Cyclin domain protein

Overview
NameCyclin domain protein
Smed IDSMED30021342
Length (bp)1655
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Cyclin domain protein vs. Ensembl Human
Match: CCNB1 (cyclin B1 [Source:HGNC Symbol;Acc:HGNC:1579])

HSP 1 Score: 101.293 bits (251), Expect = 2.647e-22
Identity = 74/248 (29.84%), Postives = 117/248 (47.18%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGL-LACVEIIDTNLMEAFCNF-MFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLI-NIFISTKYTFK--AVKEKYS 1470
            EY   ++ YL + E E      YL       + R  L+DWL++VQ+  ++  ET+ + V +ID F     + K   QLVG+  M IA K  + + P I +F ++T++ Y    + QME  +L  LNF +  P+P HF  R   +  V++    L +      M D  ++H        S  +A A  +A  I   +   WT  LQHY  Y+    +E +L  M+ L  N+ +  +   K   VK KY+
Sbjct:  169 EYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVH-----FPPSQIAAGAFCLALKIL--DNGEWTPTLQHYLSYT----EESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYA 405          
BLAST of Cyclin domain protein vs. Ensembl Human
Match: CCNB2 (cyclin B2 [Source:HGNC Symbol;Acc:HGNC:1580])

HSP 1 Score: 99.7525 bits (247), Expect = 5.890e-22
Identity = 72/274 (26.28%), Postives = 131/274 (47.81%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFM----FDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIF-ISTKYT-FKAVKEKYSLNVKKAIAKNDKL--INFIEDLNSK 1539
            +Y   +++YL + E     N ++L         R  L+DWL++V    ++  ETL + V ++D F  +  + +   QLVGI  +L+A K  + F P I++F Y+T++ Y    + +ME ++L++L F +  P+P HF  R   A    ++ + +  +   +    +D++  HP+     +SC S   +   +         W    Q+YT Y+  ++ E   +   M  N+  ++   T F A+K KY+         + KL  I+ I  LNSK
Sbjct:  133 DYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCVGIMDRFLQVQPVSRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLIDYDMVHYHPSKVAAAASCLSQKVLGQGK---------WNLKQQYYTGYTENEVLE---VMQHMAKNVVKVNENLTKFIAIKNKYA---------SSKLLKISMIPQLNSK 385          
BLAST of Cyclin domain protein vs. Ensembl Human
Match: CCNB1 (cyclin B1 [Source:HGNC Symbol;Acc:HGNC:1579])

HSP 1 Score: 99.3673 bits (246), Expect = 8.650e-22
Identity = 68/226 (30.09%), Postives = 107/226 (47.35%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGL-LACVEIIDTNLMEAFCNF-MFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEML 1413
            EY   ++ YL + E E      YL       + R  L+DWL++VQ+  ++  ET+ + V +ID F     + K   QLVG+  M IA K  + + P I +F ++T++ Y    + QME  +L  LNF +  P+P HF  R   +  V++    L +      M D  ++H        S  +A A  +A  I   +   WT  LQHY  Y+    +E +L  M+ L
Sbjct:  169 EYVKDIYAYLRQLEEEQAVRPKYLLGREVTGNMRAILIDWLVQVQMKFRLLQETMYMTVSIIDRFMQNNCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTDNTYTKHQIRQMEMKILRALNFGLGRPLPLHFLRRASKIGEVDVEQHTLAKYLMELTMLDYDMVH-----FPPSQIAAGAFCLALKIL--DNGEWTPTLQHYLSYT----EESLLPVMQHL 383          
BLAST of Cyclin domain protein vs. Ensembl Human
Match: CCNA1 (cyclin A1 [Source:HGNC Symbol;Acc:HGNC:1577])

HSP 1 Score: 98.5969 bits (244), Expect = 1.511e-21
Identity = 83/282 (29.43%), Postives = 139/282 (49.29%), Query Frame = 1
Query:  652 LLLIRTVTPKSKEMSNLSEQFD---MKIDE-NFFEYYPYMFKYLYEREREIKFNKNYLALN-GFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLL---ACVEIIDTNLMEAFCNFMFDLIILHPASPGIR--SSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKY 1467
            LL   TV+P   + S LS+  D   +  D  N  EY   +++YL E E   +   +Y+       E  RT L+DWL++V    K+  ETL + V  +D F S   + +   QLVG A ML+A K  + + P + EF Y+T+D Y    +++ME ++L+ L F + VP  N F  + L     CV        E    ++ +L +L  A P ++   S  +AAA  +A +     +  W + L  +T YS++++  C+    +  ++I    +   +A++EKY
Sbjct:  132 LLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRT------ENLAKYVAELSLLE-ADPFLKYLPSLIAAAAFCLANYTVNKHF--WPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQ---QAIREKY 401          
BLAST of Cyclin domain protein vs. Ensembl Human
Match: CCNA1 (cyclin A1 [Source:HGNC Symbol;Acc:HGNC:1577])

HSP 1 Score: 98.5969 bits (244), Expect = 1.511e-21
Identity = 83/282 (29.43%), Postives = 139/282 (49.29%), Query Frame = 1
Query:  652 LLLIRTVTPKSKEMSNLSEQFD---MKIDE-NFFEYYPYMFKYLYEREREIKFNKNYLALN-GFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLL---ACVEIIDTNLMEAFCNFMFDLIILHPASPGIR--SSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKY 1467
            LL   TV+P   + S LS+  D   +  D  N  EY   +++YL E E   +   +Y+       E  RT L+DWL++V    K+  ETL + V  +D F S   + +   QLVG A ML+A K  + + P + EF Y+T+D Y    +++ME ++L+ L F + VP  N F  + L     CV        E    ++ +L +L  A P ++   S  +AAA  +A +     +  W + L  +T YS++++  C+    +  ++I    +   +A++EKY
Sbjct:  132 LLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRT------ENLAKYVAELSLLE-ADPFLKYLPSLIAAAAFCLANYTVNKHF--WPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQ---QAIREKY 401          
BLAST of Cyclin domain protein vs. Ensembl Celegans
Match: cya-1 (G2/mitotic-specific cyclin-A1 [Source:UniProtKB/Swiss-Prot;Acc:P34638])

HSP 1 Score: 78.9518 bits (193), Expect = 2.131e-15
Identity = 64/252 (25.40%), Postives = 112/252 (44.44%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLALNG-FEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYSLNVKKAIA 1494
            E++P + KY+  R+ + + +     +     E  RT L+DW   V        ET  + V L+D   S+  I K  +QLVG   M+IA K  + F P I++F  +T++ Y+   ++ MER +L K +F V +P  + F   G      +  T  M    +++ +L ++       R S  +AAA   A      +  SW + +   T  S     + +     M +N   ++   FK++   YS   +  +A
Sbjct:  211 EFFPDIIKYMLHRQTKNRASHECFDIQSQVNEEMRTILIDWFSDVVKEYNFQKETFHLAVSLVDRALSMFNIDKMRFQLVGTTSMMIAVKYEEIFPPEIEDFALITDNTYRVPDILLMERFLLGKFDFVVAMPTSSWF---GTCFAKRMNFTKKMRNTVHYLLELSLIDVHFLRYRPSDIAAAACCFAN--LQADVESWPQKMVDDTGISTEDFVDVLRDLHRMYLN---ASTADFKSIFYNYSETAQMEVA 454          
BLAST of Cyclin domain protein vs. Ensembl Celegans
Match: cyb-2.2 (CYclin B [Source:UniProtKB/TrEMBL;Acc:Q9BLB5])

