          

HSP 2 Score: 118.242 bits (295), Expect = 8.518e-28
Identity = 57/100 (57.00%), Postives = 71/100 (71.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPE-LQNDPNIPRDAKERAQSILGNCGGSS 574
            +   N+NP+V ++EYAVRGPIV RA+ELE E+  G   PF  VIK NIGD HAMGQKPITFIRQ+ A +  PE ++ D +IP D  E A + LG+CGG S
Sbjct:   29 LNTSNINPNVIKMEYAVRGPIVIRAVELEKELATGAQKPFPNVIKANIGDAHAMGQKPITFIRQLLACIVNPEIMKTDKSIPSDVIEHANAFLGSCGGKS 128          
BLAST of Alanine aminotransferase vs. Ensembl Celegans
Match: C32F10.8 (pep chromosome:WBcel235:I:5822841:5826148:-1 gene:WBGene00016333.1 transcript:C32F10.8a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C32F10.8)

HSP 1 Score: 527.709 bits (1358), Expect = 0.000e+0
Identity = 255/479 (53.24%), Postives = 338/479 (70.56%), Query Frame = 2
Query:  569 SSVVSSQGPITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPE-MQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            + +++S   +   N+NP+  ++EYAVRGPIV RA+ELE EL  G   PF  VIK NIGD HAMGQKPITFIRQ+ A +  PE M+ D + PSD  + A   L SCGG S G+YSQSTGVEI+R+  A++I  RDG IP  S+D+ +S GASE+I+++L++     + K + GVMIPIPQYPLYSAT  E+   Q+GY+L E   W + E ELER+ N+   +   R + IINPGNPTGQ L+R++IE +I+FA+K NL +MADEVYQ N+YA+   F S KK L EMG  YNK + LASF S SKGYMGECG RGGY E +N D EV     K +SA+LCS+V+GQ ++D VVN PK+G+ SY L+++EK+ VL+ LK +  LV + ++S+ G  CN VQGAMYAFP+I +P + +  A++LN   DFFY + LLE TG+C+VPGSGFGQK+GT+HFR TILP  E  + ++    +FH
Sbjct:   20 TRIMASGKTLNTSNINPNVIKMEYAVRGPIVIRAVELEKELATGAQKPFPNVIKANIGDAHAMGQKPITFIRQLLACIVNPEIMKTDKSIPSDVIEHANAFLGSCGGKSAGAYSQSTGVEIVRKHVAEYIKRRDGGIPCNSEDVCLSGGASESIRNVLKLFINHNNAK-KVGVMIPIPQYPLYSATIEEFGLGQVGYYLSESSNWSMDEAELERSFNDHCKEYDIRVLCIINPGNPTGQALSRENIETIIKFAQKKNLFLMADEVYQDNVYAQGSQFHSFKKVLVEMGEPYNK-MELASFHSVSKGYMGECGMRGGYVEFLNLDPEVYVLFKKMISAKLCSTVLGQAVIDAVVNPPKEGDASYALWKQEKDAVLASLKERATLVEKAYSSIDGISCNPVQGAMYAFPQITIPQRAVEKAQSLNQQPDFFYAMQLLETTGICIVPGSGFGQKDGTYHFRTTILPQPELFKDMLSRFTDFH 496          

HSP 2 Score: 118.242 bits (295), Expect = 8.518e-28
Identity = 57/100 (57.00%), Postives = 71/100 (71.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPE-LQNDPNIPRDAKERAQSILGNCGGSS 574
            +   N+NP+V ++EYAVRGPIV RA+ELE E+  G   PF  VIK NIGD HAMGQKPITFIRQ+ A +  PE ++ D +IP D  E A + LG+CGG S
Sbjct:   29 LNTSNINPNVIKMEYAVRGPIVIRAVELEKELATGAQKPFPNVIKANIGDAHAMGQKPITFIRQLLACIVNPEIMKTDKSIPSDVIEHANAFLGSCGGKS 128          
BLAST of Alanine aminotransferase vs. Ensembl Celegans
Match: C32F10.8 (pep chromosome:WBcel235:I:5823081:5825231:-1 gene:WBGene00016333.1 transcript:C32F10.8b.4 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C32F10.8)

HSP 1 Score: 358.221 bits (918), Expect = 8.448e-118
Identity = 179/327 (54.74%), Postives = 229/327 (70.03%), Query Frame = 2
Query:  569 SSVVSSQGPITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPE-MQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEV 1543
            + +++S   +   N+NP+  ++EYAVRGPIV RA+ELE EL  G   PF  VIK NIGD HAMGQKPITFIRQ+ A +  PE M+ D + PSD  + A   L SCGG S G+YSQSTGVEI+R+  A++I  RDG IP  S+D+ +S GASE+I+++L++     + K + GVMIPIPQYPLYSAT  E+   Q+GY+L E   W + E ELER+ N+   +   R + IINPGNPTGQ L+R++IE +I+FA+K NL +MADEVYQ N+YA+   F S KK L EMG  YNK + LASF S SKGYMGECG RGGY E +N D EV
Sbjct:   20 TRIMASGKTLNTSNINPNVIKMEYAVRGPIVIRAVELEKELATGAQKPFPNVIKANIGDAHAMGQKPITFIRQLLACIVNPEIMKTDKSIPSDVIEHANAFLGSCGGKSAGAYSQSTGVEIVRKHVAEYIKRRDGGIPCNSEDVCLSGGASESIRNVLKLFINHNNAK-KVGVMIPIPQYPLYSATIEEFGLGQVGYYLSESSNWSMDEAELERSFNDHCKEYDIRVLCIINPGNPTGQALSRENIETIIKFAQKKNLFLMADEVYQDNVYAQGSQFHSFKKVLVEMGEPYNK-MELASFHSVSKGYMGECGMRGGYVEFLNLDPEV 344          

HSP 2 Score: 117.857 bits (294), Expect = 1.455e-28
Identity = 57/100 (57.00%), Postives = 71/100 (71.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPE-LQNDPNIPRDAKERAQSILGNCGGSS 574
            +   N+NP+V ++EYAVRGPIV RA+ELE E+  G   PF  VIK NIGD HAMGQKPITFIRQ+ A +  PE ++ D +IP D  E A + LG+CGG S
Sbjct:   29 LNTSNINPNVIKMEYAVRGPIVIRAVELEKELATGAQKPFPNVIKANIGDAHAMGQKPITFIRQLLACIVNPEIMKTDKSIPSDVIEHANAFLGSCGGKS 128          
BLAST of Alanine aminotransferase vs. Ensembl Fly
Match: CG1640 (gene:FBgn0030478 transcript:FBtr0073770)

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 250/474 (52.74%), Postives = 346/474 (73.00%), Query Frame = 2
Query:  581 SSQGPITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            SS   +T+DN+NP+   +EYAVRGP+V RA E+E EL+KG   PF +VI+ NIGDCHAMGQ+P+TF+RQ+ AL     + + P++P D K+RA  IL  C G S+GSY+ S G+E++R+  A++I +RDG I S  QDI+++ GAS  IKSIL +++ +  G    GVM+PIPQYPLYSAT +EY   ++ Y+LEE+  W L  KEL+R+ +EAK  C+PRA+V+INPGNPTGQVLTR++IE +I+FA  + +L++ADEVYQ N+Y +N  F S KK  +EMG  Y +++ + SF+STSKGY+GECG RGGY E++N D +VKA L K ++A LCS+  GQ  +  +VN P+ GEPSY+L++KE++ +L+ LK + +LV +  NS  G+K N VQGAMY FP+IE+PPK I AAKA     D FY   LLE +G+C+VPGSGFGQK GT+HFR TILP  +K++ +M+  + FH
Sbjct:   89 SSSKALTLDNINPNFIAMEYAVRGPLVIRAGEIEKELEKGVKKPFDQVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKRACAILNGCQGQSVGSYTDSAGLEVVRRQVAQYIEKRDGGIASNWQDIYLTGGASPGIKSILSMINAEV-GCKAPGVMVPIPQYPLYSATISEYGMTKVDYYLEEETGWSLDRKELQRSYDEAKKVCNPRALVVINPGNPTGQVLTRENIEEIIKFAHDNKVLVLADEVYQDNVYDKNSKFWSFKKVAYEMGDPY-RNLEMVSFLSTSKGYLGECGIRGGYMEVLNLDPKVKAMLTKSITAALCSTTAGQVAVSALVNPPQPGEPSYDLYKKERDGILAALKERAELVHKALNSFEGYKVNPVQGAMYVFPQIEIPPKAIEAAKAKGMAPDVFYAFELLETSGICIVPGSGFGQKPGTWHFRSTILPQTDKLKLMMEKFRVFH 560          

HSP 2 Score: 117.472 bits (293), Expect = 3.730e-27
Identity = 54/102 (52.94%), Postives = 73/102 (71.57%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVS 583
            +T+DN+NP+   +EYAVRGP+V RA E+E E+ +G   PF +VI+ NIGDCHAMGQ+P+TF+RQ+ AL     L + P+ P D K+RA +IL  C G SV S
Sbjct:   94 LTLDNINPNFIAMEYAVRGPLVIRAGEIEKELEKGVKKPFDQVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKRACAILNGCQGQSVGS 195          
BLAST of Alanine aminotransferase vs. Ensembl Fly
Match: CG1640 (gene:FBgn0030478 transcript:FBtr0073769)

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 250/474 (52.74%), Postives = 346/474 (73.00%), Query Frame = 2
Query:  581 SSQGPITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            SS   +T+DN+NP+   +EYAVRGP+V RA E+E EL+KG   PF +VI+ NIGDCHAMGQ+P+TF+RQ+ AL     + + P++P D K+RA  IL  C G S+GSY+ S G+E++R+  A++I +RDG I S  QDI+++ GAS  IKSIL +++ +  G    GVM+PIPQYPLYSAT +EY   ++ Y+LEE+  W L  KEL+R+ +EAK  C+PRA+V+INPGNPTGQVLTR++IE +I+FA  + +L++ADEVYQ N+Y +N  F S KK  +EMG  Y +++ + SF+STSKGY+GECG RGGY E++N D +VKA L K ++A LCS+  GQ  +  +VN P+ GEPSY+L++KE++ +L+ LK + +LV +  NS  G+K N VQGAMY FP+IE+PPK I AAKA     D FY   LLE +G+C+VPGSGFGQK GT+HFR TILP  +K++ +M+  + FH
Sbjct:   96 SSSKALTLDNINPNFIAMEYAVRGPLVIRAGEIEKELEKGVKKPFDQVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKRACAILNGCQGQSVGSYTDSAGLEVVRRQVAQYIEKRDGGIASNWQDIYLTGGASPGIKSILSMINAEV-GCKAPGVMVPIPQYPLYSATISEYGMTKVDYYLEEETGWSLDRKELQRSYDEAKKVCNPRALVVINPGNPTGQVLTRENIEEIIKFAHDNKVLVLADEVYQDNVYDKNSKFWSFKKVAYEMGDPY-RNLEMVSFLSTSKGYLGECGIRGGYMEVLNLDPKVKAMLTKSITAALCSTTAGQVAVSALVNPPQPGEPSYDLYKKERDGILAALKERAELVHKALNSFEGYKVNPVQGAMYVFPQIEIPPKAIEAAKAKGMAPDVFYAFELLETSGICIVPGSGFGQKPGTWHFRSTILPQTDKLKLMMEKFRVFH 567          

HSP 2 Score: 117.472 bits (293), Expect = 4.007e-27
Identity = 54/102 (52.94%), Postives = 73/102 (71.57%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVS 583
            +T+DN+NP+   +EYAVRGP+V RA E+E E+ +G   PF +VI+ NIGDCHAMGQ+P+TF+RQ+ AL     L + P+ P D K+RA +IL  C G SV S
Sbjct:  101 LTLDNINPNFIAMEYAVRGPLVIRAGEIEKELEKGVKKPFDQVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKRACAILNGCQGQSVGS 202          
BLAST of Alanine aminotransferase vs. Ensembl Fly
Match: CG1640 (gene:FBgn0030478 transcript:FBtr0073773)

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 250/474 (52.74%), Postives = 346/474 (73.00%), Query Frame = 2
Query:  581 SSQGPITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            SS   +T+DN+NP+   +EYAVRGP+V RA E+E EL+KG   PF +VI+ NIGDCHAMGQ+P+TF+RQ+ AL     + + P++P D K+RA  IL  C G S+GSY+ S G+E++R+  A++I +RDG I S  QDI+++ GAS  IKSIL +++ +  G    GVM+PIPQYPLYSAT +EY   ++ Y+LEE+  W L  KEL+R+ +EAK  C+PRA+V+INPGNPTGQVLTR++IE +I+FA  + +L++ADEVYQ N+Y +N  F S KK  +EMG  Y +++ + SF+STSKGY+GECG RGGY E++N D +VKA L K ++A LCS+  GQ  +  +VN P+ GEPSY+L++KE++ +L+ LK + +LV +  NS  G+K N VQGAMY FP+IE+PPK I AAKA     D FY   LLE +G+C+VPGSGFGQK GT+HFR TILP  +K++ +M+  + FH
Sbjct:   89 SSSKALTLDNINPNFIAMEYAVRGPLVIRAGEIEKELEKGVKKPFDQVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKRACAILNGCQGQSVGSYTDSAGLEVVRRQVAQYIEKRDGGIASNWQDIYLTGGASPGIKSILSMINAEV-GCKAPGVMVPIPQYPLYSATISEYGMTKVDYYLEEETGWSLDRKELQRSYDEAKKVCNPRALVVINPGNPTGQVLTRENIEEIIKFAHDNKVLVLADEVYQDNVYDKNSKFWSFKKVAYEMGDPY-RNLEMVSFLSTSKGYLGECGIRGGYMEVLNLDPKVKAMLTKSITAALCSTTAGQVAVSALVNPPQPGEPSYDLYKKERDGILAALKERAELVHKALNSFEGYKVNPVQGAMYVFPQIEIPPKAIEAAKAKGMAPDVFYAFELLETSGICIVPGSGFGQKPGTWHFRSTILPQTDKLKLMMEKFRVFH 560          

HSP 2 Score: 117.472 bits (293), Expect = 3.730e-27
Identity = 54/102 (52.94%), Postives = 73/102 (71.57%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVS 583
            +T+DN+NP+   +EYAVRGP+V RA E+E E+ +G   PF +VI+ NIGDCHAMGQ+P+TF+RQ+ AL     L + P+ P D K+RA +IL  C G SV S
Sbjct:   94 LTLDNINPNFIAMEYAVRGPLVIRAGEIEKELEKGVKKPFDQVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKRACAILNGCQGQSVGS 195          
BLAST of Alanine aminotransferase vs. Ensembl Fly
Match: CG1640 (gene:FBgn0030478 transcript:FBtr0073774)

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 250/474 (52.74%), Postives = 346/474 (73.00%), Query Frame = 2
Query:  581 SSQGPITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            SS   +T+DN+NP+   +EYAVRGP+V RA E+E EL+KG   PF +VI+ NIGDCHAMGQ+P+TF+RQ+ AL     + + P++P D K+RA  IL  C G S+GSY+ S G+E++R+  A++I +RDG I S  QDI+++ GAS  IKSIL +++ +  G    GVM+PIPQYPLYSAT +EY   ++ Y+LEE+  W L  KEL+R+ +EAK  C+PRA+V+INPGNPTGQVLTR++IE +I+FA  + +L++ADEVYQ N+Y +N  F S KK  +EMG  Y +++ + SF+STSKGY+GECG RGGY E++N D +VKA L K ++A LCS+  GQ  +  +VN P+ GEPSY+L++KE++ +L+ LK + +LV +  NS  G+K N VQGAMY FP+IE+PPK I AAKA     D FY   LLE +G+C+VPGSGFGQK GT+HFR TILP  +K++ +M+  + FH
Sbjct:   89 SSSKALTLDNINPNFIAMEYAVRGPLVIRAGEIEKELEKGVKKPFDQVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKRACAILNGCQGQSVGSYTDSAGLEVVRRQVAQYIEKRDGGIASNWQDIYLTGGASPGIKSILSMINAEV-GCKAPGVMVPIPQYPLYSATISEYGMTKVDYYLEEETGWSLDRKELQRSYDEAKKVCNPRALVVINPGNPTGQVLTRENIEEIIKFAHDNKVLVLADEVYQDNVYDKNSKFWSFKKVAYEMGDPY-RNLEMVSFLSTSKGYLGECGIRGGYMEVLNLDPKVKAMLTKSITAALCSTTAGQVAVSALVNPPQPGEPSYDLYKKERDGILAALKERAELVHKALNSFEGYKVNPVQGAMYVFPQIEIPPKAIEAAKAKGMAPDVFYAFELLETSGICIVPGSGFGQKPGTWHFRSTILPQTDKLKLMMEKFRVFH 560          

HSP 2 Score: 117.472 bits (293), Expect = 3.730e-27
Identity = 54/102 (52.94%), Postives = 73/102 (71.57%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVS 583
            +T+DN+NP+   +EYAVRGP+V RA E+E E+ +G   PF +VI+ NIGDCHAMGQ+P+TF+RQ+ AL     L + P+ P D K+RA +IL  C G SV S
Sbjct:   94 LTLDNINPNFIAMEYAVRGPLVIRAGEIEKELEKGVKKPFDQVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKRACAILNGCQGQSVGS 195          
BLAST of Alanine aminotransferase vs. Ensembl Fly
Match: CG1640 (gene:FBgn0030478 transcript:FBtr0073771)

HSP 1 Score: 531.176 bits (1367), Expect = 0.000e+0
Identity = 250/474 (52.74%), Postives = 346/474 (73.00%), Query Frame = 2
Query:  581 SSQGPITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            SS   +T+DN+NP+   +EYAVRGP+V RA E+E EL+KG   PF +VI+ NIGDCHAMGQ+P+TF+RQ+ AL     + + P++P D K+RA  IL  C G S+GSY+ S G+E++R+  A++I +RDG I S  QDI+++ GAS  IKSIL +++ +  G    GVM+PIPQYPLYSAT +EY   ++ Y+LEE+  W L  KEL+R+ +EAK  C+PRA+V+INPGNPTGQVLTR++IE +I+FA  + +L++ADEVYQ N+Y +N  F S KK  +EMG  Y +++ + SF+STSKGY+GECG RGGY E++N D +VKA L K ++A LCS+  GQ  +  +VN P+ GEPSY+L++KE++ +L+ LK + +LV +  NS  G+K N VQGAMY FP+IE+PPK I AAKA     D FY   LLE +G+C+VPGSGFGQK GT+HFR TILP  +K++ +M+  + FH
Sbjct:   89 SSSKALTLDNINPNFIAMEYAVRGPLVIRAGEIEKELEKGVKKPFDQVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKRACAILNGCQGQSVGSYTDSAGLEVVRRQVAQYIEKRDGGIASNWQDIYLTGGASPGIKSILSMINAEV-GCKAPGVMVPIPQYPLYSATISEYGMTKVDYYLEEETGWSLDRKELQRSYDEAKKVCNPRALVVINPGNPTGQVLTRENIEEIIKFAHDNKVLVLADEVYQDNVYDKNSKFWSFKKVAYEMGDPY-RNLEMVSFLSTSKGYLGECGIRGGYMEVLNLDPKVKAMLTKSITAALCSTTAGQVAVSALVNPPQPGEPSYDLYKKERDGILAALKERAELVHKALNSFEGYKVNPVQGAMYVFPQIEIPPKAIEAAKAKGMAPDVFYAFELLETSGICIVPGSGFGQKPGTWHFRSTILPQTDKLKLMMEKFRVFH 560          

HSP 2 Score: 117.472 bits (293), Expect = 3.730e-27
Identity = 54/102 (52.94%), Postives = 73/102 (71.57%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVS 583
            +T+DN+NP+   +EYAVRGP+V RA E+E E+ +G   PF +VI+ NIGDCHAMGQ+P+TF+RQ+ AL     L + P+ P D K+RA +IL  C G SV S
Sbjct:   94 LTLDNINPNFIAMEYAVRGPLVIRAGEIEKELEKGVKKPFDQVIRANIGDCHAMGQQPLTFLRQLLALTFETRLLDSPDYPEDVKKRACAILNGCQGQSVGS 195          
BLAST of Alanine aminotransferase vs. Ensembl Zebrafish
Match: si:ch211-217a12.1 (si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214-95])

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 275/469 (58.64%), Postives = 344/469 (73.35%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T+D MNP+ KRLEYAVRGPIVQRA++++ ELK G   PF EVIK NIGDCHAMGQKPITF RQV AL + P++  D  FP DAK RA+RIL++CGGGS+G+YS S G+E+IRQD A++I  RDG I  +  +I++S GAS+AI ++L+++ +  +G  R GVMI IPQYPLYSA  AE  A QI Y+L+ED  W L   EL RA+ EAK  C PRA+ IINPGNPTGQV +R  IE VIRFA   NL +M+DEVYQ N+YA+   F S KK L EMG +Y+  V LASF STSK YMGECGFRGGY E++N D EVK QL K +S RLC  V GQ +LDVVVN P+  EPSY+ F KE++  L+ L  K  +  +  N +PG KCN VQGAMY FP+I LPPK I  AK    + D FYC+ LLE+TG+C+VPGSGFGQ++GT+HFR+TILP  +K++ V+  IK+FH
Sbjct:   13 LTVDTMNPNIKRLEYAVRGPIVQRAVQIDKELKMGIKKPFTEVIKANIGDCHAMGQKPITFFRQVLALCSYPDLLEDNKFPEDAKSRAQRILKACGGGSLGAYSTSQGIEMIRQDVARYIERRDGGIACDPDNIYLSTGASDAIVTMLKLMVS-GEGASRTGVMISIPQYPLYSAALAELGAVQINYYLDEDNCWSLDINELRRALQEAKKHCRPRALCIINPGNPTGQVQSRQCIEEVIRFAADENLFLMSDEVYQDNVYADGCKFHSFKKVLFEMGPQYSSKVELASFHSTSKCYMGECGFRGGYMEVVNLDPEVKVQLTKLVSVRLCPPVPGQALLDVVVNPPQPDEPSYDTFIKERSDTLAALAEKASMTQDILNQVPGIKCNPVQGAMYTFPRIHLPPKAILKAKENGQSPDMFYCMKLLEETGICLVPGSGFGQRDGTYHFRMTILPLKDKLKVVLAKIKDFH 480          

HSP 2 Score: 138.272 bits (347), Expect = 2.574e-34
Identity = 66/108 (61.11%), Postives = 80/108 (74.07%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV---VSSQG 592
            +T+D MNP+++RLEYAVRGPIVQRA++++ E+  G   PF EVIK NIGDCHAMGQKPITF RQV AL + P+L  D   P DAK RAQ IL  CGG S+    +SQG
Sbjct:   13 LTVDTMNPNIKRLEYAVRGPIVQRAVQIDKELKMGIKKPFTEVIKANIGDCHAMGQKPITFFRQVLALCSYPDLLEDNKFPEDAKSRAQRILKACGGGSLGAYSTSQG 120          
BLAST of Alanine aminotransferase vs. Ensembl Zebrafish
Match: si:ch211-217a12.1 (si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214-95])

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 275/469 (58.64%), Postives = 344/469 (73.35%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T+D MNP+ KRLEYAVRGPIVQRA++++ ELK G   PF EVIK NIGDCHAMGQKPITF RQV AL + P++  D  FP DAK RA+RIL++CGGGS+G+YS S G+E+IRQD A++I  RDG I  +  +I++S GAS+AI ++L+++ +  +G  R GVMI IPQYPLYSA  AE  A QI Y+L+ED  W L   EL RA+ EAK  C PRA+ IINPGNPTGQV +R  IE VIRFA   NL +M+DEVYQ N+YA+   F S KK L EMG +Y+  V LASF STSK YMGECGFRGGY E++N D EVK QL K +S RLC  V GQ +LDVVVN P+  EPSY+ F KE++  L+ L  K  +  +  N +PG KCN VQGAMY FP+I LPPK I  AK    + D FYC+ LLE+TG+C+VPGSGFGQ++GT+HFR+TILP  +K++ V+  IK+FH
Sbjct:   13 LTVDTMNPNIKRLEYAVRGPIVQRAVQIDKELKMGIKKPFTEVIKANIGDCHAMGQKPITFFRQVLALCSYPDLLEDNKFPEDAKSRAQRILKACGGGSLGAYSTSQGIEMIRQDVARYIERRDGGIACDPDNIYLSTGASDAIVTMLKLMVS-GEGASRTGVMISIPQYPLYSAALAELGAVQINYYLDEDNCWSLDINELRRALQEAKKHCRPRALCIINPGNPTGQVQSRQCIEEVIRFAADENLFLMSDEVYQDNVYADGCKFHSFKKVLFEMGPQYSSKVELASFHSTSKCYMGECGFRGGYMEVVNLDPEVKVQLTKLVSVRLCPPVPGQALLDVVVNPPQPDEPSYDTFIKERSDTLAALAEKASMTQDILNQVPGIKCNPVQGAMYTFPRIHLPPKAILKAKENGQSPDMFYCMKLLEETGICLVPGSGFGQRDGTYHFRMTILPLKDKLKVVLAKIKDFH 480          

HSP 2 Score: 138.272 bits (347), Expect = 2.574e-34
Identity = 66/108 (61.11%), Postives = 80/108 (74.07%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV---VSSQG 592
            +T+D MNP+++RLEYAVRGPIVQRA++++ E+  G   PF EVIK NIGDCHAMGQKPITF RQV AL + P+L  D   P DAK RAQ IL  CGG S+    +SQG
Sbjct:   13 LTVDTMNPNIKRLEYAVRGPIVQRAVQIDKELKMGIKKPFTEVIKANIGDCHAMGQKPITFFRQVLALCSYPDLLEDNKFPEDAKSRAQRILKACGGGSLGAYSTSQG 120          
BLAST of Alanine aminotransferase vs. Ensembl Zebrafish
Match: gpt2 (glutamic pyruvate transaminase (alanine aminotransferase) 2 [Source:ZFIN;Acc:ZDB-GENE-030729-8])

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 272/470 (57.87%), Postives = 341/470 (72.55%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERD-GIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFHL 2002
            +T+D +NP  K +EYAVRGPIV +A E+E  L++G + PF EVIK NIGD HAMGQ+PITF+RQV AL   PE+   P+FP DAK RA+RIL+ CGG S+GSYS S GVE IR+D A +I +RD G+PS  +DI+++ GAS+ I +IL++L + KD   R GVMIPIPQYPLYSA  +E +A Q+ Y+L+ED  W L   EL RA   AK  C PR I IINPGNPTGQV ++  IE V+ FA + NL +M+DEVYQ N+YA +  F S KK L+EMG EY  SV LASF STSKGY GECGFRGGY E+IN D EVKAQL K LS RLC  + GQ  +DV+VN P+  E SY+ F +EK+ VL  L  K KL  E  N++PG KCN VQGAMYAFP+I +PPK +  AK L    D  YCL LLE+TG+CVVPGSGFGQK+GT+HFR+TILP  EK++ ++  +++FH+
Sbjct:   67 LTMDTLNPQVKAVEYAVRGPIVIKAGEIERCLEEGGTKPFSEVIKANIGDAHAMGQQPITFLRQVVALCTFPELMESPSFPEDAKWRARRILQGCGGHSLGSYSASAGVEYIRKDIAAYIEQRDEGVPSNWEDIYLTTGASDGIMTILRLLVSGKD-SSRTGVMIPIPQYPLYSAAISEMDAVQVNYYLDEDNCWALDINELHRAYQAAKQHCQPRVICIINPGNPTGQVQSKKCIEEVLHFAYEENLFVMSDEVYQDNVYAPDCQFHSFKKVLYEMGPEYYNSVELASFHSTSKGYTGECGFRGGYMEVINMDPEVKAQLVKLLSVRLCPPLSGQAAMDVIVNPPQPDEHSYQQFHQEKSSVLGALAEKAKLTEEILNAVPGIKCNPVQGAMYAFPRIFIPPKAMEEAKTLGMQPDMLYCLRLLEETGICVVPGSGFGQKDGTYHFRMTILPSKEKLKVLLGKLRDFHV 535          

HSP 2 Score: 127.872 bits (320), Expect = 1.447e-30
Identity = 60/102 (58.82%), Postives = 74/102 (72.55%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVS 583
            +T+D +NP V+ +EYAVRGPIV +A E+E  + +G T PF EVIK NIGD HAMGQ+PITF+RQV AL   PEL   P+ P DAK RA+ IL  CGG S+ S
Sbjct:   67 LTMDTLNPQVKAVEYAVRGPIVIKAGEIERCLEEGGTKPFSEVIKANIGDAHAMGQQPITFLRQVVALCTFPELMESPSFPEDAKWRARRILQGCGGHSLGS 168          
BLAST of Alanine aminotransferase vs. Ensembl Zebrafish
Match: gpt2l (glutamic pyruvate transaminase (alanine aminotransferase) 2, like [Source:NCBI gene;Acc:403086])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 269/469 (57.36%), Postives = 349/469 (74.41%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T+D MN + K+++YAVRGPIVQRA+++E ELK+G   PF EVIK NIGD HAMGQ+PITF RQV AL   P++ +D  FP DAK RA+RIL+SCGG SIG+Y+ S G++ +RQD AK+I  RDG IPS+  +I+++ GAS+ I +IL++L T  +G  R GVMI IPQYPLYSA+ AE  A QI Y+L E++ W L   EL+R++  A+  C+PR + IINPGNPTGQV +R  IE VI+FA K NL +MADEVYQ N+YA+   F S KK L EMG EY+K V LASF STSK YMGECGFRGGY E+IN D +VKAQL K +S RLC    GQ ++D+VVN P+ GEPS++ F +E+  VLS L  K KL  +  N++PG  CN VQGAMY+FP+I LP + I+ AKA     D FYC+ LLE+TG+C+VPGSGFGQ+EGT+HFR+TILPP +K++ ++  +K+FH
Sbjct:   87 LTVDTMNANVKKVDYAVRGPIVQRAVQIEKELKEGVKKPFDEVIKANIGDAHAMGQRPITFFRQVMALCTYPQLLDDNKFPEDAKNRARRILQSCGGNSIGAYTTSQGIDCVRQDVAKYIERRDGGIPSDPDNIYLTTGASDGIVTILKLL-TAGEGLTRTGVMISIPQYPLYSASIAELGAVQINYYLNEEKCWSLDISELQRSLQAARKHCNPRVLCIINPGNPTGQVQSRQCIEDVIQFAAKENLFLMADEVYQDNVYAKGCEFHSFKKVLFEMGPEYSKKVELASFHSTSKCYMGECGFRGGYMEVINMDADVKAQLTKLVSVRLCPPAPGQALMDLVVNPPQPGEPSHQTFMQERTAVLSALAEKAKLTEQILNTVPGISCNPVQGAMYSFPRITLPERAISEAKAKGQAPDMFYCMKLLEETGICLVPGSGFGQREGTYHFRMTILPPTDKLKLMLNKLKDFH 554          

HSP 2 Score: 131.339 bits (329), Expect = 1.450e-31
Identity = 61/108 (56.48%), Postives = 81/108 (75.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV---VSSQG 592
            +T+D MN +V++++YAVRGPIVQRA+++E E+ +G   PF EVIK NIGD HAMGQ+PITF RQV AL   P+L +D   P DAK RA+ IL +CGG+S+    +SQG
Sbjct:   87 LTVDTMNANVKKVDYAVRGPIVQRAVQIEKELKEGVKKPFDEVIKANIGDAHAMGQRPITFFRQVMALCTYPQLLDDNKFPEDAKNRARRILQSCGGNSIGAYTTSQG 194          
BLAST of Alanine aminotransferase vs. Ensembl Zebrafish
Match: gpt2l (glutamic pyruvate transaminase (alanine aminotransferase) 2, like [Source:NCBI gene;Acc:403086])

HSP 1 Score: 165.236 bits (417), Expect = 9.967e-47
Identity = 73/120 (60.83%), Postives = 95/120 (79.17%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFI 955
            +T+D MN + K+++YAVRGPIVQRA+++E ELK+G   PF EVIK NIGD HAMGQ+PITF RQV AL   P++ +D  FP DAK RA+RIL+SCGG SIG+Y+ S G++ +RQD AK+I
Sbjct:   74 LTVDTMNANVKKVDYAVRGPIVQRAVQIEKELKEGVKKPFDEVIKANIGDAHAMGQRPITFFRQVMALCTYPQLLDDNKFPEDAKNRARRILQSCGGNSIGAYTTSQGIDCVRQDVAKYI 193          

HSP 2 Score: 131.339 bits (329), Expect = 1.305e-34
Identity = 61/108 (56.48%), Postives = 81/108 (75.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV---VSSQG 592
            +T+D MN +V++++YAVRGPIVQRA+++E E+ +G   PF EVIK NIGD HAMGQ+PITF RQV AL   P+L +D   P DAK RA+ IL +CGG+S+    +SQG
Sbjct:   74 LTVDTMNANVKKVDYAVRGPIVQRAVQIEKELKEGVKKPFDEVIKANIGDAHAMGQRPITFFRQVMALCTYPQLLDDNKFPEDAKNRARRILQSCGGNSIGAYTTSQG 181          
BLAST of Alanine aminotransferase vs. Ensembl Xenopus
Match: gpt (glutamic-pyruvate transaminase (alanine aminotransferase) [Source:NCBI gene;Acc:549559])

HSP 1 Score: 576.244 bits (1484), Expect = 0.000e+0
Identity = 284/511 (55.58%), Postives = 364/511 (71.23%), Query Frame = 2
Query:  473 AALLAMPELQNDPNIPRDAK-ERAQSILGNCGGSSVVSSQGPITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            A L  +  L   P   RD K  R  S  G C           +T+++MNP  +++EYAVRGPIV RA+ELE EL++G   PF EVIK NIGD HAMGQKPITF+RQV+A+   PE+ ND  FP D KQ+A RIL++CGG SIG+YS S G+E+IRQD AK+I  RDG I S+  +I++S GAS++I ++L++L + + GK R GV+IPIPQYPLYSA  AE NA Q+ Y+L+E+  W L   EL R++ EA+  C P+ + IINPGNPTGQV +R  IE VIRFA + NL +MADEVYQ N+YA+  TF S KK L EMG +Y+++V LASF STSKGYMGECGFRGGY E+IN D  VK QL K +S RLC  V GQ +LDV+VN PK GEPSY+ F  EK  VL +L  K +L  E  N  PG +CN VQGAMY+FP+I +P K I  A+A     D F+C+ LLE+TG+CVVPGSGFGQ+EGT HFR+TILPP +K++++++ +K+FH
Sbjct:   10 ALLCLLRSLSGTPLAERDGKVARKMSENGTCNRI--------LTLESMNPCIQKVEYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPITFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQGIEVIRQDVAKYIERRDGGIQSDPNNIYLSTGASDSIVTMLKLLVSGQ-GKSRTGVLIPIPQYPLYSAALAELNAVQVNYYLDEENCWALDINELRRSLTEARKHCDPKVLCIINPGNPTGQVQSRKCIEDVIRFAAEENLFLMADEVYQDNVYAKGCTFHSFKKVLFEMGPKYSETVELASFHSTSKGYMGECGFRGGYMEVINMDPAVKQQLTKLVSVRLCPPVPGQALLDVIVNPPKPGEPSYKQFMAEKQAVLGNLAEKARLTEEILNQSPGIRCNPVQGAMYSFPRIHIPEKAIKLAQAEGQAPDMFFCMKLLEETGICVVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFH 511          

HSP 2 Score: 130.183 bits (326), Expect = 2.850e-31
Identity = 63/108 (58.33%), Postives = 80/108 (74.07%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV---VSSQG 592
            +T+++MNP ++++EYAVRGPIV RA+ELE E+ QG   PF EVIK NIGD HAMGQKPITF+RQV+A+   PEL ND   P D K++A  IL  CGG S+    +SQG
Sbjct:   44 LTLESMNPCIQKVEYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPITFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQG 151          
BLAST of Alanine aminotransferase vs. Ensembl Xenopus
Match: gpt (glutamic-pyruvate transaminase (alanine aminotransferase) [Source:NCBI gene;Acc:549559])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 273/469 (58.21%), Postives = 352/469 (75.05%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T+++MNP  +++EYAVRGPIV RA+ELE EL++G   PF EVIK NIGD HAMGQKPITF+RQV+A+   PE+ ND  FP D KQ+A RIL++CGG SIG+YS S G+E+IRQD AK+I  RDG I S+  +I++S GAS++I ++L++L + + GK R GV+IPIPQYPLYSA  AE NA Q+ Y+L+E+  W L   EL R++ EA+  C P+ + IINPGNPTGQV +R  IE VIRFA + NL +MADEVYQ N+YA+  TF S KK L EMG +Y+++V LASF STSKGYMGECGFRGGY E+IN D  VK QL K +S RLC  V GQ +LDV+VN PK GEPSY+ F  EK  VL +L  K +L  E  N  PG +CN VQGAMY+FP+I +P K I  A+A     D F+C+ LLE+TG+CVVPGSGFGQ+EGT HFR+TILPP +K++++++ +K+FH
Sbjct:   39 LTLESMNPCIQKVEYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPITFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQGIEVIRQDVAKYIERRDGGIQSDPNNIYLSTGASDSIVTMLKLLVSGQ-GKSRTGVLIPIPQYPLYSAALAELNAVQVNYYLDEENCWALDINELRRSLTEARKHCDPKVLCIINPGNPTGQVQSRKCIEDVIRFAAEENLFLMADEVYQDNVYAKGCTFHSFKKVLFEMGPKYSETVELASFHSTSKGYMGECGFRGGYMEVINMDPAVKQQLTKLVSVRLCPPVPGQALLDVIVNPPKPGEPSYKQFMAEKQAVLGNLAEKARLTEEILNQSPGIRCNPVQGAMYSFPRIHIPEKAIKLAQAEGQAPDMFFCMKLLEETGICVVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFH 506          

HSP 2 Score: 130.183 bits (326), Expect = 2.579e-31
Identity = 63/108 (58.33%), Postives = 80/108 (74.07%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV---VSSQG 592
            +T+++MNP ++++EYAVRGPIV RA+ELE E+ QG   PF EVIK NIGD HAMGQKPITF+RQV+A+   PEL ND   P D K++A  IL  CGG S+    +SQG
Sbjct:   39 LTLESMNPCIQKVEYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPITFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQG 146          
BLAST of Alanine aminotransferase vs. Ensembl Xenopus
Match: gpt (glutamic-pyruvate transaminase (alanine aminotransferase) [Source:NCBI gene;Acc:549559])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 273/469 (58.21%), Postives = 352/469 (75.05%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T+++MNP  +++EYAVRGPIV RA+ELE EL++G   PF EVIK NIGD HAMGQKPITF+RQV+A+   PE+ ND  FP D KQ+A RIL++CGG SIG+YS S G+E+IRQD AK+I  RDG I S+  +I++S GAS++I ++L++L + + GK R GV+IPIPQYPLYSA  AE NA Q+ Y+L+E+  W L   EL R++ EA+  C P+ + IINPGNPTGQV +R  IE VIRFA + NL +MADEVYQ N+YA+  TF S KK L EMG +Y+++V LASF STSKGYMGECGFRGGY E+IN D  VK QL K +S RLC  V GQ +LDV+VN PK GEPSY+ F  EK  VL +L  K +L  E  N  PG +CN VQGAMY+FP+I +P K I  A+A     D F+C+ LLE+TG+CVVPGSGFGQ+EGT HFR+TILPP +K++++++ +K+FH
Sbjct:   23 LTLESMNPCIQKVEYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPITFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQGIEVIRQDVAKYIERRDGGIQSDPNNIYLSTGASDSIVTMLKLLVSGQ-GKSRTGVLIPIPQYPLYSAALAELNAVQVNYYLDEENCWALDINELRRSLTEARKHCDPKVLCIINPGNPTGQVQSRKCIEDVIRFAAEENLFLMADEVYQDNVYAKGCTFHSFKKVLFEMGPKYSETVELASFHSTSKGYMGECGFRGGYMEVINMDPAVKQQLTKLVSVRLCPPVPGQALLDVIVNPPKPGEPSYKQFMAEKQAVLGNLAEKARLTEEILNQSPGIRCNPVQGAMYSFPRIHIPEKAIKLAQAEGQAPDMFFCMKLLEETGICVVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFH 490          