HSP 1 Score: 76.2554 bits (186), Expect = 8.426e-15
Identity = 37/139 (26.62%), Postives = 74/139 (53.24%), Query Frame = 1
Query:  721 KIDENFFEYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVP 1137
            K++E F      ++ YL   E++   + +++         R  L+DWL++V L   +T ETL + + ++D      ++ K+ +QL+G+A + +A K    + P I E+  +TE+ +    ++ ME+ +L  LNF ++ P
Sbjct:   45 KLEEEFNCMAEDIYNYLVHHEKKYVLDDSFINGGNVNSKMRRILVDWLVQVHLRFHLTPETLHLTIFVLDRIIVKNIVSKAEFQLLGVAALFVASKFEDIYLPDILEYELITENTFSKKQILAMEQTILNALNFDLSCP 183          
BLAST of Cyclin domain protein vs. Ensembl Celegans
Match: cyb-2.2 (CYclin B [Source:UniProtKB/TrEMBL;Acc:Q9BLB5])

HSP 1 Score: 76.2554 bits (186), Expect = 8.426e-15
Identity = 37/139 (26.62%), Postives = 74/139 (53.24%), Query Frame = 1
Query:  721 KIDENFFEYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVP 1137
            K++E F      ++ YL   E++   + +++         R  L+DWL++V L   +T ETL + + ++D      ++ K+ +QL+G+A + +A K    + P I E+  +TE+ +    ++ ME+ +L  LNF ++ P
Sbjct:   45 KLEEEFNCMAEDIYNYLVHHEKKYVLDDSFINGGNVNSKMRRILVDWLVQVHLRFHLTPETLHLTIFVLDRIIVKNIVSKAEFQLLGVAALFVASKFEDIYLPDILEYELITENTFSKKQILAMEQTILNALNFDLSCP 183          
BLAST of Cyclin domain protein vs. Ensembl Celegans
Match: cyb-1 (G2/mitotic-specific cyclin-B1 [Source:UniProtKB/Swiss-Prot;Acc:Q10653])

HSP 1 Score: 73.559 bits (179), Expect = 6.538e-14
Identity = 41/164 (25.00%), Postives = 84/164 (51.22%), Query Frame = 1
Query:  649 QLLLIRTVTPKSKEMSNLSEQFDMKIDEN-FFEYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVP 1137
            ++L ++   P   E +  S++ +++  E         ++KYL   E++    + ++         R  L+DWL++V +   +T ETL + V ++D      +  K+  QL+GI+ M +A K  + + P I ++ ++TE+ Y    ++ ME+ +L  LNF ++ P
Sbjct:   45 EILALKPSNPAPVETAQKSQRINLQDAETKCLAMADDIYKYLVHHEKKYLLEECFMEGGEPTPKMRRILVDWLVQVHVRFHLTPETLHLTVFILDRMLQKKVTSKADLQLLGISAMFVASKFEEVYLPDIHDYEFITENTYSKKQILAMEQTILNSLNFDLSCP 208          
BLAST of Cyclin domain protein vs. Ensembl Celegans
Match: cyb-1 (G2/mitotic-specific cyclin-B1 [Source:UniProtKB/Swiss-Prot;Acc:Q10653])

HSP 1 Score: 73.559 bits (179), Expect = 6.538e-14
Identity = 41/164 (25.00%), Postives = 84/164 (51.22%), Query Frame = 1
Query:  649 QLLLIRTVTPKSKEMSNLSEQFDMKIDEN-FFEYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVP 1137
            ++L ++   P   E +  S++ +++  E         ++KYL   E++    + ++         R  L+DWL++V +   +T ETL + V ++D      +  K+  QL+GI+ M +A K  + + P I ++ ++TE+ Y    ++ ME+ +L  LNF ++ P
Sbjct:   45 EILALKPSNPAPVETAQKSQRINLQDAETKCLAMADDIYKYLVHHEKKYLLEECFMEGGEPTPKMRRILVDWLVQVHVRFHLTPETLHLTVFILDRMLQKKVTSKADLQLLGISAMFVASKFEEVYLPDIHDYEFITENTYSKKQILAMEQTILNSLNFDLSCP 208          
BLAST of Cyclin domain protein vs. Ensembl Fly
Match: CycB3 (gene:FBgn0015625 transcript:FBtr0334578)

HSP 1 Score: 95.5153 bits (236), Expect = 2.147e-20
Identity = 77/278 (27.70%), Postives = 131/278 (47.12%), Query Frame = 1
Query:  706 EQFDMKIDENFFEYYPY---MFKYLYEREREIKFNKNYLALN-GFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYT----EYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYSLNVKKAIAKNDKLIN 1515
            E FD K  ++ F+   Y   +F YL  RE E     +Y+          RT L+DW+++VQ   ++  ETL + V ++D++    +I K   QL+G A   IACK  +R  P I++F Y+ +  Y    +V+MER  L  + + + +P+   F  R    C ++    L      ++ +L ++  A+     S  ++AA+FMA  +       +  +WT  L +YT Y   QL +   I   +   +    + T K ++ KYS  +   +AK   L N
Sbjct:  289 EDFDRKNWDDPFQVSHYAMDIFNYLKVREAEFPI-ADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYDLGIPLSYRFLRR-YARCAKVPMPTL--TLARYILELSLMDYANISFSDSQMASAALFMALRMHGGPGQLDKQTWTSTLIYYTGY---QLADFAEIVTALNAGLHRKPRATIKTIRNKYSHKIFHEVAKVPLLTN 559          
BLAST of Cyclin domain protein vs. Ensembl Fly
Match: CycB3 (gene:FBgn0015625 transcript:FBtr0084728)

HSP 1 Score: 95.5153 bits (236), Expect = 2.147e-20
Identity = 77/278 (27.70%), Postives = 131/278 (47.12%), Query Frame = 1
Query:  706 EQFDMKIDENFFEYYPY---MFKYLYEREREIKFNKNYLALN-GFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYT----EYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYSLNVKKAIAKNDKLIN 1515
            E FD K  ++ F+   Y   +F YL  RE E     +Y+          RT L+DW+++VQ   ++  ETL + V ++D++    +I K   QL+G A   IACK  +R  P I++F Y+ +  Y    +V+MER  L  + + + +P+   F  R    C ++    L      ++ +L ++  A+     S  ++AA+FMA  +       +  +WT  L +YT Y   QL +   I   +   +    + T K ++ KYS  +   +AK   L N
Sbjct:  289 EDFDRKNWDDPFQVSHYAMDIFNYLKVREAEFPI-ADYMPRQIHLTTWMRTLLVDWMVEVQETFELNHETLYLAVKIVDLYLCREVINKEKLQLLGAAAFFIACKYDERQPPLIEDFLYICDGAYNHDELVRMERETLRVIKYDLGIPLSYRFLRR-YARCAKVPMPTL--TLARYILELSLMDYANISFSDSQMASAALFMALRMHGGPGQLDKQTWTSTLIYYTGY---QLADFAEIVTALNAGLHRKPRATIKTIRNKYSHKIFHEVAKVPLLTN 559          
BLAST of Cyclin domain protein vs. Ensembl Fly
Match: CycB (gene:FBgn0000405 transcript:FBtr0071914)

HSP 1 Score: 94.3597 bits (233), Expect = 3.571e-20
Identity = 76/297 (25.59%), Postives = 138/297 (46.46%), Query Frame = 1
Query:  682 SKEMSNLSEQFDMKIDENFF---EYYPYMFKYLYEREREIKFNKNYLALNGFEE---SFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITL-IKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPS--------WTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYSLNVKKAIAKNDKLINFIED 1527
            SK ++ + E  D    EN     EY   ++ YLY+ E E   +K++LA  G +E     R  L+DW+ +V L   +  ET Q+ V +ID +  +    K+++ QLVG+  + IA K  + F P I +F ++T+D Y    + QME  + + ++  ++ P+P HF  R   A     + + M     +  +L  +       R S  +AA++F++  +    + +        WT  L  Y+ YS   L+    +  ++  +   + +   KA+  KY  +  + IA   +L   + D
Sbjct:  204 SKRLAGI-EDIDANDKENLVLVSEYVNDIYDYLYQVELEQPIHKDHLA--GQKEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATKYEELFPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHTM---SKYFIELASVDYEMATYRPSEIAAASLFLSLHLLNGNHRAGTGFNDRHWTPTLTFYSRYSAAHLRPITRLIAKLARD---APQAKLKAIYNKYQGSKFQKIALRTELTGALMD 491          
BLAST of Cyclin domain protein vs. Ensembl Fly
Match: CycB (gene:FBgn0000405 transcript:FBtr0071913)