HSP 2 Score: 130.183 bits (326), Expect = 2.092e-31
Identity = 63/108 (58.33%), Postives = 80/108 (74.07%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV---VSSQG 592
            +T+++MNP ++++EYAVRGPIV RA+ELE E+ QG   PF EVIK NIGD HAMGQKPITF+RQV+A+   PEL ND   P D K++A  IL  CGG S+    +SQG
Sbjct:   23 LTLESMNPCIQKVEYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPITFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQG 130          
BLAST of Alanine aminotransferase vs. Ensembl Xenopus
Match: gpt (glutamic-pyruvate transaminase (alanine aminotransferase) [Source:NCBI gene;Acc:549559])

HSP 1 Score: 575.474 bits (1482), Expect = 0.000e+0
Identity = 272/469 (58.00%), Postives = 352/469 (75.05%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T+++MNP  +++EYAVRGPIV RA+ELE EL++G   PF EVIK NIGD HAMGQKPITF+RQV+A+   PE+ ND  FP D KQ+A RIL++CGG SIG+YS S G+E+IRQD AK+I  RDG I S+  +I++S GAS++I ++L++L + + GK R GV+IPIPQYPLYSA  AE NA Q+ Y+L+E+  W L   EL R++ EA+  C P+ + IINPGNPTGQV +R  IE VIRFA + NL +MADEVYQ N+YA+  TF S KK L EMG +Y+++V LASF STSKGYMGECGFRGGY E+IN D  VK QL K +S RLC  V GQ +LDV+VN PK GEPSY+ F  EK  VL +L  K +L  E  N  PG +CN VQGAMY+FP+I +P K I  A+ +    D F+C+ LLE+TG+CVVPGSGFGQ+EGT HFR+TILPP +K++++++ +K+FH
Sbjct:   34 LTLESMNPCIQKVEYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPITFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQGIEVIRQDVAKYIERRDGGIQSDPNNIYLSTGASDSIVTMLKLLVSGQ-GKSRTGVLIPIPQYPLYSAALAELNAVQVNYYLDEENCWALDINELRRSLTEARKHCDPKVLCIINPGNPTGQVQSRKCIEDVIRFAAEENLFLMADEVYQDNVYAKGCTFHSFKKVLFEMGPKYSETVELASFHSTSKGYMGECGFRGGYMEVINMDPAVKQQLTKLVSVRLCPPVPGQALLDVIVNPPKPGEPSYKQFMAEKQAVLGNLAEKARLTEEILNQSPGIRCNPVQGAMYSFPRIHIPEKAIKLAQVIGQAPDMFFCMKLLEETGICVVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFH 501          

HSP 2 Score: 130.183 bits (326), Expect = 2.531e-31
Identity = 63/108 (58.33%), Postives = 80/108 (74.07%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV---VSSQG 592
            +T+++MNP ++++EYAVRGPIV RA+ELE E+ QG   PF EVIK NIGD HAMGQKPITF+RQV+A+   PEL ND   P D K++A  IL  CGG S+    +SQG
Sbjct:   34 LTLESMNPCIQKVEYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPITFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQG 141          
BLAST of Alanine aminotransferase vs. Ensembl Xenopus
Match: gpt (glutamic-pyruvate transaminase (alanine aminotransferase) [Source:NCBI gene;Acc:549559])

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 273/469 (58.21%), Postives = 352/469 (75.05%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T+++MNP  +++EYAVRGPIV RA+ELE EL++G   PF EVIK NIGD HAMGQKPITF+RQV+A+   PE+ ND  FP D KQ+A RIL++CGG SIG+YS S G+E+IRQD AK+I  RDG I S+  +I++S GAS++I ++L++L + + GK R GV+IPIPQYPLYSA  AE NA Q+ Y+L+E+  W L   EL R++ EA+  C P+ + IINPGNPTGQV +R  IE VIRFA + NL +MADEVYQ N+YA+  TF S KK L EMG +Y+++V LASF STSKGYMGECGFRGGY E+IN D  VK QL K +S RLC  V GQ +LDV+VN PK GEPSY+ F  EK  VL +L  K +L  E  N  PG +CN VQGAMY+FP+I +P K I  A+A     D F+C+ LLE+TG+CVVPGSGFGQ+EGT HFR+TILPP +K++++++ +K+FH
Sbjct:   29 LTLESMNPCIQKVEYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPITFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQGIEVIRQDVAKYIERRDGGIQSDPNNIYLSTGASDSIVTMLKLLVSGQ-GKSRTGVLIPIPQYPLYSAALAELNAVQVNYYLDEENCWALDINELRRSLTEARKHCDPKVLCIINPGNPTGQVQSRKCIEDVIRFAAEENLFLMADEVYQDNVYAKGCTFHSFKKVLFEMGPKYSETVELASFHSTSKGYMGECGFRGGYMEVINMDPAVKQQLTKLVSVRLCPPVPGQALLDVIVNPPKPGEPSYKQFMAEKQAVLGNLAEKARLTEEILNQSPGIRCNPVQGAMYSFPRIHIPEKAIKLAQAEGQAPDMFFCMKLLEETGICVVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFH 496          

HSP 2 Score: 130.183 bits (326), Expect = 2.284e-31
Identity = 63/108 (58.33%), Postives = 80/108 (74.07%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV---VSSQG 592
            +T+++MNP ++++EYAVRGPIV RA+ELE E+ QG   PF EVIK NIGD HAMGQKPITF+RQV+A+   PEL ND   P D K++A  IL  CGG S+    +SQG
Sbjct:   29 LTLESMNPCIQKVEYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPITFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQG 136          
BLAST of Alanine aminotransferase vs. Ensembl Mouse
Match: Gpt2 (glutamic pyruvate transaminase (alanine aminotransferase) 2 [Source:MGI Symbol;Acc:MGI:1915391])

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 266/469 (56.72%), Postives = 351/469 (74.84%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFHL 2002
            +T+++MNP  K +EYAVRGPIV +A E+E EL++G   PF EVI+ NIGD HAMGQ+PITF+RQV AL   P + N P+FP DAK+RA+RIL++CGG S+GSYS S GV  IR+D A FI+ RDG+P++  +I+++ GAS+ I +IL++L +   GK R GVMIPIPQYPLYSA  +E +A Q+ Y+L+E+  W L+  EL RA+ +AKD C P+ + IINPGNPTGQV +R  IE VI FA +  L ++ADEVYQ N+Y+ +  F S KK L++MG EY+ +V LASF STSKGYMGECG+RGGY E+IN   E+K QL K LS RLC  V GQ  +D+VVN P+ GE S+E F +EK  VL +L  K KL  + FN +PG +CN +QGAMYAFP+I +P K + AA++     D FYC+ LLE+TG+CVVPGSGFGQ+EGT+HFR+TILPPV+K++TV+  +K+FHL
Sbjct:   48 LTLESMNPQVKAVEYAVRGPIVLKAGEIEMELQRGIKKPFTEVIRANIGDAHAMGQQPITFLRQVMALCTYPNLLNSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAFITRRDGVPADPDNIYLTTGASDGISTILKLLVS-GGGKSRTGVMIPIPQYPLYSAVISELDAVQVNYYLDEENCWALNVDELRRALRQAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYQMGHEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPEPGEESFEQFSREKEFVLGNLAKKAKLTEDLFNQVPGIQCNPLQGAMYAFPRILIPAKAVEAAQSHKMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVDKLKTVLHKVKDFHL 515          

HSP 2 Score: 126.331 bits (316), Expect = 4.941e-30
Identity = 62/108 (57.41%), Postives = 80/108 (74.07%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVS---SQG 592
            +T+++MNP V+ +EYAVRGPIV +A E+E E+ +G   PF EVI+ NIGD HAMGQ+PITF+RQV AL   P L N P+ P DAK+RA+ IL  CGG+S+ S   SQG
Sbjct:   48 LTLESMNPQVKAVEYAVRGPIVLKAGEIEMELQRGIKKPFTEVIRANIGDAHAMGQQPITFLRQVMALCTYPNLLNSPSFPEDAKKRARRILQACGGNSLGSYSASQG 155          
BLAST of Alanine aminotransferase vs. Ensembl Mouse
Match: Gpt (glutamic pyruvic transaminase, soluble [Source:MGI Symbol;Acc:MGI:95802])

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 263/469 (56.08%), Postives = 351/469 (74.84%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T+D MNP  +R+EYAVRGPIVQRALELE EL++G   PF EVI+ NIGD  AMGQ+PITF RQV AL   P + + P+FP DAK+RA+RIL++CGG S+G+YS S+G++ IR+D A++I  RDG IP++  +IF+S GAS+AI ++L++L    +G+ R GV+IPIPQYPLYSA  AE +A Q+ Y+L+E++ W L   EL RA+ +A+D+C PR + +INPGNPTGQV TR+ IE VIRFA +  L +MADEVYQ N+YAE   F S KK L EMG  Y     LASF S SKGYMGECGFRGGY E++N D EV+ Q+ K +S RLC  V GQ ++ +VV+ P   EPS++ F+ E+ +VL++L AK KL  + FN  PG +CN VQGAMY+FP+I+LP K +  A+ L    D F+CL LLE+TG+CVVPGSGFGQ+EGT+HFR+TILPP+EK++ +++ ++ FH
Sbjct:   21 LTLDTMNPCVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDAKRRAERILQACGGHSLGAYSISSGIQPIREDVAQYIERRDGGIPADPNNIFLSTGASDAIVTMLKLL-VAGEGRARTGVLIPIPQYPLYSAALAELDAVQVDYYLDEERAWALDIAELRRALCQARDRCCPRVLCVINPGNPTGQVQTRECIEAVIRFAFEEGLFLMADEVYQDNVYAEGSQFHSFKKVLTEMGPPYATQQELASFHSVSKGYMGECGFRGGYVEVVNMDAEVQKQMAKLMSVRLCPPVPGQALMGMVVSPPTPSEPSFKQFQAERQEVLAELAAKAKLTEQVFNEAPGIRCNPVQGAMYSFPQIQLPLKAVQRAQDLGLAPDMFFCLCLLEETGICVVPGSGFGQQEGTYHFRMTILPPMEKLRVLLEKLRHFH 488          

HSP 2 Score: 134.806 bits (338), Expect = 4.920e-33
Identity = 63/100 (63.00%), Postives = 74/100 (74.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV 577
            +T+D MNP VRR+EYAVRGPIVQRA+ELE E+ QG   PF EVI+ NIGD  AMGQ+PITF RQV AL   P L + P+ P DAK RA+ IL  CGG S+
Sbjct:   21 LTLDTMNPCVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDAKRRAERILQACGGHSL 120          
BLAST of Alanine aminotransferase vs. Ensembl Mouse
Match: Gpt (glutamic pyruvic transaminase, soluble [Source:MGI Symbol;Acc:MGI:95802])

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 263/469 (56.08%), Postives = 351/469 (74.84%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T+D MNP  +R+EYAVRGPIVQRALELE EL++G   PF EVI+ NIGD  AMGQ+PITF RQV AL   P + + P+FP DAK+RA+RIL++CGG S+G+YS S+G++ IR+D A++I  RDG IP++  +IF+S GAS+AI ++L++L    +G+ R GV+IPIPQYPLYSA  AE +A Q+ Y+L+E++ W L   EL RA+ +A+D+C PR + +INPGNPTGQV TR+ IE VIRFA +  L +MADEVYQ N+YAE   F S KK L EMG  Y     LASF S SKGYMGECGFRGGY E++N D EV+ Q+ K +S RLC  V GQ ++ +VV+ P   EPS++ F+ E+ +VL++L AK KL  + FN  PG +CN VQGAMY+FP+I+LP K +  A+ L    D F+CL LLE+TG+CVVPGSGFGQ+EGT+HFR+TILPP+EK++ +++ ++ FH
Sbjct:   21 LTLDTMNPCVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDAKRRAERILQACGGHSLGAYSISSGIQPIREDVAQYIERRDGGIPADPNNIFLSTGASDAIVTMLKLL-VAGEGRARTGVLIPIPQYPLYSAALAELDAVQVDYYLDEERAWALDIAELRRALCQARDRCCPRVLCVINPGNPTGQVQTRECIEAVIRFAFEEGLFLMADEVYQDNVYAEGSQFHSFKKVLTEMGPPYATQQELASFHSVSKGYMGECGFRGGYVEVVNMDAEVQKQMAKLMSVRLCPPVPGQALMGMVVSPPTPSEPSFKQFQAERQEVLAELAAKAKLTEQVFNEAPGIRCNPVQGAMYSFPQIQLPLKAVQRAQDLGLAPDMFFCLCLLEETGICVVPGSGFGQQEGTYHFRMTILPPMEKLRVLLEKLRHFH 488          

HSP 2 Score: 134.806 bits (338), Expect = 4.920e-33
Identity = 63/100 (63.00%), Postives = 74/100 (74.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV 577
            +T+D MNP VRR+EYAVRGPIVQRA+ELE E+ QG   PF EVI+ NIGD  AMGQ+PITF RQV AL   P L + P+ P DAK RA+ IL  CGG S+
Sbjct:   21 LTLDTMNPCVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDAKRRAERILQACGGHSL 120          
BLAST of Alanine aminotransferase vs. Ensembl Mouse
Match: Gpt (glutamic pyruvic transaminase, soluble [Source:MGI Symbol;Acc:MGI:95802])

HSP 1 Score: 379.022 bits (972), Expect = 2.376e-125
Identity = 190/360 (52.78%), Postives = 248/360 (68.89%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERD-GIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEK 1672
            +T+D MNP  +R+EYAVRGPIVQRALELE EL++G   PF EVI+ NIGD  AMGQ+PITF RQV AL   P + + P+FP DAK+RA+RIL++CGG S+G+YS S+G++ IR+D A++I  RD GIP++  +IF+S GAS+AI ++L++L    +G+ R GV+IPIPQYPLYSA  AE +A Q+ Y+L+E++ W L   EL RA+      C               QV TR+ IE VIRFA +  L +MADEVYQ N+YAE   F S KK L EMG  Y     LASF S SKGYMGECGFRGGY E++N D EV+ Q+ K +S RLC  V GQ ++ +VV+ P   EPS++ F+  K
Sbjct:   21 LTLDTMNPCVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDAKRRAERILQACGGHSLGAYSISSGIQPIREDVAQYIERRDGGIPADPNNIFLSTGASDAIVTMLKLL-VAGEGRARTGVLIPIPQYPLYSAALAELDAVQVDYYLDEERAWALDIAELRRAL------C---------------QVQTRECIEAVIRFAFEEGLFLMADEVYQDNVYAEGSQFHSFKKVLTEMGPPYATQQELASFHSVSKGYMGECGFRGGYVEVVNMDAEVQKQMAKLMSVRLCPPVPGQALMGMVVSPPTPSEPSFKQFQAVK 358          

HSP 2 Score: 135.576 bits (340), Expect = 3.151e-34
Identity = 63/100 (63.00%), Postives = 74/100 (74.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV 577
            +T+D MNP VRR+EYAVRGPIVQRA+ELE E+ QG   PF EVI+ NIGD  AMGQ+PITF RQV AL   P L + P+ P DAK RA+ IL  CGG S+
Sbjct:   21 LTLDTMNPCVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDAKRRAERILQACGGHSL 120          
BLAST of Alanine aminotransferase vs. Ensembl Mouse
Match: Gpt (glutamic pyruvic transaminase, soluble [Source:MGI Symbol;Acc:MGI:95802])

HSP 1 Score: 293.123 bits (749), Expect = 9.344e-94
Identity = 135/242 (55.79%), Postives = 176/242 (72.73%), Query Frame = 2
Query: 1274 GQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            GQV TR+ IE VIRFA +  L +MADEVYQ N+YAE   F S KK L EMG  Y     LASF S SKGYMGECGFRGGY E++N D EV+ Q+ K +S RLC  V GQ ++ +VV+ P   EPS++ F+ E+ +VL++L AK KL  + FN  PG +CN VQGAMY+FP+I+LP K +  A+ L    D F+CL LLE+TG+CVVPGSGFGQ+EGT+HFR+TILPP+EK++ +++ ++ FH
Sbjct:    7 GQVQTRECIEAVIRFAFEEGLFLMADEVYQDNVYAEGSQFHSFKKVLTEMGPPYATQQELASFHSVSKGYMGECGFRGGYVEVVNMDAEVQKQMAKLMSVRLCPPVPGQALMGMVVSPPTPSEPSFKQFQAERQEVLAELAAKAKLTEQVFNEAPGIRCNPVQGAMYSFPQIQLPLKAVQRAQDLGLAPDMFFCLCLLEETGICVVPGSGFGQQEGTYHFRMTILPPMEKLRVLLEKLRHFH 248          
BLAST of Alanine aminotransferase vs. UniProt/SwissProt
Match: sp|A4IFH5|ALAT1_BOVIN (Alanine aminotransferase 1 OS=Bos taurus OX=9913 GN=GPT PE=2 SV=1)

HSP 1 Score: 581.252 bits (1497), Expect = 0.000e+0
Identity = 266/469 (56.72%), Postives = 352/469 (75.05%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T+D+MNP+ +R+EYAVRGPIVQRALELE EL++G   PF EVI+ NIGD  AMGQ PITF RQV AL   P++ N P+FP DAK+RA+RIL++CGG S+G+YS S GV++IR+D A++I  RDG IP++  +IF+S GAS+AI ++L++L T  +G+ R GV+IPIPQYPLYSA  AE+NA Q+ Y+L+E++ W L   EL RA+ +A+D C PRA+ +INPGNPTGQV TR+ IE VIRFA +  L ++ADEVYQ N+YAE+  F S KK L EMG  Y     LASF S SKGYMGECGFRGGY E++N D  VK Q+ K  S RLC    GQ +LDV V+ P   +PS+  F+ E+  VL++L AK KL  + FN  PG +CN VQGAMY+FP+++LPP+ +  A+ L    D F+CL LLE+TG+CVVPGSGFGQ+EGT+HFR+TILPP+EK++ +++ + +FH
Sbjct:   21 LTLDSMNPYVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQIPITFPRQVLALCVHPDLLNSPDFPDDAKRRAERILQACGGHSLGAYSISAGVQMIREDVARYIERRDGGIPADPNNIFLSTGASDAIVTVLKLLVT-GEGRTRTGVLIPIPQYPLYSAALAEFNAVQVDYYLDEERAWALDVAELRRALRQARDHCRPRALCVINPGNPTGQVQTRECIEDVIRFAYEEKLFLLADEVYQDNVYAESSQFHSFKKVLTEMGPPYAAQQELASFHSISKGYMGECGFRGGYVEVVNMDAAVKQQMQKLRSVRLCPPTPGQVLLDVAVSPPAPSDPSFPRFQAERRAVLAELAAKAKLTEQVFNEAPGIRCNPVQGAMYSFPRVQLPPRAVQRAQELGLAPDMFFCLRLLEETGICVVPGSGFGQREGTYHFRMTILPPMEKLRPLLEKLSQFH 488          

HSP 2 Score: 136.346 bits (342), Expect = 9.266e-33
Identity = 64/100 (64.00%), Postives = 76/100 (76.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV 577
            +T+D+MNP+VRR+EYAVRGPIVQRA+ELE E+ QG   PF EVI+ NIGD  AMGQ PITF RQV AL   P+L N P+ P DAK RA+ IL  CGG S+
Sbjct:   21 LTLDSMNPYVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQIPITFPRQVLALCVHPDLLNSPDFPDDAKRRAERILQACGGHSL 120          
BLAST of Alanine aminotransferase vs. UniProt/SwissProt
Match: sp|Q28DB5|ALAT2_XENTR (Alanine aminotransferase 2 OS=Xenopus tropicalis OX=8364 GN=gpt2 PE=2 SV=1)

HSP 1 Score: 574.704 bits (1480), Expect = 0.000e+0
Identity = 273/469 (58.21%), Postives = 352/469 (75.05%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T+++MNP  +++EYAVRGPIV RA+ELE EL++G   PF EVIK NIGD HAMGQKPITF+RQV+A+   PE+ ND  FP D KQ+A RIL++CGG SIG+YS S G+E+IRQD AK+I  RDG I S+  +I++S GAS++I ++L++L + + GK R GV+IPIPQYPLYSA  AE NA Q+ Y+L+E+  W L   EL R++ EA+  C P+ + IINPGNPTGQV +R  IE VIRFA + NL +MADEVYQ N+YA+  TF S KK L EMG +Y+++V LASF STSKGYMGECGFRGGY E+IN D  VK QL K +S RLC  V GQ +LDV+VN PK GEPSY+ F  EK  VL +L  K +L  E  N  PG +CN VQGAMY+FP+I +P K I  A+A     D F+C+ LLE+TG+CVVPGSGFGQ+EGT HFR+TILPP +K++++++ +K+FH
Sbjct:   49 LTLESMNPCIQKVEYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPITFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQGIEVIRQDVAKYIERRDGGIQSDPNNIYLSTGASDSIVTMLKLLVSGQ-GKSRTGVLIPIPQYPLYSAALAELNAVQVNYYLDEENCWALDINELRRSLTEARKHCDPKVLCIINPGNPTGQVQSRKCIEDVIRFAAEENLFLMADEVYQDNVYAKGCTFHSFKKVLFEMGPKYSETVELASFHSTSKGYMGECGFRGGYMEVINMDPAVKQQLTKLVSVRLCPPVPGQALLDVIVNPPKPGEPSYKQFMAEKQAVLGNLAEKARLTEEILNQSPGIRCNPVQGAMYSFPRIHIPEKAIKLAQAEGQAPDMFFCMKLLEETGICVVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFH 516          

HSP 2 Score: 130.183 bits (326), Expect = 1.507e-30
Identity = 63/108 (58.33%), Postives = 80/108 (74.07%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV---VSSQG 592
            +T+++MNP ++++EYAVRGPIV RA+ELE E+ QG   PF EVIK NIGD HAMGQKPITF+RQV+A+   PEL ND   P D K++A  IL  CGG S+    +SQG
Sbjct:   49 LTLESMNPCIQKVEYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPITFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQG 156          
BLAST of Alanine aminotransferase vs. UniProt/SwissProt
Match: sp|Q6GM82|ALAT2_XENLA (Alanine aminotransferase 2 OS=Xenopus laevis OX=8355 GN=gpt2 PE=2 SV=1)

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 272/469 (58.00%), Postives = 352/469 (75.05%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T+D+MNP  +++EYAVRGPIV RA+ELE EL++G   PF EVIK NIGD HAMGQKP+TF+RQV+A+   PE+ ND  FP D KQ+A RIL++CGG SIG+YS S G+E+IRQD AK+I  RDG I S+  +I++S GAS++I ++L++L + + GK R GVMIPIPQYPLYSA  AE +A Q+ Y+L+E+  W L   EL RA+ EA+  C P+ + IINPGNPTGQV +R  IE VIRFA + NL +MADEVYQ N+YA+   F S KK L EMG +Y++++ LASF STSKGYMGECGFRGGY E+IN D  VK QL K +S RLC  V GQ +LDV+VN PK GEPSY+ F  EK  VL++L  K +L  E  N  PG +CN VQGAMY+FP+I +P K I  A+A     D F+C+ LLE+TG+CVVPGSGFGQ+EGT HFR+TILPP +K++++++ +K+FH
Sbjct:   65 LTLDSMNPCIQKVEYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPVTFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQGIEVIRQDVAKYIERRDGGILSDPNNIYLSTGASDSIVTMLKLLVSGQ-GKSRTGVMIPIPQYPLYSAALAELDAVQVNYYLDEENCWALDINELRRALAEARKHCDPKVLCIINPGNPTGQVQSRKCIEDVIRFAAEENLFLMADEVYQDNVYAKGCAFHSFKKVLFEMGPKYSETLELASFHSTSKGYMGECGFRGGYMEVINMDPAVKQQLTKLVSVRLCPPVPGQVLLDVIVNPPKPGEPSYKQFISEKQAVLNNLAEKARLTEEILNQAPGIRCNPVQGAMYSFPRIHIPEKAIKLAQAEGQAPDMFFCMKLLEETGICVVPGSGFGQREGTHHFRMTILPPTDKLKSLLERLKDFH 532          

HSP 2 Score: 131.339 bits (329), Expect = 7.551e-31
Identity = 63/108 (58.33%), Postives = 80/108 (74.07%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV---VSSQG 592
            +T+D+MNP ++++EYAVRGPIV RA+ELE E+ QG   PF EVIK NIGD HAMGQKP+TF+RQV+A+   PEL ND   P D K++A  IL  CGG S+    +SQG
Sbjct:   65 LTLDSMNPCIQKVEYAVRGPIVIRAVELEKELQQGVKKPFTEVIKANIGDAHAMGQKPVTFLRQVSAICLYPELMNDNKFPEDVKQKAARILQACGGHSIGAYSASQG 172          
BLAST of Alanine aminotransferase vs. UniProt/SwissProt
Match: sp|Q8BGT5|ALAT2_MOUSE (Alanine aminotransferase 2 OS=Mus musculus OX=10090 GN=Gpt2 PE=1 SV=1)

HSP 1 Score: 572.392 bits (1474), Expect = 0.000e+0
Identity = 266/469 (56.72%), Postives = 351/469 (74.84%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFHL 2002
            +T+++MNP  K +EYAVRGPIV +A E+E EL++G   PF EVI+ NIGD HAMGQ+PITF+RQV AL   P + N P+FP DAK+RA+RIL++CGG S+GSYS S GV  IR+D A FI+ RDG+P++  +I+++ GAS+ I +IL++L +   GK R GVMIPIPQYPLYSA  +E +A Q+ Y+L+E+  W L+  EL RA+ +AKD C P+ + IINPGNPTGQV +R  IE VI FA +  L ++ADEVYQ N+Y+ +  F S KK L++MG EY+ +V LASF STSKGYMGECG+RGGY E+IN   E+K QL K LS RLC  V GQ  +D+VVN P+ GE S+E F +EK  VL +L  K KL  + FN +PG +CN +QGAMYAFP+I +P K + AA++     D FYC+ LLE+TG+CVVPGSGFGQ+EGT+HFR+TILPPV+K++TV+  +K+FHL
Sbjct:   48 LTLESMNPQVKAVEYAVRGPIVLKAGEIEMELQRGIKKPFTEVIRANIGDAHAMGQQPITFLRQVMALCTYPNLLNSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAFITRRDGVPADPDNIYLTTGASDGISTILKLLVS-GGGKSRTGVMIPIPQYPLYSAVISELDAVQVNYYLDEENCWALNVDELRRALRQAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFHSFKKVLYQMGHEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPEPGEESFEQFSREKEFVLGNLAKKAKLTEDLFNQVPGIQCNPLQGAMYAFPRILIPAKAVEAAQSHKMAPDMFYCMKLLEETGICVVPGSGFGQREGTYHFRMTILPPVDKLKTVLHKVKDFHL 515          

HSP 2 Score: 126.331 bits (316), Expect = 3.456e-29
Identity = 62/108 (57.41%), Postives = 80/108 (74.07%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVS---SQG 592
            +T+++MNP V+ +EYAVRGPIV +A E+E E+ +G   PF EVI+ NIGD HAMGQ+PITF+RQV AL   P L N P+ P DAK+RA+ IL  CGG+S+ S   SQG
Sbjct:   48 LTLESMNPQVKAVEYAVRGPIVLKAGEIEMELQRGIKKPFTEVIRANIGDAHAMGQQPITFLRQVMALCTYPNLLNSPSFPEDAKKRARRILQACGGNSLGSYSASQG 155          
BLAST of Alanine aminotransferase vs. UniProt/SwissProt
Match: sp|Q8QZR5|ALAT1_MOUSE (Alanine aminotransferase 1 OS=Mus musculus OX=10090 GN=Gpt PE=1 SV=3)

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 263/469 (56.08%), Postives = 351/469 (74.84%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T+D MNP  +R+EYAVRGPIVQRALELE EL++G   PF EVI+ NIGD  AMGQ+PITF RQV AL   P + + P+FP DAK+RA+RIL++CGG S+G+YS S+G++ IR+D A++I  RDG IP++  +IF+S GAS+AI ++L++L    +G+ R GV+IPIPQYPLYSA  AE +A Q+ Y+L+E++ W L   EL RA+ +A+D+C PR + +INPGNPTGQV TR+ IE VIRFA +  L +MADEVYQ N+YAE   F S KK L EMG  Y     LASF S SKGYMGECGFRGGY E++N D EV+ Q+ K +S RLC  V GQ ++ +VV+ P   EPS++ F+ E+ +VL++L AK KL  + FN  PG +CN VQGAMY+FP+I+LP K +  A+ L    D F+CL LLE+TG+CVVPGSGFGQ+EGT+HFR+TILPP+EK++ +++ ++ FH
Sbjct:   21 LTLDTMNPCVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDAKRRAERILQACGGHSLGAYSISSGIQPIREDVAQYIERRDGGIPADPNNIFLSTGASDAIVTMLKLL-VAGEGRARTGVLIPIPQYPLYSAALAELDAVQVDYYLDEERAWALDIAELRRALCQARDRCCPRVLCVINPGNPTGQVQTRECIEAVIRFAFEEGLFLMADEVYQDNVYAEGSQFHSFKKVLTEMGPPYATQQELASFHSVSKGYMGECGFRGGYVEVVNMDAEVQKQMAKLMSVRLCPPVPGQALMGMVVSPPTPSEPSFKQFQAERQEVLAELAAKAKLTEQVFNEAPGIRCNPVQGAMYSFPQIQLPLKAVQRAQDLGLAPDMFFCLCLLEETGICVVPGSGFGQQEGTYHFRMTILPPMEKLRVLLEKLRHFH 488          

HSP 2 Score: 134.806 bits (338), Expect = 3.442e-32
Identity = 63/100 (63.00%), Postives = 74/100 (74.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV 577
            +T+D MNP VRR+EYAVRGPIVQRA+ELE E+ QG   PF EVI+ NIGD  AMGQ+PITF RQV AL   P L + P+ P DAK RA+ IL  CGG S+
Sbjct:   21 LTLDTMNPCVRRVEYAVRGPIVQRALELEQELRQGVKKPFTEVIRANIGDAQAMGQRPITFFRQVLALCVYPNLLSSPDFPEDAKRRAERILQACGGHSL 120          
BLAST of Alanine aminotransferase vs. TrEMBL
Match: V4AU38 (Aminotran_1_2 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_114341 PE=4 SV=1)

HSP 1 Score: 655.981 bits (1691), Expect = 0.000e+0
Identity = 305/469 (65.03%), Postives = 382/469 (81.45%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFHL 2002
            ++++NMNPH K++EYAVRGPIV RA E+E EL+KG+  PF +VI+ NIGDCHA GQ+P+TFIRQV+A+ A PE+  DPNFP DAK+RA+RIL+ CGG SIGSYS S+GV++IR+D AK+I++RDG PS  +DIF+S GAS+ IK+I+++L T + GK RAGVMIPIPQYPLY+AT AEYNA+ IGYFL ED+ W L   EL+RA+ EAK  C P+AIVIINPGNPTGQVLT+++IE VI+FAK+ NL +MADEVYQ NIYA+   F S KK L EMG++YN  + LASFMSTSKGYMGECGFRGGYCE+IN D +VKA L K +SA+LCSS+ GQ ++DVVVN PK+GEPSY+LFEKEK  VL  L  K K+V+ETFN++ G  CN VQGAMYAFP+I+LP K++ AAKA   + D FYC NLLE+TG+CVVPGSGFGQ EGT+HFR TILPPV+K+  ++   ++FHL
Sbjct:    8 LSVENMNPHIKKMEYAVRGPIVIRAGEIEAELQKGEKKPFPDVIRANIGDCHATGQQPLTFIRQVSAICAYPELLKDPNFPRDAKERARRILDGCGGHSIGSYSDSSGVKVIREDTAKYITDRDGHPSNWEDIFLSTGASDGIKTIMKLLMTGETGKGRAGVMIPIPQYPLYTATIAEYNAHPIGYFLNEDRNWALDVSELKRALEEAKPHCRPKAIVIINPGNPTGQVLTKENIEAVIKFAKEENLFLMADEVYQHNIYAQGSKFYSFKKVLTEMGSKYN-DLELASFMSTSKGYMGECGFRGGYCEVINLDPDVKAMLLKSISAKLCSSIAGQAVMDVVVNPPKQGEPSYDLFEKEKWMVLGQLAEKAKMVTETFNTIEGISCNEVQGAMYAFPQIKLPKKLLEAAKAKGQSPDAFYCFNLLEETGICVVPGSGFGQVEGTYHFRTTILPPVQKLGEMLARFRDFHL 475          

HSP 2 Score: 145.591 bits (366), Expect = 2.137e-33
Identity = 63/102 (61.76%), Postives = 83/102 (81.37%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVS 583
            ++++NMNPH++++EYAVRGPIV RA E+E E+ +G+  PF +VI+ NIGDCHA GQ+P+TFIRQV+A+ A PEL  DPN PRDAKERA+ IL  CGG S+ S
Sbjct:    8 LSVENMNPHIKKMEYAVRGPIVIRAGEIEAELQKGEKKPFPDVIRANIGDCHATGQQPLTFIRQVSAICAYPELLKDPNFPRDAKERARRILDGCGGHSIGS 109          
BLAST of Alanine aminotransferase vs. TrEMBL
Match: A0A267GX42 (Aminotran_1_2 domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig014945g2 PE=4 SV=1)

HSP 1 Score: 644.04 bits (1660), Expect = 0.000e+0
Identity = 297/468 (63.46%), Postives = 371/468 (79.27%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T+++MNP  KRLEYAVRGPIV RA +LE ELK G + PF EVI+CNIGDCHAMGQKPITF+RQV A+L+ P + +   +P+D K RAKRILE CGGGS+G+YS S GV +IR+DCAK+I  RDGIP+  ++IF+++GASEA+K++L++L+T ++G D+ GVM+PIPQYPLYSA+ ++YN   + Y+LEE   W LS+ EL RA +EA  KC PRA+V+INPGNPTGQVL ++ IE VIRFAK+ NL I+ADEVYQ N+YAE   F S K+ LH MG  Y K + LASFMS SKGYMGECGFRGGYCEL+N D EV+A LYK LSARLCS V+GQ ILDV++N PK  EPS+   E+EK++VL DLK K ++ +ETFNS+PG +CN VQGAMYAFP IELPPK+I  AKA     D  YC  LLE+ GVCVVPGSGFGQ+ GT+HFR+TILPPVEK++ VM++ KEFH
Sbjct:   39 LTLESMNPCVKRLEYAVRGPIVARATQLEKELKSGATKPFSEVIRCNIGDCHAMGQKPITFLRQVIAVLSDPSLMDSDRYPADVKARAKRILEGCGGGSVGAYSASCGVPVIREDCAKYIEARDGIPANPENIFLTSGASEAVKAVLELLATGQEGADQPGVMVPIPQYPLYSASISQYNLQTVPYYLEESDNWSLSQAELRRAYDEAVGKCKPRALVVINPGNPTGQVLRKEIIEDVIRFAKEKNLFILADEVYQHNVYAEGAKFYSFKQVLHGMGDAYFKEMELASFMSASKGYMGECGFRGGYCELVNMDPEVQAMLYKQLSARLCSVVMGQAILDVIMNPPKPDEPSFAEHEREKSQVLGDLKLKAQMATETFNSIPGMRCNPVQGAMYAFPSIELPPKLIEEAKAKGMQPDAMYCTALLEEKGVCVVPGSGFGQRPGTYHFRMTILPPVEKLKKVMQIFKEFH 506          

HSP 2 Score: 137.502 bits (345), Expect = 1.680e-30
Identity = 63/100 (63.00%), Postives = 76/100 (76.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV 577
            +T+++MNP V+RLEYAVRGPIV RA +LE E+  G T PF EVI+CNIGDCHAMGQKPITF+RQV A+L+ P L +    P D K RA+ IL  CGG SV
Sbjct:   39 LTLESMNPCVKRLEYAVRGPIVARATQLEKELKSGATKPFSEVIRCNIGDCHAMGQKPITFLRQVIAVLSDPSLMDSDRYPADVKARAKRILEGCGGGSV 138          
BLAST of Alanine aminotransferase vs. TrEMBL
Match: A0A1I8GXV6 (Aminotran_1_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 643.654 bits (1659), Expect = 0.000e+0
Identity = 297/468 (63.46%), Postives = 371/468 (79.27%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T+++MNP  KRLEYAVRGPIV RA +LE ELK G + PF EVI+CNIGDCHAMGQKPITF+RQV A+L+ P + +   +P+D K RAKRILE CGGGS+G+YS S GV +IR+DCAK+I  RDGIP+  ++IF+++GASEA+K++L++L+T ++G D+ GVM+PIPQYPLYSA+ ++YN   + Y+LEE   W LS+ EL RA +EA  KC PRA+V+INPGNPTGQVL ++ IE VIRFAK+ NL I+ADEVYQ N+YAE   F S K+ LH MG  Y K + LASFMS SKGYMGECGFRGGYCEL+N D EV+A LYK LSARLCS V+GQ ILDV++N PK  EPS+   E+EK++VL DLK K ++ +ETFNS+PG +CN VQGAMYAFP IELPPK+I  AKA     D  YC  LLE+ GVCVVPGSGFGQ+ GT+HFR+TILPPVEK++ VM++ KEFH
Sbjct:    9 LTLESMNPCVKRLEYAVRGPIVARATQLEKELKSGATKPFSEVIRCNIGDCHAMGQKPITFLRQVIAVLSDPSLMDSDRYPADVKARAKRILEGCGGGSVGAYSASCGVPVIREDCAKYIEARDGIPANPENIFLTSGASEAVKAVLELLATGQEGADQPGVMVPIPQYPLYSASISQYNLQTVPYYLEESDNWSLSQAELRRAYDEAVGKCKPRALVVINPGNPTGQVLRKEIIEDVIRFAKEKNLFILADEVYQHNVYAEGAKFYSFKQVLHGMGDAYFKEMELASFMSASKGYMGECGFRGGYCELVNMDPEVQAMLYKQLSARLCSVVMGQAILDVIMNPPKPDEPSFAEHEREKSQVLGDLKLKAQMATETFNSIPGMRCNPVQGAMYAFPSIELPPKLIEEAKAKGMQPDAMYCTALLEEKGVCVVPGSGFGQRPGTYHFRMTILPPVEKLKNVMQIFKEFH 476          