HSP 1 Score: 94.3597 bits (233), Expect = 4.194e-20
Identity = 76/297 (25.59%), Postives = 138/297 (46.46%), Query Frame = 1
Query:  682 SKEMSNLSEQFDMKIDENFF---EYYPYMFKYLYEREREIKFNKNYLALNGFEE---SFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITL-IKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPS--------WTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYSLNVKKAIAKNDKLINFIED 1527
            SK ++ + E  D    EN     EY   ++ YLY+ E E   +K++LA  G +E     R  L+DW+ +V L   +  ET Q+ V +ID +  +    K+++ QLVG+  + IA K  + F P I +F ++T+D Y    + QME  + + ++  ++ P+P HF  R   A     + + M     +  +L  +       R S  +AA++F++  +    + +        WT  L  Y+ YS   L+    +  ++  +   + +   KA+  KY  +  + IA   +L   + D
Sbjct:  228 SKRLAGI-EDIDANDKENLVLVSEYVNDIYDYLYQVELEQPIHKDHLA--GQKEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATKYEELFPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHTM---SKYFIELASVDYEMATYRPSEIAAASLFLSLHLLNGNHRAGTGFNDRHWTPTLTFYSRYSAAHLRPITRLIAKLARD---APQAKLKAIYNKYQGSKFQKIALRTELTGALMD 515          
BLAST of Cyclin domain protein vs. Ensembl Fly
Match: CycB (gene:FBgn0000405 transcript:FBtr0309858)

HSP 1 Score: 93.9745 bits (232), Expect = 5.098e-20
Identity = 76/297 (25.59%), Postives = 138/297 (46.46%), Query Frame = 1
Query:  682 SKEMSNLSEQFDMKIDENFF---EYYPYMFKYLYEREREIKFNKNYLALNGFEE---SFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITL-IKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPS--------WTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYSLNVKKAIAKNDKLINFIED 1527
            SK ++ + E  D    EN     EY   ++ YLY+ E E   +K++LA  G +E     R  L+DW+ +V L   +  ET Q+ V +ID +  +    K+++ QLVG+  + IA K  + F P I +F ++T+D Y    + QME  + + ++  ++ P+P HF  R   A     + + M     +  +L  +       R S  +AA++F++  +    + +        WT  L  Y+ YS   L+    +  ++  +   + +   KA+  KY  +  + IA   +L   + D
Sbjct:  232 SKRLAGI-EDIDANDKENLVLVSEYVNDIYDYLYQVELEQPIHKDHLA--GQKEVSHKMRAVLIDWINEVHLQFHLAAETFQLAVAIIDRYLQVVKDTKRTYLQLVGVTALFIATKYEELFPPAIGDFVFITDDTYTARQIRQMELQIFKAIDCNLSRPLPIHFLRRYSKAAGAEDEHHTM---SKYFIELASVDYEMATYRPSEIAAASLFLSLHLLNGNHRAGTGFNDRHWTPTLTFYSRYSAAHLRPITRLIAKLARD---APQAKLKAIYNKYQGSKFQKIALRTELTGALMD 519          
BLAST of Cyclin domain protein vs. Ensembl Zebrafish
Match: ccnb3 (cyclin B3 [Source:ZFIN;Acc:ZDB-GENE-060929-684])

HSP 1 Score: 105.145 bits (261), Expect = 5.708e-24
Identity = 66/224 (29.46%), Postives = 109/224 (48.66%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEML 1413
            EY   +F YL  RE +       +       + R  L+DWL++VQ   ++  ETL + V + D + +++  K+   QL+G   MLIA K  +R  P + +F Y+ +D YK   ++ ME  +L+ LNF +N+P+P  F  R    CV      L      F+ +L +L      +R+S  ++A + +A  +   +   WT+ LQ ++ YS   L   V     ML
Sbjct:  141 EYAKEIFDYLKNREEKFVLCDYMVDQPNLNTNMRAILVDWLVEVQENFELNHETLYLAVKVTDHYLAVSQTKREALQLIGSTAMLIASKFEERAPPCVDDFLYICDDAYKRSQLISMEISILQALNFDINIPVPYRFLRR-YAKCVNAGMDTL--TLARFICELSLLEMEFVPVRASLLASACLLIA--LVTKDLGGWTQCLQFHSGYSAEDLAPVVRKLHHML 359          
BLAST of Cyclin domain protein vs. Ensembl Zebrafish
Match: ccnb3 (cyclin B3 [Source:ZFIN;Acc:ZDB-GENE-060929-684])

HSP 1 Score: 105.145 bits (261), Expect = 5.708e-24
Identity = 66/224 (29.46%), Postives = 109/224 (48.66%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEML 1413
            EY   +F YL  RE +       +       + R  L+DWL++VQ   ++  ETL + V + D + +++  K+   QL+G   MLIA K  +R  P + +F Y+ +D YK   ++ ME  +L+ LNF +N+P+P  F  R    CV      L      F+ +L +L      +R+S  ++A + +A  +   +   WT+ LQ ++ YS   L   V     ML
Sbjct:  141 EYAKEIFDYLKNREEKFVLCDYMVDQPNLNTNMRAILVDWLVEVQENFELNHETLYLAVKVTDHYLAVSQTKREALQLIGSTAMLIASKFEERAPPCVDDFLYICDDAYKRSQLISMEISILQALNFDINIPVPYRFLRR-YAKCVNAGMDTL--TLARFICELSLLEMEFVPVRASLLASACLLIA--LVTKDLGGWTQCLQFHSGYSAEDLAPVVRKLHHML 359          
BLAST of Cyclin domain protein vs. Ensembl Zebrafish
Match: ccnb3 (cyclin B3 [Source:ZFIN;Acc:ZDB-GENE-060929-684])

HSP 1 Score: 105.145 bits (261), Expect = 5.708e-24
Identity = 66/224 (29.46%), Postives = 109/224 (48.66%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEML 1413
            EY   +F YL  RE +       +       + R  L+DWL++VQ   ++  ETL + V + D + +++  K+   QL+G   MLIA K  +R  P + +F Y+ +D YK   ++ ME  +L+ LNF +N+P+P  F  R    CV      L      F+ +L +L      +R+S  ++A + +A  +   +   WT+ LQ ++ YS   L   V     ML
Sbjct:  141 EYAKEIFDYLKNREEKFVLCDYMVDQPNLNTNMRAILVDWLVEVQENFELNHETLYLAVKVTDHYLAVSQTKREALQLIGSTAMLIASKFEERAPPCVDDFLYICDDAYKRSQLISMEISILQALNFDINIPVPYRFLRR-YAKCVNAGMDTL--TLARFICELSLLEMEFVPVRASLLASACLLIA--LVTKDLGGWTQCLQFHSGYSAEDLAPVVRKLHHML 359          
BLAST of Cyclin domain protein vs. Ensembl Zebrafish
Match: ccnb2 (cyclin B2 [Source:ZFIN;Acc:ZDB-GENE-030429-12])

HSP 1 Score: 101.293 bits (251), Expect = 8.328e-23
Identity = 66/257 (25.68%), Postives = 121/257 (47.08%), Query Frame = 1
Query:  706 EQFDMKIDENFFEYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYME--MLINIFISTKYTFKAVKEKYS 1470
            ++ D  + +   EY   ++ YL   E +      Y+         R  L+DWLI+V    ++  ETL + V ++D F  +  + +   QLVG+  MLIACK  + + P + +F Y+ +D +    + +ME +ML  LNF +  P+P HF  R   A     + +       +  +L +L         S  +AAA+ +++ +   +   W+   QHY+ Y    LK  + +  +  +++N  +S   T   V++KY+
Sbjct:  109 DEGDADMPQLCSEYVKDIYFYLRRLEGQQSVRPRYMEGYDINGRMRALLVDWLIQVHSRFQLLQETLYMTVAILDRFLQVQPVTRRKLQLVGVTAMLIACKYEEMYVPMVGDFAYIADDAFTKAQIREMEMLMLSGLNFKLGRPLPLHFLRRASKAGNADAEKH---TLAKYFLELTLLDYDMVHYNPSETAAAALCLSQLVLDGQ--KWSSTQQHYSTYDEAHLKPIMQLIAKNVVMVNEGLSKHLT---VRKKYA 357          
BLAST of Cyclin domain protein vs. Ensembl Zebrafish
Match: ccna2 (cyclin A2 [Source:ZFIN;Acc:ZDB-GENE-020418-1])