HSP 2 Score: 137.117 bits (344), Expect = 1.351e-30
Identity = 63/100 (63.00%), Postives = 76/100 (76.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV 577
            +T+++MNP V+RLEYAVRGPIV RA +LE E+  G T PF EVI+CNIGDCHAMGQKPITF+RQV A+L+ P L +    P D K RA+ IL  CGG SV
Sbjct:    9 LTLESMNPCVKRLEYAVRGPIVARATQLEKELKSGATKPFSEVIRCNIGDCHAMGQKPITFLRQVIAVLSDPSLMDSDRYPADVKARAKRILEGCGGGSV 108          
BLAST of Alanine aminotransferase vs. TrEMBL
Match: A0A267GCT9 (Aminotran_1_2 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001904g5 PE=4 SV=1)

HSP 1 Score: 640.188 bits (1650), Expect = 0.000e+0
Identity = 296/468 (63.25%), Postives = 370/468 (79.06%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T+++MNP  KRLEYAVRGPIV RA +LE ELK G + PF EVI+CNIGDCHAMGQKPITF+RQV A+L+ P + +   +P+D K RAKRILE CGGGS+G+YS S GV +IR+DCAK+I  RDGIP+  ++IF+++GASEA+K++L++L+T ++G D+ GVM+PIPQYPLYSA+ ++YN   + Y+LEE   W LS+ EL RA +EA  KC PRA+V+INPGNPTGQVL ++ IE VIRFAK+ NL I+ADEVYQ N+YAE   F S K+ LH MG  Y K + LASFMS SKGYMGECGFRGGYCEL+N D EV+A LYK LSARLCS V+GQ ILDV++N PK  EPS+   E+EK++VL DLK K ++ +ETFNS+ G +CN VQGAMYAFP IELPPK+I  AKA     D  YC  LLE+ GVCVVPGSGFGQ+ GT+HFR+TILPPVEK++ VM++ KEFH
Sbjct:    9 LTLESMNPCVKRLEYAVRGPIVARATQLEKELKSGATKPFSEVIRCNIGDCHAMGQKPITFLRQVIAVLSDPSLMDSDRYPADVKARAKRILEGCGGGSVGAYSASCGVPVIREDCAKYIEARDGIPANPENIFLTSGASEAVKAVLELLATGQEGADQPGVMVPIPQYPLYSASISQYNLQTVPYYLEESDNWSLSQAELRRAYDEAVGKCKPRALVVINPGNPTGQVLRKEIIEDVIRFAKEKNLFILADEVYQHNVYAEGAKFYSFKQVLHGMGDAYFKEMELASFMSASKGYMGECGFRGGYCELVNMDPEVQAMLYKQLSARLCSVVMGQAILDVIMNPPKPDEPSFAEHEREKSQVLGDLKLKAQMATETFNSIAGMRCNPVQGAMYAFPSIELPPKLIEEAKAKGMQPDAMYCTALLEEKGVCVVPGSGFGQRPGTYHFRMTILPPVEKLKNVMQIFKEFH 476          

HSP 2 Score: 137.117 bits (344), Expect = 1.277e-30
Identity = 63/100 (63.00%), Postives = 76/100 (76.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV 577
            +T+++MNP V+RLEYAVRGPIV RA +LE E+  G T PF EVI+CNIGDCHAMGQKPITF+RQV A+L+ P L +    P D K RA+ IL  CGG SV
Sbjct:    9 LTLESMNPCVKRLEYAVRGPIVARATQLEKELKSGATKPFSEVIRCNIGDCHAMGQKPITFLRQVIAVLSDPSLMDSDRYPADVKARAKRILEGCGGGSV 108          
BLAST of Alanine aminotransferase vs. TrEMBL
Match: A0A1I8HB54 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 639.032 bits (1647), Expect = 0.000e+0
Identity = 296/468 (63.25%), Postives = 370/468 (79.06%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T+++MNP  KRLEYAVRGPIV RA +LE ELK G + PF EVI+CNIGDCHAMGQKPITF+RQV A+L+ P + +   +P+D K RAKRILE CGGGS+G+YS S GV +IR+DCAK+I  RDGIP+  ++IF+++GASEA+K++L++L+T ++G D+ GVM+PIPQYPLYSA+ ++YN   + Y+LEE   W LS+ EL RA +EA  KC PRA+V+INPGNPTGQVL ++ IE VIRFAK+ NL I+ADEVYQ N+YAE   F S K+ LH MG  Y K + LASFMS SKGYMGECGFRGGYCEL+N D EV+A LYK LSARLCS V+GQ ILDV++N PK  EPS+   E+EK++VL DLK K ++ +ETFNS+ G +CN VQGAMYAFP IELPPK+I  AKA     D  YC  LLE+ GVCVVPGSGFGQ+ GT+HFR+TILPPVEK++ VM++ KEFH
Sbjct:  489 LTLESMNPCVKRLEYAVRGPIVARATQLEKELKSGATKPFSEVIRCNIGDCHAMGQKPITFLRQVIAVLSDPSLMDSDRYPADVKARAKRILEGCGGGSVGAYSASCGVPVIREDCAKYIEARDGIPANPENIFLTSGASEAVKAVLELLATGQEGADQPGVMVPIPQYPLYSASISQYNLQTVPYYLEESDNWSLSQAELRRAYDEAVGKCKPRALVVINPGNPTGQVLRKEIIEDVIRFAKEKNLFILADEVYQHNVYAEGAKFYSFKQVLHGMGDAYFKEMELASFMSASKGYMGECGFRGGYCELVNMDPEVQAMLYKQLSARLCSVVMGQAILDVIMNPPKPDEPSFAEHEREKSQVLGDLKLKAQMATETFNSIAGMRCNPVQGAMYAFPSIELPPKLIEEAKAKGMQPDAMYCTALLEEKGVCVVPGSGFGQRPGTYHFRMTILPPVEKLKNVMQIFKEFH 956          

HSP 2 Score: 547.74 bits (1410), Expect = 1.579e-179
Identity = 258/470 (54.89%), Postives = 339/470 (72.13%), Query Frame = 2
Query:  608 NMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEM-QNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQILSTQKDGKD-----RAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            ++NP+   +EYAVRGPIV  A  +++EL  G   PF E+I CNIGDCHAMGQKPI+F+RQV AL+  P + ++D ++P+D KQRA+RIL++  GG +   S+  G+ +IRQDCA +I +RDG+P     + +S GA E IK +LQ+ +  +         + GVMIPIPQYP+YSA+  +YN   + Y+L+E   W L   EL RA +EA  KC PR +V+INPGNPTGQVL ++ IE V+RFAK+ NL I+ADEVYQ N+YAE   F S K+ALH +G E++ +V LAS MS SKGY GECGFRGGYCEL+N D  +++ LY+ L+ R C SV GQ ILDV+VN PK  EPS+   E+EK++VL DLK K ++ +ETFNS+PG +CN VQGAMYAFP IELPPK+I  AKA     D  YC  LLE+ GVCVVPGSGFGQ+ GT+HFR+TILPPV+K++ VM+  ++FH
Sbjct:   12 SINPYILNIEYAVRGPIVANAQRIQSELDAGIPKPFTELIWCNIGDCHAMGQKPISFLRQVVALIVDPSLIESDSHYPADVKQRARRILDN--GGGLQYSSEMLGLPVIRQDCANYIQDRDGVPCNPDSVILSTGAGEMIKELLQVFARLQPSASTVNGLQYGVMIPIPQYPMYSASITQYNLQSVHYYLDESDNWSLDLSELRRAYDEAVGKCEPRVLVVINPGNPTGQVLRKEVIEDVVRFAKEKNLFILADEVYQHNVYAEGAKFYSFKRALHRLGPEFSTTVQLASLMSASKGYAGECGFRGGYCELLNPDARLQSLLYRQLANRGCPSVAGQAILDVIVNPPKPDEPSFAEHEREKSQVLGDLKLKAQMATETFNSIPGMRCNPVQGAMYAFPSIELPPKLIEEAKAKGMQPDAMYCTALLEEKGVCVVPGSGFGQRPGTYHFRMTILPPVDKLRQVMEQFRDFH 479          

HSP 3 Score: 136.732 bits (343), Expect = 2.717e-29
Identity = 63/100 (63.00%), Postives = 76/100 (76.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV 577
            +T+++MNP V+RLEYAVRGPIV RA +LE E+  G T PF EVI+CNIGDCHAMGQKPITF+RQV A+L+ P L +    P D K RA+ IL  CGG SV
Sbjct:  489 LTLESMNPCVKRLEYAVRGPIVARATQLEKELKSGATKPFSEVIRCNIGDCHAMGQKPITFLRQVIAVLSDPSLMDSDRYPADVKARAKRILEGCGGGSV 588          

HSP 4 Score: 110.923 bits (276), Expect = 3.351e-21
Identity = 51/94 (54.26%), Postives = 70/94 (74.47%), Query Frame = 2
Query:  290 NMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEL-QNDPNIPRDAKERAQSILGNCGG 568
            ++NP++  +EYAVRGPIV  A  +++E++ G   PF E+I CNIGDCHAMGQKPI+F+RQV AL+  P L ++D + P D K+RA+ IL N GG
Sbjct:   12 SINPYILNIEYAVRGPIVANAQRIQSELDAGIPKPFTELIWCNIGDCHAMGQKPISFLRQVVALIVDPSLIESDSHYPADVKQRARRILDNGGG 105          
BLAST of Alanine aminotransferase vs. Ensembl Cavefish
Match: si:ch211-217a12.1 (si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214-95])

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 276/469 (58.85%), Postives = 342/469 (72.92%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T+D+MNP+ KR+EYAVRGPIVQRA+++E EL++G   PF EVIK NIGDCHAMGQKPITF RQV AL + PE+  D  FP D K RA+RIL++C GGSIGSYS S G+E+IR D A++I  RDG IP    +I++S GAS+ I ++L++L +  +G  R GVMI IPQYPLYSA  AE  A QI Y+L+E + W L  KEL RA+  A+  C PR + IINPGNPTGQV +R  IE VI+FA + NL +MADEVYQ N+YAE   F S KK L EMG EY++ V L SF STSK YMGECGFRGGY E++N D EVK QL K +S RLC  V GQ +LD+VVN P+  EPSY  F KE++  L+ L  K K+  +  N +PG  CN VQGAMY+FP I+LPPK IA AK      D FYC+ LLE+ G+C+VPGSGFGQ++GTFHFR+TILPP EK++ V+  IKEFH
Sbjct:  578 LTLDSMNPNVKRVEYAVRGPIVQRAVQIEKELREGVKKPFTEVIKANIGDCHAMGQKPITFFRQVLALCSYPELLEDNKFPEDVKNRARRILQACAGGSIGSYSASQGIELIRNDVARYIERRDGGIPCSPDNIYLSAGASDGIMTMLKLLVS-GEGSSRTGVMISIPQYPLYSAGLAELAAVQINYYLDEAKCWSLDVKELRRALEAARKHCRPRVLCIINPGNPTGQVQSRQCIEDVIKFAAEENLFLMADEVYQDNVYAEGCQFHSFKKVLFEMGPEYSEKVELVSFHSTSKCYMGECGFRGGYMEVVNLDPEVKVQLTKLVSVRLCPPVTGQALLDLVVNPPQPDEPSYATFIKERSHTLAMLAEKAKMTQDILNQVPGISCNPVQGAMYSFPSIQLPPKAIAEAKEKGQAPDMFYCMKLLEEKGICLVPGSGFGQRDGTFHFRMTILPPTEKLKIVLAKIKEFH 1045          

HSP 2 Score: 137.502 bits (345), Expect = 6.183e-33
Identity = 68/114 (59.65%), Postives = 82/114 (71.93%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVS---SQGPITIDN 610
            +T+D+MNP+V+R+EYAVRGPIVQRA+++E E+ +G   PF EVIK NIGDCHAMGQKPITF RQV AL + PEL  D   P D K RA+ IL  C G S+ S   SQG   I N
Sbjct:  578 LTLDSMNPNVKRVEYAVRGPIVQRAVQIEKELREGVKKPFTEVIKANIGDCHAMGQKPITFFRQVLALCSYPELLEDNKFPEDVKNRARRILQACAGGSIGSYSASQGIELIRN 691          
BLAST of Alanine aminotransferase vs. Ensembl Cavefish
Match: gpt2 (glutamic--pyruvic transaminase 2 [Source:NCBI gene;Acc:103044245])

HSP 1 Score: 565.844 bits (1457), Expect = 0.000e+0
Identity = 268/470 (57.02%), Postives = 345/470 (73.40%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERD-GIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFHL 2002
            +T++ +NP  K +EYAVRGPIV +A E+E  L++G   PF EVIK NIGD HAMGQ+PITF+RQV AL   PE+ + P+FP DAK+RA+RIL+SCGG S+GSYS S GV+ IR+D A +I +RD G+PS+ ++IF++ GAS+ I +IL++L +   G+ R GVMIPIPQYPLYSA  AE  A Q+ Y+L+ED  W L   EL R+   AK+ C PR + IINPGNPTGQV ++  IE V+ FA + NL +MADEVYQ N+YA +  F S KK L+EMG EY  SV LASF STSKGY GECGFRGG+ E++N D EVKAQL K LS RLC  V GQ  +DV+VN P+  EPS+  F KEK  VL  L  K KL  +  +++PG KCN VQGAMYAFP+I +PP+ +  AKAL    D  YCL LLE+TG+CVVPGSGFGQ+EGT+HFR+TILP  EK++ +++ +++FH+
Sbjct:   71 LTMETLNPQVKAVEYAVRGPIVIKAGEIEKSLQEGCKRPFTEVIKANIGDAHAMGQQPITFLRQVVALCTFPELMDSPSFPEDAKRRARRILQSCGGQSLGSYSASQGVDCIRKDIAAYIEQRDQGVPSDWENIFLTTGASDGIVNILRLLVSGA-GRSRTGVMIPIPQYPLYSAAIAEMGAVQVNYYLDEDNCWALDVNELHRSYQAAKEHCQPRVLCIINPGNPTGQVQSKKCIEDVLHFAYEENLFVMADEVYQENVYAPDCQFHSFKKVLYEMGPEYFNSVELASFHSTSKGYTGECGFRGGFMEVVNLDPEVKAQLVKLLSVRLCPPVAGQAAMDVIVNPPQPDEPSFTQFHKEKAAVLGALADKAKLTEQILSAVPGIKCNPVQGAMYAFPQIFIPPRAVEEAKALGMQPDMLYCLRLLEETGICVVPGSGFGQREGTYHFRMTILPSPEKLKVLLEKVRDFHM 539          

HSP 2 Score: 126.331 bits (316), Expect = 4.651e-30
Identity = 59/110 (53.64%), Postives = 77/110 (70.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVSSQGPITID 607
            +T++ +NP V+ +EYAVRGPIV +A E+E  + +G   PF EVIK NIGD HAMGQ+PITF+RQV AL   PEL + P+ P DAK RA+ IL +CGG S+ S      +D
Sbjct:   71 LTMETLNPQVKAVEYAVRGPIVIKAGEIEKSLQEGCKRPFTEVIKANIGDAHAMGQQPITFLRQVVALCTFPELMDSPSFPEDAKRRARRILQSCGGQSLGSYSASQGVD 180          
BLAST of Alanine aminotransferase vs. Ensembl Cavefish
Match: gpt2l (alanine aminotransferase 2-like [Source:NCBI gene;Acc:111194474])

HSP 1 Score: 565.074 bits (1455), Expect = 0.000e+0
Identity = 274/499 (54.91%), Postives = 356/499 (71.34%), Query Frame = 2
Query:  509 PNIPRDAKERAQSILGNCGGSSVVSSQGPI-TIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            P  P   + R+ S+ GN      ++ +G + T+D MN + K++EYAVRGPIVQRA+++E ELK+G   PF EVIK NIGD HAMGQ+PITF RQV AL + PE+ +D  FP DAK RA+RIL++CGG SIG+Y+ S G++ +R D A++I  RDG I  +  +I+++ GAS+ I +IL++L T  +G+ R GVMI IPQYPLYSA  AE  A QI Y+L E++ W L   EL+R+++ A+  C+PR + IINPGNPTGQV +R  IE VIRFA K  L +MADEVYQ N+YAE   F S KK L EMG E++ +V LASF STSK YMGECG RGGY E+IN D EVKAQL K +S RLC  V GQ ++ +V N P+ GEPSY  F  E+   L+DL  K KL  E  N++PG +CN VQGAMY+FP+I LP + I  AKA     D FYC+ LLE+TG+C+VPGSGFGQKEGT+HFR+TILPP +K++ ++  +KEFH
Sbjct:   25 PLQPTLRRTRSSSMAGN----DALARRGKVLTVDTMNANVKKVEYAVRGPIVQRAVQIEKELKEGVKKPFNEVIKANIGDAHAMGQQPITFFRQVLALCSYPELLDDNKFPEDAKNRARRILKACGGSSIGAYTASQGIDCVRIDVARYIERRDGGISCDPDNIYLTTGASDGIVTILKLL-TAGEGRTRTGVMISIPQYPLYSAAIAELGAVQINYYLNEEKCWSLDISELQRSLDAARQYCNPRVLCIINPGNPTGQVQSRQCIEDVIRFAAKERLFLMADEVYQDNVYAEGCAFHSFKKVLFEMGPEFSSTVELASFHSTSKCYMGECGLRGGYMEVINMDPEVKAQLTKLVSVRLCPPVPGQTLMGLVTNSPQPGEPSYAQFITERTATLNDLAQKAKLTEEILNTVPGIRCNPVQGAMYSFPQITLPERAIKEAKAKGQVPDMFYCMKLLEETGICLVPGSGFGQKEGTYHFRMTILPPTDKLKIMLDKLKEFH 518          

HSP 2 Score: 133.65 bits (335), Expect = 1.325e-32
Identity = 64/108 (59.26%), Postives = 81/108 (75.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV---VSSQG 592
            +T+D MN +V+++EYAVRGPIVQRA+++E E+ +G   PF EVIK NIGD HAMGQ+PITF RQV AL + PEL +D   P DAK RA+ IL  CGGSS+    +SQG
Sbjct:   51 LTVDTMNANVKKVEYAVRGPIVQRAVQIEKELKEGVKKPFNEVIKANIGDAHAMGQQPITFFRQVLALCSYPELLDDNKFPEDAKNRARRILKACGGSSIGAYTASQG 158          
BLAST of Alanine aminotransferase vs. Ensembl Cavefish
Match: si:ch211-217a12.1 (si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214-95])

HSP 1 Score: 546.969 bits (1408), Expect = 0.000e+0
Identity = 267/470 (56.81%), Postives = 332/470 (70.64%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFHL 2002
            +T+D+MNP+ KR+EYAVRGPIVQRA+++E EL++G   PF EVIK NIGDCHAMGQKPITF RQV AL + PE+  D  FP D K RA+RIL++C GGSIGSYS S G+E+IR D A++I  RDG IP    +I++S GAS+ I ++L++L    +G  R GVMI IPQYPLYSA  AE  A QI Y+L+E + W L  KEL RA+  A+  C PR + IINPGNPTGQV +R  IE VI+FA + NL +MADEVYQ N+YAE   F S KK L EMG EY++ V L SF STSK YMGECGFRGGY E++N D EVK QL K +S RLC  V GQ +LD+VVN P+  EPSY  F KE++  L+ L  K K+  +  N +PG  CN VQGAMY+FP I+LPPK IA AK      D FYC+ LLE+ G+C+VPGSGFGQ++GTFHFR           +VM ++K F +
Sbjct:   13 LTLDSMNPNVKRVEYAVRGPIVQRAVQIEKELREGVKKPFTEVIKANIGDCHAMGQKPITFFRQVLALCSYPELLEDNKFPEDVKNRARRILQACAGGSIGSYSASQGIELIRNDVARYIERRDGGIPCSPDNIYLSAGASDGIMTMLKLL-VSGEGSSRTGVMISIPQYPLYSAGLAELAAVQINYYLDEAKCWSLDVKELRRALEAARKHCRPRVLCIINPGNPTGQVQSRQCIEDVIKFAAEENLFLMADEVYQDNVYAEGCQFHSFKKVLFEMGPEYSEKVELVSFHSTSKCYMGECGFRGGYMEVVNLDPEVKVQLTKLVSVRLCPPVTGQALLDLVVNPPQPDEPSYATFIKERSHTLAMLAEKAKMTQDILNQVPGISCNPVQGAMYSFPSIQLPPKAIAEAKEKGQAPDMFYCMKLLEEKGICLVPGSGFGQRDGTFHFR-----------SVMWILKVFFI 470          

HSP 2 Score: 136.732 bits (343), Expect = 8.523e-34
Identity = 68/114 (59.65%), Postives = 82/114 (71.93%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVS---SQGPITIDN 610
            +T+D+MNP+V+R+EYAVRGPIVQRA+++E E+ +G   PF EVIK NIGDCHAMGQKPITF RQV AL + PEL  D   P D K RA+ IL  C G S+ S   SQG   I N
Sbjct:   13 LTLDSMNPNVKRVEYAVRGPIVQRAVQIEKELREGVKKPFTEVIKANIGDCHAMGQKPITFFRQVLALCSYPELLEDNKFPEDVKNRARRILQACAGGSIGSYSASQGIELIRN 126          
BLAST of Alanine aminotransferase vs. Ensembl Cavefish
Match: gpt2 (glutamic--pyruvic transaminase 2 [Source:NCBI gene;Acc:103044245])

HSP 1 Score: 544.658 bits (1402), Expect = 0.000e+0
Identity = 261/451 (57.87%), Postives = 329/451 (72.95%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERD-GIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITI 1945
            +T++ +NP  K +EYAVRGPIV +A E+E  L++G   PF EVIK NIGD HAMGQ+PITF+RQV AL   PE+ + P+FP DAK+RA+RIL+SCGG S+GSYS S GV+ IR+D A +I +RD G+PS+ ++IF++ GAS+ I +IL++L +   G+ R GVMIPIPQYPLYSA  AE  A Q+ Y+L+ED  W L   EL R+   AK+ C PR + IINPGNPTGQV ++  IE V+ FA + NL +MADEVYQ N+YA +  F S KK L+EMG EY  SV LASF STSKGY GECGFRGG+ E++N D EVKAQL K LS RLC  V GQ  +DV+VN P+  EPS+  F KEK  VL  L  K KL  +  +++PG KCN VQGAMYAFP+I +PP+ +  AKAL    D  YCL LLE+TG+CVVPGSGFGQ+EGT+HFR+ I
Sbjct:   71 LTMETLNPQVKAVEYAVRGPIVIKAGEIEKSLQEGCKRPFTEVIKANIGDAHAMGQQPITFLRQVVALCTFPELMDSPSFPEDAKRRARRILQSCGGQSLGSYSASQGVDCIRKDIAAYIEQRDQGVPSDWENIFLTTGASDGIVNILRLLVSGA-GRSRTGVMIPIPQYPLYSAAIAEMGAVQVNYYLDEDNCWALDVNELHRSYQAAKEHCQPRVLCIINPGNPTGQVQSKKCIEDVLHFAYEENLFVMADEVYQENVYAPDCQFHSFKKVLYEMGPEYFNSVELASFHSTSKGYTGECGFRGGFMEVVNLDPEVKAQLVKLLSVRLCPPVAGQAAMDVIVNPPQPDEPSFTQFHKEKAAVLGALADKAKLTEQILSAVPGIKCNPVQGAMYAFPQIFIPPRAVEEAKALGMQPDMLYCLRLLEETGICVVPGSGFGQREGTYHFRMII 520          

HSP 2 Score: 125.946 bits (315), Expect = 4.485e-30
Identity = 59/110 (53.64%), Postives = 77/110 (70.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVSSQGPITID 607
            +T++ +NP V+ +EYAVRGPIV +A E+E  + +G   PF EVIK NIGD HAMGQ+PITF+RQV AL   PEL + P+ P DAK RA+ IL +CGG S+ S      +D
Sbjct:   71 LTMETLNPQVKAVEYAVRGPIVIKAGEIEKSLQEGCKRPFTEVIKANIGDAHAMGQQPITFLRQVVALCTFPELMDSPSFPEDAKRRARRILQSCGGQSLGSYSASQGVD 180          
BLAST of Alanine aminotransferase vs. Ensembl Sea Lamprey
Match: gpt2 (glutamic pyruvate transaminase (alanine aminotransferase) 2 [Source:ZFIN;Acc:ZDB-GENE-030729-8])

HSP 1 Score: 291.197 bits (744), Expect = 7.088e-94
Identity = 135/246 (54.88%), Postives = 173/246 (70.33%), Query Frame = 2
Query: 1262 GNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            GNPTGQV  R  IE VI FA +  L I+ADEVYQ N+YA    F S KK LH+MG EY ++V LAS  STSKG++GECG RGGY E++N    VKA+L K +S RLC  V+GQ  +DV+ N P+ GEPS+ L+ +E++ VL  L  K  L ++  N   G  CN VQGAMYAFP++ +PP+ +A A+A     D FYCL LLE+TG+CVVPGSGFGQK+GT HFR+TILPP EK++ ++  + EFH
Sbjct:    1 GNPTGQVQDRHSIEEVIEFAAEEGLFIIADEVYQDNVYAPGCQFHSFKKVLHDMGPEYEQTVQLASLHSTSKGFLGECGQRGGYMEVLNLPAGVKAELVKLVSVRLCPPVLGQATVDVLANPPELGEPSHSLYVQERDSVLRSLARKALLTAQLLNGTEGIACNPVQGAMYAFPRVHIPPRAVAEAQARGLLPDMFYCLQLLEETGICVVPGSGFGQKDGTHHFRMTILPPEEKLKILLTKVTEFH 246          
BLAST of Alanine aminotransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003702.1 (pep scaffold:Pmarinus_7.0:GL476611:173756:192777:1 gene:ENSPMAG00000003364.1 transcript:ENSPMAT00000003702.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 1.041e-12
Identity = 44/177 (24.86%), Postives = 85/177 (48.02%), Query Frame = 2
Query:  902 YSQSTGVEIIRQDCAKFISE--RDGIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFL-------EEDQFWGLSEKELERAINEAK-DKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISM 1402
            Y    G   ++++ A+F+++  +   P +S+++ V NG      ++  +L    DG     ++IP P Y +       Y+  +  +         +E   + L+  +LE A+  AK +    RA+++INP NP G +   D +   + FAK+H L ++ DE+Y   I+ +   F S+
Sbjct:  104 YGDWRGHAFLKKEMARFLTDYCKAPRPLDSENVVVVNGCGSLFTALSAVLCDPGDG-----ILIPTPYYGIIDEDIRHYSGVRTVHVPLSGVPSEDETHPFQLTVPKLETALEAAKKEGMRIRAVILINPNNPLGDIYPADALLSYLEFAKRHELHVIMDEIYMLTIFIKGPKFTSV 275          
BLAST of Alanine aminotransferase vs. Ensembl Yeast
Match: ALT2 (Catalytically inactive alanine transaminase; expression is repressed in the presence of alanine and repression is mediated by Nrg1p; ALT2 has a paralog, ALT1, that arose from the whole genome duplication [Source:SGD;Acc:S000002518])

HSP 1 Score: 385.185 bits (988), Expect = 9.592e-127
Identity = 209/484 (43.18%), Postives = 300/484 (61.98%), Query Frame = 2
Query:  590 GPITIDNMNPHAKRLEYAVRGPIVQRALELENELKKG-KSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPN--------FPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEA-KDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYN---KSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            G IT  ++N    + EYAVRG I  RA EL+ ELKK  +  PF ++I  NIG+   + QKP+TF RQV A+L  PE+    +        F  DA +RA+R+L   GG SIG+YS S GV  IRQ  A FI+ RDG  P+  +DI+++ GAS A  S+L +L   KD +   G++IPIPQYPLY+A+ + +NA  + Y+L+E+  W  +  E+E+ + +A K +  P  +++INPGNPTG VL+ + I  +   A K+ + I++DEVYQ NI+ + + F SMKK L ++   Y     +V LAS  S SKG+M ECG RGGY E+I +  E++  L+K +S  +CS V GQ ++D++V  P+ G+ SYE    E+ K+  +++ +  L+ ETF  L G +C   QGAMY FP++ LP K +  ++ L    D FYC +LLE TG+C VPGSGFGQ+ GT+H R T L P  K    ++  KEFH
Sbjct:   24 GKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGG-SIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLC--KDSQ--TGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVK-FHSMKKVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKW---IQDWKEFH 498          

HSP 2 Score: 79.7221 bits (195), Expect = 4.204e-16
Identity = 46/109 (42.20%), Postives = 63/109 (57.80%), Query Frame = 2
Query:  272 GPITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQG-KTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMP--------ELQNDPNIPRDAKERAQSILGNCGGS 571
            G IT  ++N  V + EYAVRG I  RA EL+ E+ +  +  PF ++I  NIG+   + QKP+TF RQV A+L  P        EL +     RDA ERA+ +L + GGS
Sbjct:   24 GKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGS 132          
BLAST of Alanine aminotransferase vs. Ensembl Yeast
Match: ALT1 (Alanine transaminase (glutamic pyruvic transaminase); involved in alanine biosynthesis and catabolism; TOR1-independent role in determining chronological lifespan; expression is induced in the presence of alanine; repression is mediated by Nrg1p; ALT1 has a paralog, ALT2, that arose from the whole genome duplication; Alt2p is catalytically inactive [Source:SGD;Acc:S000004079])

HSP 1 Score: 377.096 bits (967), Expect = 1.723e-122
Identity = 210/482 (43.57%), Postives = 297/482 (61.62%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKG-KSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPN--------FPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERD-GIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEA-KDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYN---KSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPP-VEKMQTVMKLIKEF 1996
            +T++++N +  + +YAVRG I  RA EL+ +L+K  +S PF  +I  NIG+   + QKP+T+ RQV +LL  PE+ N           F  DA +RAK ++E  GG S+G+YS S GVE IR+  A+FI++RD G  S  +DIF++ GAS A+  +L I     +     GV+IPIPQYPLY+AT A  N+  + Y+L+E+  W  + +E+E  + EA +++  P  +V+INPGNPTG VL+ + I  +   A K+  +++ADEVYQ NI+   + F SMKK L  +  E+     +V LAS  STSKG  GECG RGGY EL  +  E++  + K  S  LC  V GQ ++D++V  P +GE S+E  + E+N +   L  +   + ETFNSL G +C   QGAMY FPKI+LP K +  A+ L  T D FYC  LLE TG+C VPGSGFGQ+ GT+H R T L P +E ++      KEF
Sbjct:  111 LTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGG-SVGAYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPE----TGVLIPIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTK-FHSMKKILRHLQREHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKEF 586          

HSP 2 Score: 76.2554 bits (186), Expect = 7.783e-15
Identity = 45/116 (38.79%), Postives = 73/116 (62.93%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQG-KTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEL--QNDPNI------PRDAKERAQSILGNCGGS--SVVSSQG 592
            +T++++N +V + +YAVRG I  RA EL+ ++ +  ++ PF  +I  NIG+   + QKP+T+ RQV +LL  PEL  QN+  +        DA +RA+S++ + GGS  +  SSQG
Sbjct:  111 LTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQG 226          
BLAST of Alanine aminotransferase vs. Ensembl Yeast
Match: BNA3 (Kynurenine aminotransferase; catalyzes formation of kynurenic acid from kynurenine; potential Cdc28p substrate [Source:SGD;Acc:S000003596])

HSP 1 Score: 60.4622 bits (145), Expect = 4.698e-10
Identity = 61/256 (23.83%), Postives = 117/256 (45.70%), Query Frame = 2
Query: 1175 WGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGY-----CELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYA---FPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKE 1918
            W +  ++ E+AI         +A++I  P NP G+V TR+++  +     KHN++I++DEVY+   + ++ T I+      E+G      +TL   + ++       G+R G+      EL+++    KA    C ++    S + +   + + +  K G      FEK + + ++    K K+ +  F+ L G    + +G  +    F K+++P       + LN   DF     L+ + GV  +P + F  KE
Sbjct:  184 WTIDFEQFEKAITSKT-----KAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYFTDSFTRIATLSP--EIG-----QLTLT--VGSAGKSFAATGWRIGWVLSLNAELLSYAA--KAHTRICFAS---PSPLQEACANSINDALKIG-----YFEKMRQEYIN----KFKIFTSIFDEL-GLPYTAPEGTYFVLVDFSKVKIPEDYPYPEEILNKGKDFRISHWLINELGVVAIPPTEFYIKE 410          
BLAST of Alanine aminotransferase vs. Ensembl Nematostella
Match: EDO30450 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0S1])

HSP 1 Score: 562.762 bits (1449), Expect = 0.000e+0
Identity = 267/469 (56.93%), Postives = 350/469 (74.63%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQILSTQ-KDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +T  +MNP+ K++EYAVRG IV RA ELE EL++G   PFKEV+K NIGD HA+G KP+ F RQV AL   P + +DP+FPSDAK RA+RIL S  G S+G+YS S G+E IR+D  K+I ERDG P+  +DI+++NGASE I+SIL++L T   +G +RAGVMIPIPQYPLYSAT  E N++QI Y+L+E   W L   E+ RAINEA+  C PRA+ +INPGNPTGQVL+ ++I+ VIRF K+  L IMADEVYQ N+YAE+  F S KK L +MG EY + + LASF STSKG++GECGFRGGY E++  D EVK  L K LSA+LCS + GQ ++D +VN P+ G+ SY+ F KEK  VL+  K + +L+++TFNS+ G +CN   GAMY+FP +ELP K + AAK+     D FY + LLEQTG+CVVPG+GFGQK+GT+HFR+TILPP+EK++ + +  K+FH
Sbjct:   20 LTGGSMNPYVKQIEYAVRGAIVIRASELEKELQQGHEKPFKEVVKANIGDAHALGMKPLKFPRQVLALCVNPALLDDPSFPSDAKDRARRILNSTRGFSMGAYSDSVGLEAIREDVTKYIEERDGHPANIEDIYLTNGASEGIRSILKLLQTHVSEGNERAGVMIPIPQYPLYSATLLELNSHQINYYLDEANGWSLDIDEMRRAINEARKHCVPRALCVINPGNPTGQVLSYENIQQVIRFCKEEKLFIMADEVYQANVYAEDAKFHSFKKVLRDMGPEY-EDMELASFHSTSKGFLGECGFRGGYMEIVGLDPEVKFHLNKMLSAKLCSCITGQAMMDCLVNPPRPGDESYDEFTKEKEAVLASFKERAQLITKTFNSVEGIQCNESMGAMYSFPGLELPHKAVVAAKSRGLHPDSFYAMELLEQTGLCVVPGNGFGQKDGTYHFRLTILPPIEKLKPLFESFKDFH 487          

HSP 2 Score: 115.931 bits (289), Expect = 2.519e-27
Identity = 56/100 (56.00%), Postives = 72/100 (72.00%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV 577
            +T  +MNP+V+++EYAVRG IV RA ELE E+ QG   PFKEV+K NIGD HA+G KP+ F RQV AL   P L +DP+ P DAK+RA+ IL +  G S+
Sbjct:   20 LTGGSMNPYVKQIEYAVRGAIVIRASELEKELQQGHEKPFKEVVKANIGDAHALGMKPLKFPRQVLALCVNPALLDDPSFPSDAKDRARRILNSTRGFSM 119          
BLAST of Alanine aminotransferase vs. Ensembl Nematostella
Match: EDO35435 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLG7])

HSP 1 Score: 457.218 bits (1175), Expect = 1.453e-154
Identity = 231/481 (48.02%), Postives = 313/481 (65.07%), Query Frame = 2
Query:  563 GGSSVVSSQGPITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAM-GQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQILST-QKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            GGS V  S   IT + +NP  KR++Y +RGP+ QR+  +E EL +G++ PF EV+K +IGD   + GQKPITF+RQV  LL  P++  D  FPSD K+R + IL    GG+I SY+ S G++I+RQ  A FIS RDG P +  +I+++NG  EAI+ +L+ L T  ++G  RAGVMIPIP+YPLYS    E N YQI YFL ED  W L   EL+RA+N ++  C PRA+V+INPGNPTGQVLT ++I  VI+F  +  L++ ADEVYQ NIYA+   F S +K LH++G EY +   L S   ++K + GEC  RGGY +L  +D +VK+  +  ++   C ++ GQ  + +V   PK G+ SY L++KE+  +   +K K  + +   NSL G +CN+VQGAMYAFP++ LP K I AAK    T D  Y   LLE TG  V PGS  GQKEGT+HFRITI+PP+EK     +  K FH
Sbjct:    6 GGSGV--SAKIITSETINPAYKRIKYGLRGPLDQRSQVIEEELAQGQAKPFTEVVK-HIGDPQGLQGQKPITFMRQVLCLLTYPDLLQDERFPSDVKKRVREILSEKNGGTISSYTSSQGLKIVRQQIADFISTRDGYPEDLSNIYLTNGGGEAIRIVLKALMTADQEGPGRAGVMIPIPEYPLYSGRLLELNGYQIPYFLNEDDNWQLEMGELQRALNSSRPHCVPRALVLINPGNPTGQVLTYENIREVIKFCHRERLVLFADEVYQDNIYADGCAFHSCRKVLHDLGEEY-RDFQLVSLHCSAKSHFGECALRGGYYQLTGFDEDVKSFFHNRMTLYSCPNIYGQVAMGIVCQPPKPGDDSYALYDKERTAIQKSMKEKAGMTTRFLNSLAGIQCNTVQGAMYAFPRVLLPDKAIQAAKDQGLTPDSLYASELLEATGQFVAPGSVMGQKEGTYHFRITIIPPLEKTVHQYEQFKRFH 482          

HSP 2 Score: 94.7449 bits (234), Expect = 1.836e-20
Identity = 51/109 (46.79%), Postives = 69/109 (63.30%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAM-GQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGG---SSVVSSQG 592
            IT + +NP  +R++Y +RGP+ QR+  +E E+ QG+  PF EV+K +IGD   + GQKPITF+RQV  LL  P+L  D   P D K+R + IL    G   SS  SSQG
Sbjct:   15 ITSETINPAYKRIKYGLRGPLDQRSQVIEEELAQGQAKPFTEVVK-HIGDPQGLQGQKPITFMRQVLCLLTYPDLLQDERFPSDVKKRVREILSEKNGGTISSYTSSQG 122          
BLAST of Alanine aminotransferase vs. Ensembl Nematostella
Match: EDO40513 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6Z0])

HSP 1 Score: 92.4337 bits (228), Expect = 7.896e-20
Identity = 88/375 (23.47%), Postives = 171/375 (45.60%), Query Frame = 2
Query:  848 KQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYF-LEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARL-----CSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPP 1954
            K+  + I ES   G    Y+ S+G    ++  AK+ S R     E++D+ +++G S A++  + +L    D      ++IP+P + +Y  T +    Y++ ++ L  ++ W +  + +E  I+        RAI++ +P NP G V  ++ +E +I  A+KH L I++DEVY   +++  +TF  M        A  +K+V + +  + SK ++   G+R G+  + + +G  + ++   L+A        ++VI   + D++   P         +E   N     ++   KLV E    +PG       GAMY    I++       ++  +   D  +   L+ +  V  +P   F       +FRI +  P
Sbjct:   63 KEAVEAITESAKSGKNNGYAPSSGYLKSKEAIAKYCS-RPNAEVEAKDVVITSGCSHALEMAISVLLNPGDN-----LLIPLPGFSIYQ-TASISKGYEVRHYNLLPEKSWEVDLEHMESMIDS-----RTRAILVNSPSNPCGSVYNKEHLEAIIAVAEKHMLPIISDEVYADVVFS-GQTFYPM--------ASLSKNVPILTCGAVSKRFLAP-GWRVGWVLIHDRNGAFEDEVRPGLTALSTILLGANTVIQAALPDILAKTPDS------FYENAINV----MQTNAKLVYEELCRIPGLTPIMPCGAMYMMVGIDI-------SQFPDIKDDVDFTEKLVAEQSVFCLPAKCFHYPN---YFRIVLTTP 395          
BLAST of Alanine aminotransferase vs. Ensembl Nematostella
Match: EDO32652 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUH9])