HSP 1 Score: 94.7449 bits (234), Expect = 2.460e-20
Identity = 72/245 (29.39%), Postives = 121/245 (49.39%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLALN-GFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIR--SSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKY 1467
            +Y   +  +L E E + K    Y+        S R  L+DWL++V    K+  ETL + V  ID F S   + +   QLVG A ML+A K  + + P + EF Y+T+D Y    V++ME ++L  L+F +  P  N F  +  L   + + + + E+   F+ +L ++    P ++   S  +AAA  +A     +   SW+K L   T YS+  L  CV    ++      ++++  +AV+EKY
Sbjct:  173 DYAAEIHTHLREMEVKSKPKAGYMRKQPDITNSMRAILVDWLVEVGEEYKLQNETLYLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLTVLSFDLAAPTINQFLTQYFLH--QPVSSKV-ESLSMFLGELSLID-CDPFLKYLPSQMAAAAFILANHTLASG--SWSKSLVDLTGYSLEDLLPCV---QDLHQTYLAASQHAQQAVREKY 408          
BLAST of Cyclin domain protein vs. Ensembl Xenopus
Match: ENSXETT00000018933.1 (cyclin B5 [Source:NCBI gene;Acc:394448])

HSP 1 Score: 103.219 bits (256), Expect = 3.338e-23
Identity = 69/252 (27.38%), Postives = 124/252 (49.21%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFM------FDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFIST---KYTFKAVKEKYS 1470
            +Y   ++ YL + E +      YL      E  R  L+DWLI+V L  ++  ETL + + ++D F     I +S  QLVG+  + IA K  + ++P I +F Y+T++ Y    + +ME ++L++LNF +  P+P +F  R    C      + +  +  FM      +D++  HP       S  +AAA+ + + +      +W   LQ YT YS    ++ +++ M+ +  + +     +  F +VK KYS
Sbjct:  122 DYVKDIYTYLRQLEVQQAVRPRYLHGMEVNERMRAILVDWLIQVHLKFQLLQETLYMAIAIMDRFLQGQPISRSKLQLVGVTSLFIASKYEEMYYPEISDFVYITDNTYSKAQIREMEMMILKELNFDLGRPLPLNFLRRASKCCSADAGQHTLAKY--FMELTLLDYDMVHFHP-------SAIAAAALCLTQKVL--NIGTWDATLQFYTGYS----QDDLILPMKHMAKVIVQVNQNQTKFLSVKNKYS 358          
BLAST of Cyclin domain protein vs. Ensembl Xenopus
Match: ENSXETT00000033191.1 (cyclin B5 [Source:NCBI gene;Acc:394448])

HSP 1 Score: 102.834 bits (255), Expect = 4.095e-23
Identity = 69/252 (27.38%), Postives = 124/252 (49.21%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFM------FDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFIST---KYTFKAVKEKYS 1470
            +Y   ++ YL + E +      YL      E  R  L+DWLI+V L  ++  ETL + + ++D F     I +S  QLVG+  + IA K  + ++P I +F Y+T++ Y    + +ME ++L++LNF +  P+P +F  R    C      + +  +  FM      +D++  HP       S  +AAA+ + + +      +W   LQ YT YS    ++ +++ M+ +  + +     +  F +VK KYS
Sbjct:  125 DYVKDIYTYLRQLEVQQAVRPRYLHGMEVNERMRAILVDWLIQVHLKFQLLQETLYMAIAIMDRFLQGQPISRSKLQLVGVTSLFIASKYEEMYYPEISDFVYITDNTYSKAQIREMEMMILKELNFDLGRPLPLNFLRRASKCCSADAGQHTLAKY--FMELTLLDYDMVHFHP-------SAIAAAALCLTQKVL--NIGTWDATLQFYTGYS----QDDLILPMKHMAKVIVQVNQNQTKFLSVKNKYS 361          
BLAST of Cyclin domain protein vs. Ensembl Xenopus
Match: ENSXETT00000016677.1 (cyclin B3 [Source:NCBI gene;Acc:100494711])

HSP 1 Score: 103.219 bits (256), Expect = 4.544e-23
Identity = 84/283 (29.68%), Postives = 132/283 (46.64%), Query Frame = 1
Query:  676 PKSKEMSNLSEQFDMK-IDENFF--EYYPYMFKYLYEREREIKFN-KNYLALN-GFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDT-NLMEAFCNFM---FDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYSLNVKKAIAK 1497
            P+ K +    E  D   +D+ F   EY   +F Y+  R+RE KF   NY+ +     +  R  L+DW+++VQ   ++  ETL + V ++D + + T+  K   QL+G   +LIA K  +R  P + +F Y+ +D YK   VV ME  +L+KLNF +N+P+P  F  R        ++T  L    C      +D +          S+ K AA   +           WT  LQHY+ Y   Q K+ + +   +   +        KAV+ KYS  V   +AK
Sbjct:  133 PEEKVLPPGVEDIDQDSLDDPFSNSEYAMDIFNYM--RDREEKFLLPNYMEMQTDISKDMRAILVDWMVEVQENFELNHETLYLAVKMVDHYLAATVSMKEKLQLIGSTAVLIASKFEERCPPCVDDFMYICDDAYKRDEVVAMEMEILQKLNFDINIPVPYRFLRRFAKCAHATMETLTLARYICELTLQEYDFV--------QESASKMAAGCLLLALKMKG-LGGWTATLQHYSGY---QTKDLLPLVKRLNFLLTHPPNEKLKAVRGKYSHRVFFEVAK 401          
BLAST of Cyclin domain protein vs. Ensembl Xenopus
Match: ENSXETT00000033175.1 (cyclin B5 [Source:NCBI gene;Acc:394448])

HSP 1 Score: 102.834 bits (255), Expect = 5.329e-23
Identity = 69/252 (27.38%), Postives = 124/252 (49.21%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFM------FDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFIST---KYTFKAVKEKYS 1470
            +Y   ++ YL + E +      YL      E  R  L+DWLI+V L  ++  ETL + + ++D F     I +S  QLVG+  + IA K  + ++P I +F Y+T++ Y    + +ME ++L++LNF +  P+P +F  R    C      + +  +  FM      +D++  HP       S  +AAA+ + + +      +W   LQ YT YS    ++ +++ M+ +  + +     +  F +VK KYS
Sbjct:  134 DYVKDIYTYLRQLEVQQAVRPRYLHGMEVNERMRAILVDWLIQVHLKFQLLQETLYMAIAIMDRFLQGQPISRSKLQLVGVTSLFIASKYEEMYYPEISDFVYITDNTYSKAQIREMEMMILKELNFDLGRPLPLNFLRRASKCCSADAGQHTLAKY--FMELTLLDYDMVHFHP-------SAIAAAALCLTQKVL--NIGTWDATLQFYTGYS----QDDLILPMKHMAKVIVQVNQNQTKFLSVKNKYS 370          
BLAST of Cyclin domain protein vs. Ensembl Xenopus
Match: ENSXETT00000016648.1 (cyclin B3 [Source:NCBI gene;Acc:100494711])

HSP 1 Score: 101.293 bits (251), Expect = 6.551e-23
Identity = 78/258 (30.23%), Postives = 122/258 (47.29%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFN-KNYLALN-GFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDT-NLMEAFCNFM---FDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYSLNVKKAIAK 1497
            EY   +F Y+  R+RE KF   NY+ +     +  R  L+DW+++VQ   ++  ETL + V ++D + + T+  K   QL+G   +LIA K  +R  P + +F Y+ +D YK   VV ME  +L+KLNF +N+P+P  F  R        ++T  L    C      +D +          S+ K AA   +           WT  LQHY+ Y   Q K+ + +   +   +        KAV+ KYS  V   +AK
Sbjct:   79 EYAMDIFNYM--RDREEKFLLPNYMEMQTDISKDMRAILVDWMVEVQENFELNHETLYLAVKMVDHYLAATVSMKEKLQLIGSTAVLIASKFEERCPPCVDDFMYICDDAYKRDEVVAMEMEILQKLNFDINIPVPYRFLRRFAKCAHATMETLTLARYICELTLQEYDFV--------QESASKMAAGCLLLALKMKG-LGGWTATLQHYSGY---QTKDLLPLVKRLNFLLTHPPNEKLKAVRGKYSHRVFFEVAK 322          
BLAST of Cyclin domain protein vs. Ensembl Mouse
Match: Ccnb2 (cyclin B2 [Source:MGI Symbol;Acc:MGI:88311])

HSP 1 Score: 100.908 bits (250), Expect = 1.525e-22
Identity = 64/247 (25.91%), Postives = 120/247 (48.58%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFM----FDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYS 1470
            +Y   +++YL + E     N ++L         R  L+DWL++V    ++  ETL + + ++D F    L+ +   QLVGI  +L+A K  + F P I++F Y+T++ Y    + +ME ++L++L F +  P+P HF  R   A    ++ + +  +   +    +D++  HP+     +SC S   +   +         W    Q+YT Y  +++ E V+ +M   +      +  F AVK KY+
Sbjct:  133 DYVKDIYQYLRQLEVLQSINPHFLDGRDINGRMRAILVDWLVQVHSKFRLLQETLYMCIAIMDRFLQAQLVCRKKLQLVGITALLLASKYEEMFSPNIEDFVYITDNAYTSSQIREMETLILKELKFELGRPLPLHFLRRASKAGEVDVEQHTLAKYLMELTLVDYDMVHYHPSQVAAAASCLSQKVLGQGK---------WNLKQQYYTGYMESEVLE-VMQHMAKNVVKVNDNRTKFIAVKNKYA 369          
BLAST of Cyclin domain protein vs. Ensembl Mouse
Match: Ccnb1 (cyclin B1 [Source:MGI Symbol;Acc:MGI:88302])

HSP 1 Score: 100.908 bits (250), Expect = 2.166e-22
Identity = 70/221 (31.67%), Postives = 104/221 (47.06%), Query Frame = 1
Query:  715 DMKIDENFF-EYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGL-LACVEIIDTNLMEAFCNF-MFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYS 1368
            D   D N   EY   ++ YL + E E      YL       + R  L+DWLI+VQ+  ++  ET+ + V +ID F   + + K   QLVG+  M IA K  + + P I +F ++T + Y    + QME  +L  LNF +  P+P HF  R   +  V++    L +      M D  ++H A   I     +A A  +A  I   +   WT  LQHY  YS
Sbjct:  156 DDGADPNLCSEYVKDIYAYLRQLEEEQSVRPKYLQGREVTGNMRAILIDWLIQVQMKFRLLQETMYMTVSIIDRFMQNSCVPKKMLQLVGVTAMFIASKYEEMYPPEIGDFAFVTNNTYTKHQIRQMEMKILRVLNFSLGRPLPLHFLRRASKVGEVDVEQHTLAKYLMELSMLDYDMVHFAPSQI-----AAGAFCLALKIL--DNGEWTPTLQHYLSYS 369          
BLAST of Cyclin domain protein vs. Ensembl Mouse
Match: Ccna2 (cyclin A2 [Source:MGI Symbol;Acc:MGI:108069])

HSP 1 Score: 96.6709 bits (239), Expect = 8.787e-22
Identity = 76/271 (28.04%), Postives = 134/271 (49.45%), Query Frame = 1
Query:  667 TVTPKSKEMSNLSEQFDMKIDENFFEYYPYMFKYLYEREREIKFNKNYLALN-GFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNL-MEAFCNFMFDLIILHPASPGIR--SSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKY 1467
            T +P + +MS + E   + ++E   +Y   +  YL E E + K    Y+        S R  L+DWL++V    K+  ETL + V  ID F S   + +   QLVG A ML+A K  + + P + EF Y+T+D Y    V++ME ++L+ L F +  P  N F  +  L    +   N  +E+   F+ +L ++  A P ++   S  + AA  +A +    +  SW + L   T Y++  LK C++   +  +    + ++  ++++EKY
Sbjct:    6 TESPHAMDMSIVLEDKPVNVNE-VPDYQEDIHTYLREMEVKCKPKVGYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPTVNQFLTQYFL---HLQPANCKVESLAMFLGELSLID-ADPYLKYLPSLIAGAAFHLALYTVTGQ--SWPESLAQQTGYTLESLKPCLVDLHQTYLK---APQHAQQSIREKY 266          
BLAST of Cyclin domain protein vs. Ensembl Mouse
Match: Ccna2 (cyclin A2 [Source:MGI Symbol;Acc:MGI:108069])

HSP 1 Score: 97.8265 bits (242), Expect = 2.309e-21
Identity = 75/269 (27.88%), Postives = 133/269 (49.44%), Query Frame = 1
Query:  673 TPKSKEMSNLSEQFDMKIDENFFEYYPYMFKYLYEREREIKFNKNYLALN-GFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNL-MEAFCNFMFDLIILHPASPGIR--SSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKY 1467
            +P + +MS + E   + ++E   +Y   +  YL E E + K    Y+        S R  L+DWL++V    K+  ETL + V  ID F S   + +   QLVG A ML+A K  + + P + EF Y+T+D Y    V++ME ++L+ L F +  P  N F  +  L    +   N  +E+   F+ +L ++  A P ++   S  + AA  +A +    +  SW + L   T Y++  LK C++   +  +    + ++  ++++EKY
Sbjct:  145 SPHAMDMSIVLEDKPVNVNE-VPDYQEDIHTYLREMEVKCKPKVGYMKRQPDITNSMRAILVDWLVEVGEEYKLQNETLHLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLASKFEEIYPPEVAEFVYITDDTYSKKQVLRMEHLVLKVLAFDLAAPTVNQFLTQYFL---HLQPANCKVESLAMFLGELSLID-ADPYLKYLPSLIAGAAFHLALYTVTGQ--SWPESLAQQTGYTLESLKPCLVDLHQTYLK---APQHAQQSIREKY 403          
BLAST of Cyclin domain protein vs. Ensembl Mouse
Match: Ccna1 (cyclin A1 [Source:MGI Symbol;Acc:MGI:108042])