HSP 1 Score: 59.3066 bits (142), Expect = 2.914e-9
Identity = 49/208 (23.56%), Postives = 102/208 (49.04%), Query Frame = 2
Query:  974 PSESQD---IFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSAT---NAEYNAYQIGYFLE------EDQFWGLSEKELERAINEAKDK-CHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELIN-WDGEVKAQL 1555
            P+E+ D   + V NG +  ++++  +L+   DG     ++IP P Y  ++A     A+   + +  +L       E+  + LS   LE A+++AK +    R I++ NP NP G + + + ++  + FA KH L ++ DE+Y  +++ +  +F S+            K++     +    G+  + G  G  C +++ W+ +V++ L
Sbjct:   97 PAETIDPNNLLVQNGCATVVEALGTVLADPGDG-----ILIPAPYYGGFNADLCQRAQVVPFPV--YLSSKPGPGENGPFQLSVWRLEDALDKAKKQGVTIRGILLTNPNNPVGNIYSDELLQDCLDFAHKHKLHVIFDEIYMLSVFKKEYSFKSILSF---------KNIPDRERLHVIWGFSKDFGVSGFRCGVLHTWNKKVQSSL 288          
BLAST of Alanine aminotransferase vs. Ensembl Nematostella
Match: EDO34101 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQB8])

HSP 1 Score: 53.5286 bits (127), Expect = 2.152e-7
Identity = 21/55 (38.18%), Postives = 37/55 (67.27%), Query Frame = 2
Query: 1214 EAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYA 1378
            E+K     +A+VI  P NP G+V +R ++EM+     +HN+L ++DEVY++ +Y+
Sbjct:  174 ESKFSSKTKAMVINTPNNPLGKVFSRSELEMIANLCIRHNILCISDEVYEWLVYS 228          
BLAST of Alanine aminotransferase vs. Ensembl Medaka
Match: si:ch211-217a12.1 (alanine aminotransferase 2-like [Source:NCBI gene;Acc:101168997])

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 281/470 (59.79%), Postives = 352/470 (74.89%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFHL 2002
            +T+D+MNP+ +R+EYAVRGPIVQRA+++E EL++G   PF EVIK NIGD HAMGQKPITF RQV AL + P++  D  FP DAK+RA+RIL++CGG SIG+YS S G+E IRQD A++I +RDG IPS   +I++S GAS+AI ++L++L    +G+DR GVMI IPQYPLYSA  A+  A QI Y+L+ED+ WGL   EL RA+N AK  C PR + IINPGNPTGQV +R+ IE VIRFAK+ NL +MADEVYQ N+YA+   F S KK L EMG EY+ S+ +ASF STSK YMGECGFRGGY E++N D EVKAQL K +S RLC  V GQ +LD+VVN P   EPSY  + KE+  VL+ L  K  L  E FN++PG  CN VQGAMY FP+I LP K IA A+      D  YC+ LLE+ G+C+VPGSGFGQKEGTFHFR+TILPP EK++ V++ I++FHL
Sbjct:   16 LTLDSMNPNVRRVEYAVRGPIVQRAVQIEKELREGVKKPFTEVIKANIGDAHAMGQKPITFFRQVLALCSYPDLLEDNKFPEDAKKRARRILDACGGHSIGAYSASQGIECIRQDVARYIEKRDGGIPSNPDNIYLSTGASDAIVTMLKLLVC-GEGRDRTGVMISIPQYPLYSAALADLGAVQINYYLDEDKCWGLDVTELRRALNAAKQHCKPRVLCIINPGNPTGQVQSRECIEDVIRFAKEENLFLMADEVYQDNVYAKGCKFHSFKKVLFEMGPEYSSSLEMASFHSTSKCYMGECGFRGGYMEVLNMDPEVKAQLTKLVSVRLCPPVSGQAMLDLVVNPPLPDEPSYASYVKERTAVLAALAEKSHLTEEMFNTVPGITCNPVQGAMYTFPRITLPQKAIAKAQEEGQAPDMLYCMKLLEEEGICLVPGSGFGQKEGTFHFRMTILPPTEKLKVVLQKIRDFHL 484          

HSP 2 Score: 137.117 bits (344), Expect = 7.054e-34
Identity = 66/108 (61.11%), Postives = 82/108 (75.93%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV---VSSQG 592
            +T+D+MNP+VRR+EYAVRGPIVQRA+++E E+ +G   PF EVIK NIGD HAMGQKPITF RQV AL + P+L  D   P DAK+RA+ IL  CGG S+    +SQG
Sbjct:   16 LTLDSMNPNVRRVEYAVRGPIVQRAVQIEKELREGVKKPFTEVIKANIGDAHAMGQKPITFFRQVLALCSYPDLLEDNKFPEDAKKRARRILDACGGHSIGAYSASQG 123          
BLAST of Alanine aminotransferase vs. Ensembl Medaka
Match: gpt2l (alanine aminotransferase 2-like [Source:NCBI gene;Acc:101161270])

HSP 1 Score: 570.852 bits (1470), Expect = 0.000e+0
Identity = 275/469 (58.64%), Postives = 345/469 (73.56%), Query Frame = 2
Query:  596 ITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            +TIDNMNP  K++EYAVRGPIVQRA+ELE EL +G   PF EVIK NIGD HAMGQ+PITF RQV AL + PE+ +D  FP DAK RA+RIL SCGG S+G+YS S G+E +RQD A +I  RDG +P +  +I+++ GAS+ I ++L++L    +G  RAGVMI IPQYPLYSA  AE  A QI Y+L E++ W L   EL+RA+NEA+  C+PRA+ IINPGNPTGQV +R  IE VIRFA +  L +MADEVYQ N+YAE   F S KK L EMG EY+++V LASF STSK YMGECGFRGGY E+IN D EVKAQL K LS RLC  V GQ ++D+VVN P+ GEPSYE F  E+   LS L  K KL  +  N++ G +CN VQGAMY+FP+I +P K I  A       D FYC+ +LE+TG+C+VPGSGFGQK+GT+HFR+TILPP +K++ ++  ++EFH
Sbjct:   40 LTIDNMNPTVKKVEYAVRGPIVQRAVELERELSEGMKKPFAEVIKANIGDAHAMGQQPITFFRQVLALCSYPELLSDSIFPEDAKNRARRILNSCGGNSMGAYSASQGIESVRQDVALYIERRDGGVPCDPDNIYLTTGASDGIVTMLKLLVC-GEGAARAGVMISIPQYPLYSAALAELGAVQINYYLNEEKCWSLDISELQRALNEARRYCNPRALCIINPGNPTGQVQSRQCIEDVIRFAARERLFLMADEVYQDNVYAEGCQFHSFKKVLFEMGPEYSETVELASFHSTSKCYMGECGFRGGYMEIINMDEEVKAQLTKLLSVRLCPPVPGQALMDLVVNPPQPGEPSYERFISERTATLSALAEKAKLTEQVLNTVDGIRCNPVQGAMYSFPRIAIPEKAIKEATENGQQPDMFYCMKMLEETGICLVPGSGFGQKDGTYHFRMTILPPRDKLKILLNKVQEFH 507          

HSP 2 Score: 139.043 bits (349), Expect = 1.791e-34
Identity = 68/108 (62.96%), Postives = 84/108 (77.78%), Query Frame = 2
Query:  278 ITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV---VSSQG 592
            +TIDNMNP V+++EYAVRGPIVQRA+ELE E+++G   PF EVIK NIGD HAMGQ+PITF RQV AL + PEL +D   P DAK RA+ IL +CGG+S+    +SQG
Sbjct:   40 LTIDNMNPTVKKVEYAVRGPIVQRAVELERELSEGMKKPFAEVIKANIGDAHAMGQQPITFFRQVLALCSYPELLSDSIFPEDAKNRARRILNSCGGNSMGAYSASQG 147          
BLAST of Alanine aminotransferase vs. Ensembl Medaka
Match: ENSORLT00000021621.2 (alanine aminotransferase 2 [Source:NCBI gene;Acc:101172281])

HSP 1 Score: 374.015 bits (959), Expect = 6.957e-122
Identity = 193/459 (42.05%), Postives = 274/459 (59.69%), Query Frame = 2
Query:  626 KRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDG-IPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            K LEY++   + +   +++ +L++G   PFKEVI  + GD H  G KP+TF+RQV A    P++ N    P D +QRA+++L+ C G S+GSYS + G+  I Q  ++FIS RDG + S  ++IF+  G+  A+  IL +L    +     GV+ P P Y   + +        + Y+L E++ W L  +EL RA+   K  CHP A+ +INPGNP GQV +R  ++ VIRFA +  L ++ADEVYQ  IY E + F+S K+ L EMG   + +V LASF S SKG+MGECG RGGY EL+N D  VK  +Y    A     V+GQ  LD++ N P+ G+PSY L+ +E   + S +    K   E  NSL GF C +V+G  +AFP+I LP K I  AK      D FYCL LLE+ GV   PGS +GQ+EGTFH R  IL P + +  +++ + +FH
Sbjct:   15 KTLEYSL---LARWTKQIKEDLRQGVKKPFKEVIDVSWGDPHRGGVKPLTFVRQVLAACLYPQLMNGEKLPVDVRQRAQKLLDGCAGWSVGSYSATGGLPEIVQRVSEFISRRDGGVQSNPENIFLCCGSQWALTRILNVL-VNAEAPYPTGVLTPAPCYSTTTLSIEGLGGVVVPYYLSEERGWELQVEELHRALESCKGACHPIALYVINPGNPAGQVQSRKSMQEVIRFASEKRLFLLADEVYQGCIYGE-KEFVSYKRVLSEMGPPLSDTVELASFHSASKGFMGECGLRGGYVELVNLDPAVKKYIYTLFCADSSPPVLGQIALDLMTNPPQPGDPSYLLYYQETQHIRSTVVKNVKKACEVINSLQGFSCQAVEGGAFAFPRIHLPAKAIQKAKEAGMQPDTFYCLRLLEEAGVLASPGSDYGQEEGTFHIRFCILLPHDVLGELLQRLSDFH 468          

HSP 2 Score: 74.7146 bits (182), Expect = 1.289e-13
Identity = 37/94 (39.36%), Postives = 57/94 (60.64%), Query Frame = 2
Query:  302 HVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVS 583
            +++ LEY++   + +   +++ ++ QG   PFKEVI  + GD H  G KP+TF+RQV A    P+L N   +P D ++RAQ +L  C G SV S
Sbjct:   13 NMKTLEYSL---LARWTKQIKEDLRQGVKKPFKEVIDVSWGDPHRGGVKPLTFVRQVLAACLYPQLMNGEKLPVDVRQRAQKLLDGCAGWSVGS 103          
BLAST of Alanine aminotransferase vs. Ensembl Medaka
Match: ENSORLT00000016290.2 (alanine aminotransferase 2 [Source:NCBI gene;Acc:105353973])

HSP 1 Score: 315.849 bits (808), Expect = 3.797e-99
Identity = 164/472 (34.75%), Postives = 260/472 (55.08%), Query Frame = 2
Query:  599 TIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERD-GIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQ---KEGTFHFRITILPPVEKMQTVMKLIKEFHL 2002
            ++D +NP  + +  + +  +   A ++   + +G   P K VI  + GD H  G KP++F+RQV A+   P +  D  FP D K RA+R+L+ C G S+GSY+ S+G+  IRQ  A FI++RD GI +  +++F+S+GA  A+  ++++LS+  +G+ + G++ P P          E     + Y L E++ W L   +L +A++ ++  C+PRA+ I NPGNPTG V  R  I+ VI+ A    LL++ DEVYQ ++Y +N  F+S KK L EMG E++++V L SF S S   + ECG R GY E +N D +V       L   + +   GQ  LD+++N P  GEPSY+   +E     + L    +   E  N LPGF C    G +Y +P ++LP  +   A+ L   AD FYC    ++     +   G GQ   + G+ HFR+ +L P   ++  +  +  FHL
Sbjct:    4 SLDYVNPRVRAIRVSTQSFLQNLAHQITQNMTQGGQKPLKGVIDLSSGDPHRAGMKPVSFVRQVLAVCLYPHLLQDTIFPLDVKLRAQRLLQICEGQSLGSYTASSGLHHIRQTIADFITKRDTGISANPRNVFISSGAQRALMVVVKLLSS-GEGQTQTGILAPQPCPHTLPPLLDEAGVLAVPYRLMEERGWALDLNQLRQALDSSRGGCNPRAVYISNPGNPTGHVQDRKSIQEVIQLATAEKLLLLVDEVYQDSVYGQNTEFLSYKKVLFEMGQEFSETVELVSFHSLSCASVAECGLRAGYMEAVNIDPDVMKVFDTMLCTDISAPTTGQLALDLMLNPPGPGEPSYDTHAQELLLTRTVLTRNAQRALEVLNDLPGFSCQPAMGGIYLYPSVKLPAGIREQAEMLGLGADVFYC----QKLLEEELLLLGAGQYSGEAGSHHFRLCVLVPTNVLEDALHRLSAFHL 470          

HSP 2 Score: 72.7886 bits (177), Expect = 5.903e-13
Identity = 38/101 (37.62%), Postives = 54/101 (53.47%), Query Frame = 2
Query:  281 TIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVS 583
            ++D +NP VR +  + +  +   A ++   M QG   P K VI  + GD H  G KP++F+RQV A+   P L  D   P D K RAQ +L  C G S+ S
Sbjct:    4 SLDYVNPRVRAIRVSTQSFLQNLAHQITQNMTQGGQKPLKGVIDLSSGDPHRAGMKPVSFVRQVLAVCLYPHLLQDTIFPLDVKLRAQRLLQICEGQSLGS 104          
BLAST of Alanine aminotransferase vs. Ensembl Medaka
Match: tat (tyrosine aminotransferase [Source:NCBI gene;Acc:101171329])

HSP 1 Score: 84.7297 bits (208), Expect = 7.382e-17
Identity = 84/359 (23.40%), Postives = 158/359 (44.01%), Query Frame = 2
Query:  902 YSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELIN----WDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKM 1966
            Y+ S G    RQ  A F S     P E++D+ +++G S+AI+  + +L    D      +++P P + LY             Y L  D+ W +  + LE  I+E +  C    +++ NP NP G V +++ ++ +++ A K+ + I+ADE+Y   ++    +      +L  + ++    V + S    +K ++   G+R G+  + +    +  +++  L K     L +  I QG L+ ++N      P     +   N  +S LK+  ++     + +PG       GAMY    I++           ++T D  +   L+ +  V  +P S F   E    FRI +  P E M
Sbjct:  130 YAPSVGYLKSRQAVANFYSIPQA-PLEAEDVILTSGCSQAIELAINVLCNPGDN-----ILVPCPGFSLYKTLAVSVGIEVKLYNLLPDKSWEIDLQHLESMIDE-RTSC----LIVTNPSNPCGSVFSKEHLQKILKVASKYCVPILADEIYSDMVFPGCSS-----PSLACLSSD----VPILSCGGLAKRWLVP-GWRLGWILIHDRNDIFGSKIRQGLVKLSQRILGACTIVQGALESILN----NTP-----QSFYNNTISFLKSNSEICYNQLSLVPGLNPVMPSGAMYLMVGIDM-------DHFPDFTNDVDFTERLVTEQSVFCLPASAF---EYPNFFRIVVTVPEELM 448          
BLAST of Alanine aminotransferase vs. Planmine SMEST
Match: SMESG000007248.1 (SMESG000007248.1)

HSP 1 Score: 964.14 bits (2491), Expect = 0.000e+0
Identity = 464/464 (100.00%), Postives = 464/464 (100.00%), Query Frame = 2
Query:  611 MNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFHL 2002
            MNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFHL
Sbjct:    1 MNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFHL 464          

HSP 2 Score: 173.326 bits (438), Expect = 9.784e-47
Identity = 78/97 (80.41%), Postives = 88/97 (90.72%), Query Frame = 2
Query:  293 MNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVS 583
            MNPH +RLEYAVRGPIVQRA+ELENE+ +GK+ PFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPE+QNDPN P DAK+RA+ IL +CGG S+ S
Sbjct:    1 MNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGS 97          
BLAST of Alanine aminotransferase vs. Planmine SMEST
Match: SMESG000007253.1 (SMESG000007253.1)

HSP 1 Score: 885.174 bits (2286), Expect = 0.000e+0
Identity = 417/464 (89.87%), Postives = 445/464 (95.91%), Query Frame = 2
Query:  611 MNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFHL 2002
            MNPH +RLEYAVRGPIVQRA+ELENE+ +GK+ PFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPE+QNDPN P DAK+RA+ IL +CGG S+GSYS STGVE++RQ C++FI+ERD IPS+ Q+IF++ GASEAIKS+LQILS+QK+G++RAGVM+PIPQYPLYSATNAEYNAYQIGYFL+E   WGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCEL+NWDGEVKAQLYKCLSARLCSSVIGQGILDVVVN PKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCN VQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILP VEKMQTVMKLIKEFH+
Sbjct:    1 MNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVGSYSASTGVELVRQHCSRFITERDRIPSDPQNIFLTTGASEAIKSVLQILSSQKEGRERAGVMVPIPQYPLYSATNAEYNAYQIGYFLDEANCWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELVNWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNSPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNPVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPSVEKMQTVMKLIKEFHV 464          

HSP 2 Score: 208.379 bits (529), Expect = 2.773e-59
Identity = 98/114 (85.96%), Postives = 101/114 (88.60%), Query Frame = 2
Query:  293 MNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVSSQGPITIDNMNPHAKRL 634
            MNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV S      ++ +  H  R 
Sbjct:    1 MNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVGSYSASTGVELVRQHCSRF 114          
BLAST of Alanine aminotransferase vs. Planmine SMEST
Match: SMESG000007253.1 (SMESG000007253.1)

HSP 1 Score: 762.296 bits (1967), Expect = 0.000e+0
Identity = 359/404 (88.86%), Postives = 386/404 (95.54%), Query Frame = 2
Query:  611 MNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAK 1822
            MNPH +RLEYAVRGPIVQRA+ELENE+ +GK+ PFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPE+QNDPN P DAK+RA+ IL +CGG S+GSYS STGVE++RQ C++FI+ERD IPS+ Q+IF++ GASEAIKS+LQILS+QK+G++RAGVM+PIPQYPLYSATNAEYNAYQIGYFL+E   WGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCEL+NWDGEVKAQLYKCLSARLCSSVIGQGILDVVVN PKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCN VQGAMYAFPKIELPPKVIAAAK
Sbjct:    1 MNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVGSYSASTGVELVRQHCSRFITERDRIPSDPQNIFLTTGASEAIKSVLQILSSQKEGRERAGVMVPIPQYPLYSATNAEYNAYQIGYFLDEANCWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELVNWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNSPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNPVQGAMYAFPKIELPPKVIAAAK 404          

HSP 2 Score: 207.608 bits (527), Expect = 7.807e-60
Identity = 98/114 (85.96%), Postives = 101/114 (88.60%), Query Frame = 2
Query:  293 MNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVSSQGPITIDNMNPHAKRL 634
            MNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSV S      ++ +  H  R 
Sbjct:    1 MNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVGSYSASTGVELVRQHCSRF 114          
BLAST of Alanine aminotransferase vs. Planmine SMEST
Match: SMESG000009990.1 (SMESG000009990.1)