HSP 1 Score: 95.5153 bits (236), Expect = 1.099e-20
Identity = 77/269 (28.62%), Postives = 131/269 (48.70%), Query Frame = 1
Query:  670 VTPKSKEMSNLSEQFDMKIDENFFEYYPYMFKYLYEREREIKFNKNYLALN-GFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIR--SSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKY 1467
            V P +   S  +  F   +  N  EY   + +YL E E   +   +Y+       E  R  L+DWL++V    K+ TETL + V  +D F S   + +   QLVG A +L+A K  + + P + EF Y+T+D Y    +++ME ++L+ L F + VP  N F  + L      I T   E    ++ +L +L  A P ++   S  +AAA  +A +I    +  W + L  +T YS+ ++  C+    +  ++I    +   +A++EKY
Sbjct:  143 VDPTTHAQSEEATDFGSDVI-NVTEYAEEIHRYLREAEVRHRPKAHYMRKQPDITEGMRAILVDWLVEVGEEYKLRTETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAILLASKYEEIYPPDVDEFVYITDDTYTKRQLLRMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCIRT---ENLAKYVAELSLLE-ADPFLKYLPSLVAAAAYCLANYIVNRHF--WPETLAAFTGYSLNEIVPCLSELHKACLSIPHRPQ---QAIREKY 401          
BLAST of Cyclin domain protein vs. UniProt/SwissProt
Match: sp|Q9FMH5|CCA31_ARATH (Putative cyclin-A3-1 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-1 PE=3 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 1.111e-28
Identity = 79/255 (30.98%), Postives = 132/255 (51.76%), Query Frame = 1
Query:  745 YYPYMFKYLYEREREIKFNKNYLA--LNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTN--LMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTK-YTFKAVKEKYSLNVKKAIA 1494
            Y   +F+YL + E + +   +Y+         + R  L+DWL++V    K+ ++TL + V  ID F S+  + K   QL+G+  MLIA K  +   P + +FCY+T++ Y    +V+ME  +L  L F +  P  N F  R      E  + +   ME  C+++ +L +L   S     S  +A+A+F+ARFI   +   W  +L+ YT Y    LKECV     M+ ++++S K    +A++EKY  +  K +A
Sbjct:   87 YVTSIFEYLRQLEVKSRPLVDYIEKIQKDVTSNMRGVLVDWLVEVAEEYKLLSDTLYLAVSYIDRFLSLKTVNKQRLQLLGVTSMLIASKYEEITPPNVDDFCYITDNTYTKQEIVKMEADILLALQFELGNPTSNTFLRRFTRVAQEDFEMSHLQMEFLCSYLSELSMLDYQSVKFLPSTVAASAVFLARFIIRPKQHPWNVMLEEYTRYKAGDLKECV----AMIHDLYLSRKCGALEAIREKYKQHKFKCVA 337          
BLAST of Cyclin domain protein vs. UniProt/SwissProt
Match: sp|A0MEB5|CCA33_ARATH (Cyclin-A3-3 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-3 PE=2 SV=2)

HSP 1 Score: 117.857 bits (294), Expect = 6.668e-28
Identity = 76/248 (30.65%), Postives = 135/248 (54.44%), Query Frame = 1
Query:  745 YYPYMFKYLYEREREIKFNKNYLALNGFEE----SFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDT-NL-MEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFIS-TKYTFKAVKEKY 1467
            Y   +++YL E E + K    +  +   +E    S R  L+DWL++V    ++ +ETL + V  ID F S+ ++ + + QLVG++ M IA K  ++  P++++FCY+T + Y    V++ME  +L  L F +  P  N F  R +    E     NL +E  C ++ +L +L  +      S  +A+A+F+ARFI       W+++L+  T Y    L+ CV    E+++++++S ++   KAV+EKY
Sbjct:   56 YVSDIYEYLRELEVKPKLRPLHDYIEKIQEDITPSKRGVLVDWLVEVAEEFELVSETLYLTVSYIDRFLSLKMVNEHWLQLVGVSAMFIASKYEEKRRPKVEDFCYITANTYTKQDVLKMEEDILLALEFELGRPTTNTFLRRFIRVAQEDFKVPNLQLEPLCCYLSELSMLDYSCVKFVPSLLAASAVFLARFIILPNQHPWSQMLEECTKYKAADLQVCV----EIMLDLYLSRSEGASKAVREKY 299          
BLAST of Cyclin domain protein vs. UniProt/SwissProt
Match: sp|Q9DG99|CCNB2_ORYJA (G2/mitotic-specific cyclin-B2 OS=Oryzias javanicus OX=123683 GN=ccnb2 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.026e-27
Identity = 74/268 (27.61%), Postives = 135/268 (50.37%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLME-AFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYSLNVKKAIAKNDKL--INFIEDLNS 1536
            +Y   ++KYL+  E +     NY+      E  R  L+DWL++V    ++  ETL + V ++D F  +  + +   QLVG+  ML+ACK  + + P + +F Y+T+D +    +V+ME+++L  L F +  P+P HF  R      ++ D ++ +     ++ +L +L       R S  +AAA+ +++ +   +   W+   QHY+ Y    LK  + +  + ++ +    +  F AVK+KYS         + KL  I+ I  LNS
Sbjct:  118 QYVKDIYKYLHTLEEQQAIRPNYMQGYSVTEHMRALLVDWLVQVHSRFQLLQETLYLTVAILDRFLQVHPVSRRKLQLVGVTAMLVACKYEEMYPPEVGDFAYITDDAFTKFQIVEMEQVILRSLGFQLGRPLPLHFLRRA----SKVADADVEKHTLAKYLLELTLLDYHMVHYRPSEAAAAALCLSQLLL--DGLPWSLEQQHYSTYDEQHLKPIMQLMAKNVVQV-TEGRTKFLAVKKKYS---------SSKLMKISLIPQLNS 369          
BLAST of Cyclin domain protein vs. UniProt/SwissProt
Match: sp|Q9C6Y3|CCA11_ARATH (Cyclin-A1-1 OS=Arabidopsis thaliana OX=3702 GN=CYCA1-1 PE=1 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 3.152e-27
Identity = 79/251 (31.47%), Postives = 127/251 (50.60%), Query Frame = 1
Query:  757 MFKYLYEREREIKFNKNYL--ALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFC--NFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYSLNVKKAIAK 1497
            ++K+L   E + + + +Y+         S R  L+DWLI+V    ++  ETL + V  ID + S  +I +   QL+G+A M+IA K  +   P+++EFCY+T++ Y    V+ ME  +L  L F +  P    F  R + A   + +  LM+  C  N++ +L +L         S  +A+AIF+A++I       W   LQHYT Y   +L+ CV     +      S   T  AV+EKYS +  K +AK
Sbjct:  198 IYKHLRASEAKKRPDVDYMERVQKDVNSSMRGILVDWLIEVSEEYRLVPETLYLTVNYIDRYLSGNVISRQKLQLLGVACMMIAAKYEEICAPQVEEFCYITDNTYLKDEVLDMESDVLNYLKFEMTAPTTKCFLRRFVRAAHGVHEAPLMQLECMANYIAELSLLEYTMLSHSPSLVAASAIFLAKYILDPTRRPWNSTLQHYTQYKAMELRGCVKDLQRLCSTAHGS---TLPAVREKYSQHKYKFVAK 445          
BLAST of Cyclin domain protein vs. UniProt/SwissProt
Match: sp|Q9C6A9|CCA32_ARATH (Cyclin-A3-2 OS=Arabidopsis thaliana OX=3702 GN=CYCA3-2 PE=2 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 5.072e-26
Identity = 79/248 (31.85%), Postives = 127/248 (51.21%), Query Frame = 1
Query:  751 PYMFK-YLYEREREIKFNKNYL------ALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHR-GLLACVEIIDTNL-MEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKY 1467
            PY+   Y Y R+ E+K  +  L             S R  L+DWL++V    K+ +ETL + V  ID F S+  + K   QLVG++ MLIA K  +   P++ +FCY+T++ +    VV+ME  +L  L F +  P  N F  R   +A  +    +L +E  C ++ +L IL   +     S  +A+A+F+ARFI   +   W ++L+ YT Y    L+ CV I  ++ ++         +AV+EKY
Sbjct:  101 PYVADIYEYLRQLEVKPKQRPLPDYIEKVQKDVTPSMRGVLVDWLVEVAEEYKLGSETLYLTVSHIDRFLSLKTVNKQKLQLVGVSAMLIASKYEEISPPKVDDFCYITDNTFSKQDVVKMEADILLALQFELGRPTINTFMRRFTRVAQDDFKVPHLQLEPLCCYLSELSILDYKTVKFVPSLLAASAVFLARFIIRPKQHPWNQMLEEYTKYKAADLQVCVGIIHDLYLS---RRGGALQAVREKY 345          
BLAST of Cyclin domain protein vs. TrEMBL
Match: D2DJT4 (CyclinA-like protein (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 9.517e-62
Identity = 97/97 (100.00%), Postives = 97/97 (100.00%), Query Frame = 1
Query:  889 MTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACV 1179
            MTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACV
Sbjct:    1 MTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACV 97          
BLAST of Cyclin domain protein vs. TrEMBL
Match: A0A183AY11 (Cyclin N-terminal domain-containing protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS11846 PE=3 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 7.762e-36
Identity = 77/209 (36.84%), Postives = 121/209 (57.89%), Query Frame = 1
Query:  712 FDMKIDENFFEYYPYMFKYLYEREREIK--FNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSI-TLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEII--DTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTE 1323
             DM   + F  ++  +F+YLY R+ E    +   +L  NG     R TL DW+IKVQ Y K+ TETL + V L+D +T +   +  S YQLVGI  + +A K V+RF P     CYLTE+ YKP  V++ E  +L+ L+F V +P+P+HF  R +LAC ++   +   +E  C ++F+L +   ++ G+ +S + AAA+ + R +   E
Sbjct:  136 IDMAQFDEFHMHHERIFRYLYTRDLEATSYYKAEFLRRNGLSADIRATLCDWMIKVQQYLKLRTETLHLAVSLVDRYTWLQDRMNPSDYQLVGITALFVAAKFVERFAPTTTTLCYLTENSYKPKQVLEFELHLLQTLDFDVAIPLPHHFLTRAMLACDDLTYSERAKVELICCYLFELSLTEVSAVGVPASTRCAAAVRLVRQLLQVE 344          
BLAST of Cyclin domain protein vs. TrEMBL
Match: A0A4Z2DTV0 (G2/mitotic-specific cyclin-B1 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_007066 PE=3 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.458e-35
Identity = 75/196 (38.27%), Postives = 123/196 (62.76%), Query Frame = 1
Query:  757 MFKYLYEREREIK--FNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFT--SITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTN--LMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEY 1326
            +F+YL+ ++ ++   + +N+L  +G  ES R+TL DW+IKVQ Y K+ TE+L + V L+D +T   ITL   S YQL+GI  + IA K ++RF P  K  CYLTE+ Y P  V+  E  ML+ L+F +N+P+P+HF  R ++AC ++  T    +E  C ++F+L +   ++ G+ ++ K AA +++ R +   EY
Sbjct:  354 IFRYLFTQDLKVTSYYQENFLERHGLTESVRSTLCDWMIKVQQYLKLRTESLHLAVNLVDQYTWRQITLCP-SDYQLLGITAIFIAVKFIERFPPATKTLCYLTENSYSPKQVLDFEMKMLQVLDFCINIPLPHHFLDRAIVACNDLTVTGKAKIELACRYLFELSLTELSAAGVLATVKCAAGVYLTRELIRLEY 548          
BLAST of Cyclin domain protein vs. TrEMBL
Match: A0A4E0R5N2 (Putative cyclin OS=Fasciola hepatica OX=6192 GN=D915_007018 PE=3 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 5.446e-35
Identity = 97/300 (32.33%), Postives = 153/300 (51.00%), Query Frame = 1
Query:  712 FDM-KIDENFFEYYPYMFKYLYEREREIK--FNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITL-IKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEII--DTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTE---------------------YPSWT----KILQHYTFYSVTQLKECVLIYMEMLINI---FISTKYTFKAVKEKYSLNVKKAIAKNDKL 1509
             DM K+DE F  ++  +F+YLY R+ E    +   +L   G  E+ R+TL DW+IKVQ Y K+ TETL + + L+D +T +   +  S YQLVGI  + +A K V+RF P     CYLTE+ Y+   V+  E  +L+ L+F V +P+P+HF  R LLAC ++   +   +E  C ++F+L +   ++ G+ +S + AAA+ + R +   E                     + +W     +IL H        L+   LIY+  L       +  K  F+A   K+S    +AIA+ D L
Sbjct:  350 IDMAKLDE-FHMHHERIFRYLYARDLEATSYYKAEFLKRIGLSENIRSTLCDWMIKVQQYLKLRTETLHLAISLVDRYTWLQCELNPSDYQLVGITALFVAAKFVERFAPTTSTLCYLTENSYRTKQVLDFELHLLQTLDFDVAIPLPHHFLTRALLACDDLTYSERAKVELICCYLFELSLTEASAVGVAASTRCAAAVRLVRQLLQAERERVTSSPNTSALDTDSFELGFDAWNDRMVRILGH---DDSPHLRATALIYVRALRRFQPGAVVFKGKFEAAFHKFSNRGYRAIAQCDTL 645          
BLAST of Cyclin domain protein vs. TrEMBL
Match: A0A074ZNV4 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_13461 PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 3.230e-34
Identity = 94/283 (33.22%), Postives = 144/283 (50.88%), Query Frame = 1
Query:  748 YPYMFKYLYER--EREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSF----YQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEI--IDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTE---------------YPS------WTKILQHYTFYSVT-QLKECVLIYMEMLINI---FISTKYTFKAVKEKYSLNVKKAIAK 1497
            +  +++YL+ R  ER   FN  +L  N   E  R TL DW+IKVQ Y K+ TETL + V ++D +T    +KK+     YQLVGI  + +A K V+RF P     CYLTE+ YKP  V+  E  +L KL+F + +P+P+HF  R +LAC ++  I+   +E    ++F+L +   +  G  +S + AAA+ +AR +   E               +P       W +IL     +  T +L+   L Y+  L      F ST   F+A   K+S    K +A+
Sbjct:  290 HAVIYRYLFTRDMERTSLFNPEFLKQNSLTEDIRATLCDWMIKVQQYLKLRTETLHLAVSIVDQYT---WLKKNMNPIDYQLVGITALFVAAKFVERFAPSSATLCYLTENSYKPRQVLDFEHSLLRKLDFDLTIPLPHHFLTRAVLACSDLTTIEKAKVELISCYLFELSLTETSIVGFSASIRCAAAVRLARHLIDLERIRIQQTRSSSPLLLHPDRQQVEPWPEILIRSVGHGDTPRLRAVCLTYVRALRRFKTGFSSTTEKFEAAFHKFSNRGYKGVAQ 569          
BLAST of Cyclin domain protein vs. Ensembl Cavefish
Match: ccnb2 (G2/mitotic-specific cyclin-B2 [Source:NCBI gene;Acc:103043733])

HSP 1 Score: 107.071 bits (266), Expect = 8.616e-25
Identity = 76/263 (28.90%), Postives = 129/263 (49.05%), Query Frame = 1
Query:  706 EQFDMKIDENFFEYYPYMFKYLYEREREIKFNKNYLALNGFE--ESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLAC-VEIIDTNLMEAFCNFM---FDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIF-ISTKYT-FKAVKEKYS 1470
            ++ D +I +   EY   ++ YL   E +      Y+  +G+E  E  R  L+DWLI+V    ++  ETL + V ++D F  +  + +   QL G+  ML+A K  + F P + +F Y+T++ +    + +ME I+L +LNF +  P+P HF  R   A   +     L + F       +D++  HP+  G       AA + +++ +   +   W+   +HYT YS   LK    I   M  N+  ++   T F AVK+KYS
Sbjct:  107 DKGDAEIPQLCSEYVKDIYVYLRSLEAQQSIRPRYM--DGYEINERMRALLVDWLIQVHSRFQLLQETLYMTVAILDRFLQVQPVSRKKLQLAGVTAMLLASKYEEMFVPEVGDFAYITDNAFTKPQIREMEMIILRELNFELGRPLPLHFLRRASKAGNADAEKHTLAKYFLELTLLDYDMVHYHPSEIG-------AAGLCLSQLVIDGQ--KWSPTQEHYTTYSEAHLKP---IMQHMAKNVVKVNEGLTKFMAVKKKYS 355          
BLAST of Cyclin domain protein vs. Ensembl Cavefish
Match: ccnb3 (G2/mitotic-specific cyclin-B3-like [Source:NCBI gene;Acc:103043213])