HSP 1 Score: 704.131 bits (1816), Expect = 0.000e+0
Identity = 330/490 (67.35%), Postives = 396/490 (80.82%), Query Frame = 2
Query:  551 LGNCGGSSVVSSQ-------GPITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEFH 1999
            L +C    ++SS+         + I+NMNP+ K LEYAVRGPIV +A ELE  L   +  PF EVIKCNIGDCHAMGQKP+TF+RQV AL  +PE+ N   FP+DAK RAKR+LESCGG S+GSYSQSTGVEI+R+D A FIS+RDGI   S DIF+S GASEAIK +LQ+++TQ  GKD+AG+M+PIPQYPLYSATNAEYNAYQIGY+L E+  WG++  ELERAINEA + C PRAIVIINPGNPTGQVLT DDI+MVI+FA KH+LLIMADEVYQFN+YA +R+F+S KKALH+MG EY KS+ +ASFMS SKG+MGECGFRGGYCEL+N+  +V+AQLYKC+SARLCSSV GQ +++ +VN P+ GEPSYELFEKEK +VLSDLK KG+LV+ET N +PGF CN+VQGAMYAFP++ELP   I  A+ L   ADFFYC  LLE+TGVCVVPGSGF Q   T+HFR+TILP V+KM+ VM  IK FH
Sbjct:    7 LKSCSIEKIISSKISTMAILNSLNINNMNPNIKNLEYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGSYSQSTGVEIVRKDIASFISKRDGIACNSNDIFLSTGASEAIKVVLQMMATQSHGKDKAGIMVPIPQYPLYSATNAEYNAYQIGYYLSEENNWGINLSELERAINEASNHCIPRAIVIINPGNPTGQVLTADDIKMVIKFAYKHDLLIMADEVYQFNVYAPDRSFLSFKKALHDMGDEY-KSIQIASFMSASKGFMGECGFRGGYCELVNFPDDVQAQLYKCISARLCSSVAGQAMVEAIVNPPRPGEPSYELFEKEKAQVLSDLKLKGQLVTETLNQMPGFHCNAVQGAMYAFPRLELPASAIKEARKLKQAADFFYCSRLLEETGVCVVPGSGFAQVPDTYHFRMTILPSVDKMKIVMDRIKHFH 495          

HSP 2 Score: 138.658 bits (348), Expect = 1.713e-34
Identity = 63/105 (60.00%), Postives = 78/105 (74.29%), Query Frame = 2
Query:  269 LGPITIDNMNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMGQKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVS 583
            L  + I+NMNP+++ LEYAVRGPIV +A ELE  +   +  PF EVIKCNIGDCHAMGQKP+TF+RQV AL  +PEL N    P DAK RA+ +L +CGG+SV S
Sbjct:   26 LNSLNINNMNPNIKNLEYAVRGPIVIKAQELEKRLINNEKLPFDEVIKCNIGDCHAMGQKPLTFLRQVVALTVLPELINSKKFPADAKHRAKRVLESCGGNSVGS 130          
BLAST of Alanine aminotransferase vs. Planmine SMEST
Match: SMESG000035843.1 (SMESG000035843.1)

HSP 1 Score: 93.5893 bits (231), Expect = 7.026e-20
Identity = 96/386 (24.87%), Postives = 168/386 (43.52%), Query Frame = 2
Query:  866 ILESCGGGSIGSYSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQILSTQKDGKDRAGVMIPIPQYPLYS----ATNAEYNAYQIGYFLEEDQFWGLSEKELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLIMADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGECGFRGGYCELINWD-----GEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGEPSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIELPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRITILPPVEKMQTVMKLIKEF 1996
            ++ES   G    Y+ +TG    R   AK+ S        S+D+ +++G S A++  + +L+          ++IP P +P+Y     AT  E   Y +   L E + W +  + LE  I+         AI+I NP NP G V +RD +  +++ A+ ++L I+ADE+Y         +F +      E  A  N  V + S    +K ++   G+R G+  ++ +D      EV+  L    +  + ++ I QG L  ++         + + E      +  +K    +V   F+  PG      +GAMYA  ++ L        KA     DF   +N++++  V  +P   FG      +FRI +  P E M    + IK +
Sbjct:   86 VVESVRSGKYNGYAPATGYVEARSAVAKY-SMCSNYNLSSEDVIITSGCSSALEHCILVLANPGQN-----ILIPRPGFPIYHTLCHATGIETKYYNL---LPEKE-WQVDIEHLENQIDN-----DTVAILINNPSNPCGSVYSRDHLIEILKVAECYSLPIIADEIY---------SFFTFNGLDFEFMASLNDKVPVLSCNGLTKRFLCP-GWRLGW--IVIYDKYKRFTEVRQGLSDLATRTIGANTIVQGALPQIL---------FGVSEDHFESTIRIIKENFDIVESVFSKTPGLNLVKPKGAMYAMVEVRL-----ENFKAFKANEDFI--INMVKEESVFCLPSEPFGISN---YFRILLTLPPEVMIEACERIKSY 425          
The following BLAST results are available for this feature:
BLAST of Alanine aminotransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GPT23.598e-2856.81glutamic--pyruvic transaminase 2 [Source:HGNC Symb... [more]
GPT3.217e-3456.29glutamic--pyruvic transaminase [Source:HGNC Symbol... [more]
GPT3.217e-3456.29glutamic--pyruvic transaminase [Source:HGNC Symbol... [more]
GPT24.096e-17356.83glutamic--pyruvic transaminase 2 [Source:HGNC Symb... [more]
GPT21.827e-6153.37glutamic--pyruvic transaminase 2 [Source:HGNC Symb... [more]
back to top
BLAST of Alanine aminotransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C32F10.88.518e-2853.24pep chromosome:WBcel235:I:5822841:5825231:-1 gene:... [more]
C32F10.88.518e-2853.24pep chromosome:WBcel235:I:5822841:5826147:-1 gene:... [more]
C32F10.88.518e-2853.24pep chromosome:WBcel235:I:5822841:5825074:-1 gene:... [more]
C32F10.88.518e-2853.24pep chromosome:WBcel235:I:5822841:5826148:-1 gene:... [more]
C32F10.88.448e-11854.74pep chromosome:WBcel235:I:5823081:5825231:-1 gene:... [more]
back to top
BLAST of Alanine aminotransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG16403.730e-2752.74gene:FBgn0030478 transcript:FBtr0073770[more]
CG16404.007e-2752.74gene:FBgn0030478 transcript:FBtr0073769[more]
CG16403.730e-2752.74gene:FBgn0030478 transcript:FBtr0073773[more]
CG16403.730e-2752.74gene:FBgn0030478 transcript:FBtr0073774[more]
CG16403.730e-2752.74gene:FBgn0030478 transcript:FBtr0073771[more]
back to top
BLAST of Alanine aminotransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-217a12.12.574e-3458.64si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214... [more]
si:ch211-217a12.12.574e-3458.64si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214... [more]
gpt21.447e-3057.87glutamic pyruvate transaminase (alanine aminotrans... [more]
gpt2l1.450e-3157.36glutamic pyruvate transaminase (alanine aminotrans... [more]
gpt2l9.967e-4760.83glutamic pyruvate transaminase (alanine aminotrans... [more]
back to top
BLAST of Alanine aminotransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpt2.850e-3155.58glutamic-pyruvate transaminase (alanine aminotrans... [more]
gpt2.579e-3158.21glutamic-pyruvate transaminase (alanine aminotrans... [more]
gpt2.092e-3158.21glutamic-pyruvate transaminase (alanine aminotrans... [more]
gpt2.531e-3158.00glutamic-pyruvate transaminase (alanine aminotrans... [more]
gpt2.284e-3158.21glutamic-pyruvate transaminase (alanine aminotrans... [more]
back to top
BLAST of Alanine aminotransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gpt24.941e-3056.72glutamic pyruvate transaminase (alanine aminotrans... [more]
Gpt4.920e-3356.08glutamic pyruvic transaminase, soluble [Source:MGI... [more]
Gpt4.920e-3356.08glutamic pyruvic transaminase, soluble [Source:MGI... [more]
Gpt2.376e-12552.78glutamic pyruvic transaminase, soluble [Source:MGI... [more]
Gpt9.344e-9455.79glutamic pyruvic transaminase, soluble [Source:MGI... [more]
back to top
BLAST of Alanine aminotransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4IFH5|ALAT1_BOVIN9.266e-3356.72Alanine aminotransferase 1 OS=Bos taurus OX=9913 G... [more]
sp|Q28DB5|ALAT2_XENTR1.507e-3058.21Alanine aminotransferase 2 OS=Xenopus tropicalis O... [more]
sp|Q6GM82|ALAT2_XENLA7.551e-3158.00Alanine aminotransferase 2 OS=Xenopus laevis OX=83... [more]
sp|Q8BGT5|ALAT2_MOUSE3.456e-2956.72Alanine aminotransferase 2 OS=Mus musculus OX=1009... [more]
sp|Q8QZR5|ALAT1_MOUSE3.442e-3256.08Alanine aminotransferase 1 OS=Mus musculus OX=1009... [more]
back to top
BLAST of Alanine aminotransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4AU382.137e-3365.03Aminotran_1_2 domain-containing protein OS=Lottia ... [more]
A0A267GX421.680e-3063.46Aminotran_1_2 domain-containing protein (Fragment)... [more]
A0A1I8GXV61.351e-3063.46Aminotran_1_2 domain-containing protein OS=Macrost... [more]
A0A267GCT91.277e-3063.25Aminotran_1_2 domain-containing protein OS=Macrost... [more]
A0A1I8HB541.579e-17963.25Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Alanine aminotransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-217a12.16.183e-3358.85si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214... [more]
gpt24.651e-3057.02glutamic--pyruvic transaminase 2 [Source:NCBI gene... [more]
gpt2l1.325e-3254.91alanine aminotransferase 2-like [Source:NCBI gene;... [more]
si:ch211-217a12.18.523e-3456.81si:ch211-217a12.1 [Source:ZFIN;Acc:ZDB-GENE-121214... [more]
gpt24.485e-3057.87glutamic--pyruvic transaminase 2 [Source:NCBI gene... [more]
back to top
BLAST of Alanine aminotransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gpt27.088e-9454.88glutamic pyruvate transaminase (alanine aminotrans... [more]
ENSPMAT00000003702.11.041e-1224.86pep scaffold:Pmarinus_7.0:GL476611:173756:192777:1... [more]
back to top
BLAST of Alanine aminotransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
ALT29.592e-12743.18Catalytically inactive alanine transaminase; expre... [more]
ALT11.723e-12243.57Alanine transaminase (glutamic pyruvic transaminas... [more]
BNA34.698e-1023.83Kynurenine aminotransferase; catalyzes formation o... [more]
back to top
BLAST of Alanine aminotransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO304502.519e-2756.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354351.453e-15448.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405137.896e-2023.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326522.914e-923.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO341012.152e-738.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Alanine aminotransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-217a12.17.054e-3459.79alanine aminotransferase 2-like [Source:NCBI gene;... [more]
gpt2l1.791e-3458.64alanine aminotransferase 2-like [Source:NCBI gene;... [more]
ENSORLT00000021621.26.957e-12242.05alanine aminotransferase 2 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000016290.23.797e-9934.75alanine aminotransferase 2 [Source:NCBI gene;Acc:1... [more]
tat7.382e-1723.40tyrosine aminotransferase [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Alanine aminotransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000007248.19.784e-47100.00SMESG000007248.1[more]
SMESG000007253.12.773e-5989.87SMESG000007253.1[more]
SMESG000007253.17.807e-6088.86SMESG000007253.1[more]
SMESG000009990.11.713e-3467.35SMESG000009990.1[more]
SMESG000035843.17.026e-2024.87SMESG000035843.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021348 ID=SMED30021348|Name=Alanine aminotransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=2198bp
CCTCATTTAAGTATTAGGCGCTTCATAATGCCATTTTGCCGAGACGTTCC
CCTATCACTGTCATAATGACAAAAAATAAAACAGCAACAGATATTGAGAT
ATTATTTGTAAAAATACATTTAGACTTCAATTTCAAATAATACAAAATAA
AATATTTGAAAAAAGTATGAAATGGATATGGCAGATGCAATTGCTTATTG
TTTTACCTGAATAAAGGCGCGACCAAAACGGTGCAGTTTTATAAAAGGAA
AAATAACCAGTGTCAAATCTCGGTCCAATTACAATTGACAATATGAATCC
TCACGTGAGACGATTGGAGTACGCCGTTCGAGGTCCGATTGTTCAACGGG
CAATGGAACTGGAAAATGAAATGAATCAAGGAAAAACTTTCCCATTCAAA
GAAGTAATCAAATGCAACATCGGAGATTGTCATGCTATGGGGCAGAAACC
GATCACATTCATCAGGCAGGTTGCGGCTCTTTTGGCAATGCCAGAATTGC
AGAATGATCCAAATATTCCTCGGGATGCCAAAGAAAGAGCTCAAAGCATT
TTAGGTAATTGTGGTGGATCAAGCGTAGTGTCTAGTCAAGGCCCAATTAC
AATCGATAATATGAATCCCCATGCTAAGCGTTTGGAATATGCAGTTCGAG
GTCCTATTGTCCAAAGGGCGTTAGAATTAGAAAATGAATTGAAAAAAGGT
AAATCTCATCCTTTCAAAGAGGTAATTAAATGTAATATTGGTGATTGTCA
TGCAATGGGCCAGAAGCCTATTACTTTCATTCGCCAAGTAGCTGCTTTGT
TAGCAATGCCAGAAATGCAAAACGATCCAAATTTCCCTTCTGATGCTAAA
CAAAGAGCTAAAAGAATTTTAGAATCATGTGGTGGAGGAAGCATTGGTTC
ATATAGTCAGTCGACTGGGGTTGAAATCATCCGTCAAGATTGTGCAAAAT
TTATTAGTGAAAGAGACGGTATTCCAAGTGAATCTCAGGACATATTTGTG
TCTAATGGAGCCAGCGAGGCTATTAAATCTATATTACAAATATTGTCAAC
ACAAAAAGATGGCAAAGATCGTGCGGGCGTAATGATACCGATACCTCAAT
ATCCACTTTATTCCGCTACCAATGCAGAATATAATGCATATCAAATCGGT
TACTTTCTCGAAGAAGATCAATTTTGGGGACTTAGTGAAAAAGAATTAGA
GCGAGCAATAAACGAGGCGAAAGATAAATGCCACCCAAGAGCAATAGTGA
TAATAAATCCAGGAAATCCAACTGGTCAAGTTCTTACTCGTGATGATATA
GAAATGGTGATAAGATTTGCTAAAAAGCATAATTTATTAATAATGGCTGA
TGAAGTTTATCAATTCAATATTTACGCAGAAAATCGGACTTTTATCAGCA
TGAAGAAAGCGCTCCATGAAATGGGAGCGGAATACAATAAAAGTGTAACA
CTTGCCTCATTTATGAGCACTAGCAAAGGATATATGGGAGAATGCGGATT
TCGTGGTGGATATTGTGAGTTGATTAACTGGGATGGAGAAGTGAAAGCTC
AGTTGTATAAATGCCTGAGTGCAAGACTTTGCAGTTCAGTAATAGGCCAA
GGAATACTTGATGTCGTTGTCAATTGTCCGAAAAAAGGTGAACCATCATA
CGAATTATTTGAGAAAGAAAAGAATAAAGTTTTGTCTGATTTGAAGGCGA
AAGGAAAACTCGTTTCAGAGACTTTCAATTCTCTGCCAGGTTTTAAGTGC
AATTCTGTCCAAGGTGCAATGTACGCCTTTCCAAAGATTGAGTTGCCTCC
GAAAGTCATTGCAGCAGCAAAGGCGCTTAATTATACTGCTGATTTTTTCT
ACTGTTTGAATTTGTTGGAACAAACCGGAGTTTGTGTGGTTCCCGGATCC
GGATTCGGGCAGAAGGAGGGCACCTTTCATTTTAGAATCACGATTTTGCC
CCCTGTCGAGAAAATGCAAACCGTGATGAAATTAATCAAAGAATTTCACT
TGAAATTCATGGAAAAATATAAATAAATTTTCAAATATTATTACGCCTAA
TTTCTATCCACTTAGCATGATATTTATATATTTACTGTCCTCGTTAGAAT
AAAATATTTTTTGAACTGACAAACATTATATTAAAACACTACAAAAAATA
TTTTATTCTAACGAGGACAGTAAATATATAAATATCATGCTAAGTGGA
back to top

protein sequence of SMED30021348-orf-1

>SMED30021348-orf-1 ID=SMED30021348-orf-1|Name=SMED30021348-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=578bp
MNPHVRRLEYAVRGPIVQRAMELENEMNQGKTFPFKEVIKCNIGDCHAMG
QKPITFIRQVAALLAMPELQNDPNIPRDAKERAQSILGNCGGSSVVSSQG
PITIDNMNPHAKRLEYAVRGPIVQRALELENELKKGKSHPFKEVIKCNIG
DCHAMGQKPITFIRQVAALLAMPEMQNDPNFPSDAKQRAKRILESCGGGS
IGSYSQSTGVEIIRQDCAKFISERDGIPSESQDIFVSNGASEAIKSILQI
LSTQKDGKDRAGVMIPIPQYPLYSATNAEYNAYQIGYFLEEDQFWGLSEK
ELERAINEAKDKCHPRAIVIINPGNPTGQVLTRDDIEMVIRFAKKHNLLI
MADEVYQFNIYAENRTFISMKKALHEMGAEYNKSVTLASFMSTSKGYMGE
CGFRGGYCELINWDGEVKAQLYKCLSARLCSSVIGQGILDVVVNCPKKGE
PSYELFEKEKNKVLSDLKAKGKLVSETFNSLPGFKCNSVQGAMYAFPKIE
LPPKVIAAAKALNYTADFFYCLNLLEQTGVCVVPGSGFGQKEGTFHFRIT
ILPPVEKMQTVMKLIKEFHLKFMEKYK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR004839Aminotransferase_I/II
IPR015421PyrdxlP-dep_Trfase_major
IPR015422PyrdxlP-dep_Trfase_dom1
IPR015424PyrdxlP-dep_Trfase
Vocabulary: biological process
TermDefinition
GO:0009058biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0030170pyridoxal phosphate binding
GO:0003824catalytic activity
GO:0008483transaminase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015421Pyridoxal phosphate-dependent transferase, major domainGENE3DG3DSA:3.40.640.10coord: 198..414
e-value: 2.8E-42
score: 146.6
IPR004839Aminotransferase, class I/classIIPFAMPF00155Aminotran_1_2coord: 184..556
e-value: 1.6E-31
score: 109.8
IPR015422Pyridoxal phosphate-dependent transferase domain 1GENE3DG3DSA:3.90.1150.10coord: 1..70
e-value: 3.4E-13
score: 51.4
coord: 417..577
e-value: 1.5E-47
score: 163.3
coord: 101..175
e-value: 1.6E-15
score: 59.0
NoneNo IPR availablePANTHERPTHR11751:SF308ALANINE AMINOTRANSFERASE 1coord: 102..576
coord: 1..95
NoneNo IPR availablePANTHERPTHR11751SUBGROUP I AMINOTRANSFERASE RELATEDcoord: 102..576
coord: 1..95
NoneNo IPR availableCDDcd00609AAT_likecoord: 176..567
e-value: 6.47853E-52
score: 179.459
IPR015424Pyridoxal phosphate-dependent transferaseSUPERFAMILYSSF53383PLP-dependent transferasescoord: 107..568