HSP 1 Score: 105.916 bits (263), Expect = 1.901e-24
Identity = 64/227 (28.19%), Postives = 113/227 (49.78%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREI---KFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEML 1413
            EY   +F YL  RE +     +  + L+LN   ++ R  L+DWL++VQ   ++  ETL + V + D + +++   +   QL+G   ML+ACK  +R  P + +F Y+ +D YK   ++ ME  +L+ LNF +N+P+P  F  R    CV      L      F+ +L ++      +R+S  ++A + +A  +   +   WT  L+ ++ Y+   L         ML
Sbjct:  148 EYAKEIFDYLKNREEKFVLKDYMDSQLSLN---QNMRAILVDWLVEVQENFELNHETLYLAVKMTDHYLAVSQASRESLQLIGSTAMLLACKFEERLPPCVDDFLYICDDAYKRSQIITMEGTILQALNFDINIPVPYRFLRR-YAKCVNAGMDTL--TLARFVCELSLMEMQFVPVRASLLASACLLIA--LVTKDLGGWTPCLEFHSGYNTEDLAPVARKLQHML 366          
BLAST of Cyclin domain protein vs. Ensembl Cavefish
Match: ccnb3 (G2/mitotic-specific cyclin-B3-like [Source:NCBI gene;Acc:103043213])

HSP 1 Score: 106.301 bits (264), Expect = 2.932e-24
Identity = 70/249 (28.11%), Postives = 121/249 (48.59%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREI---KFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYSLNV 1479
            EY   +F YL  RE +     +  + L+LN   ++ R  L+DWL++VQ   ++  ETL + V + D + +++   +   QL+G   ML+ACK  +R  P + +F Y+ +D YK   ++ ME  +L+ LNF +N+P+P  F  R    CV      L      F+ +L ++      +R+S  ++A + +A  +   +   WT  L+ ++ Y+   L         ML     S   T   ++ KYS  V
Sbjct:  168 EYAKEIFDYLKNREEKFVLKDYMDSQLSLN---QNMRAILVDWLVEVQENFELNHETLYLAVKMTDHYLAVSQASRESLQLIGSTAMLLACKFEERLPPCVDDFLYICDDAYKRSQIITMEGTILQALNFDINIPVPYRFLRR-YAKCVNAGMDTL--TLARFVCELSLMEMQFVPVRASLLASACLLIA--LVTKDLGGWTPCLEFHSGYNTEDLAPVARKLQHMLSRTPDSKLAT---IRSKYSHKV 405          
BLAST of Cyclin domain protein vs. Ensembl Cavefish
Match: ccnb2 (G2/mitotic-specific cyclin-B2 [Source:NCBI gene;Acc:103043733])

HSP 1 Score: 105.145 bits (261), Expect = 5.708e-24
Identity = 77/263 (29.28%), Postives = 125/263 (47.53%), Query Frame = 1
Query:  706 EQFDMKIDENFFEYYPYMFKYLYEREREIKFNKNYLALNGFE--ESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLAC-VEIIDTNLMEAFCNFM---FDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIF-ISTKYT-FKAVKEKYS 1470
            ++ D +I +   EY   ++ YL   E +      Y+  +G+E  E  R  L+DWLI+V    ++  ETL + V ++D F  +  + +   QL G+  ML+A K  + F P + +F Y+T++ +    + +ME I+L +LNF +  P+P HF  R   A   +     L + F       +D++  HP+  G    C S   I         +   W+   +HYT YS   LK    I   M  N+  ++   T F AVK+KYS
Sbjct:  138 DKGDAEIPQLCSEYVKDIYVYLRSLEAQQSIRPRYM--DGYEINERMRALLVDWLIQVHSRFQLLQETLYMTVAILDRFLQVQPVSRKKLQLAGVTAMLLASKYEEMFVPEVGDFAYITDNAFTKPQIREMEMIILRELNFELGRPLPLHFLRRASKAGNADAEKHTLAKYFLELTLLDYDMVHYHPSEIGAAGLCLSQLVI---------DGQKWSPTQEHYTTYSEAHLKP---IMQHMAKNVVKVNEGLTKFMAVKKKYS 386          
BLAST of Cyclin domain protein vs. Ensembl Cavefish
Match: ccnb2 (G2/mitotic-specific cyclin-B2 [Source:NCBI gene;Acc:103043733])

HSP 1 Score: 101.293 bits (251), Expect = 1.009e-22
Identity = 65/232 (28.02%), Postives = 114/232 (49.14%), Query Frame = 1
Query:  706 EQFDMKIDENFFEYYPYMFKYLYEREREIKFNKNYLALNGFE--ESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLAC-VEIIDTNLMEAFCNFM---FDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLK 1383
            ++ D +I +   EY   ++ YL   E +      Y+  +G+E  E  R  L+DWLI+V    ++  ETL + V ++D F  +  + +   QL G+  ML+A K  + F P + +F Y+T++ +    + +ME I+L +LNF +  P+P HF  R   A   +     L + F       +D++  HP+  G       AA + +++ +   +   W+   +HYT YS   LK
Sbjct:  107 DKGDAEIPQLCSEYVKDIYVYLRSLEAQQSIRPRYM--DGYEINERMRALLVDWLIQVHSRFQLLQETLYMTVAILDRFLQVQPVSRKKLQLAGVTAMLLASKYEEMFVPEVGDFAYITDNAFTKPQIREMEMIILRELNFELGRPLPLHFLRRASKAGNADAEKHTLAKYFLELTLLDYDMVHYHPSEIG-------AAGLCLSQLVIDGQ--KWSPTQEHYTTYSEAHLK 327          
BLAST of Cyclin domain protein vs. Ensembl Sea Lamprey
Match: ccnb2 (cyclin B2 [Source:ZFIN;Acc:ZDB-GENE-030429-12])

HSP 1 Score: 98.2117 bits (243), Expect = 2.204e-22
Identity = 60/221 (27.15%), Postives = 107/221 (48.42%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFM----FDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECV 1392
            EY   ++ Y+   E+E     NYL         R+ L+DWL++VQ+  ++  ETL + V +ID +  +        QLVG+  M IA K  + + P +++F Y+T+  Y    +  ME+ +L  L F +  P+P HF  R   A     D + +  +   +    ++++  HP       S  +AAA+++++ +   +   W   LQ+YT Y+  +L   V
Sbjct:  134 EYVKDIYVYMKTLEKEQSVQANYLEGKKINGRMRSILVDWLVQVQMKFRLLQETLYLTVAIIDRYLQVVPFSLVNLQLVGVTAMFIAAKYEEMYSPEMEDFVYITDHAYTKAEIRAMEQAILLGLQFNLGRPLPLHFLRRASKAGSVDADKHTLAKYLMELSLVDYNMVHFHP-------SQIAAAALYLSQKLM--DDSKWNMDLQYYTTYTEEELMPVV 345          
BLAST of Cyclin domain protein vs. Ensembl Sea Lamprey
Match: ccna1 (cyclin A1 [Source:ZFIN;Acc:ZDB-GENE-040311-2])

HSP 1 Score: 73.9442 bits (180), Expect = 6.336e-15
Identity = 44/133 (33.08%), Postives = 70/133 (52.63%), Query Frame = 1
Query:  757 MFKYLYEREREIKFNKNYLALN-GFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHF 1152
            +++YL + E   K    Y+        S R+ L+DWL++V    K+ +ETL + V  ID F S   + +   QLVG A M +A K  + + P + EF ++T+D Y    V++ME ++L  L+F V  P    F
Sbjct:   31 IYQYLQKAELRCKPKAGYMRKQPDITTSMRSILVDWLVEVVEEYKLHSETLYLAVNYIDRFLSSMSVLRGKLQLVGTAAMYLAAKFEEIYPPEVSEFVFITDDTYTKQQVLRMEHLILRVLSFEVASPTIMQF 163          
BLAST of Cyclin domain protein vs. Ensembl Sea Lamprey
Match: ccne1 (cyclin E1 [Source:NCBI gene;Acc:30188])

HSP 1 Score: 57.3806 bits (137), Expect = 2.874e-9
Identity = 37/115 (32.17%), Postives = 59/115 (51.30%), Query Frame = 1
Query:  781 EREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSI-TLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNF 1122
            ER+  F   + AL       R  L+DWL++V    ++  ETL + +   D F +  T + KS  QL+GI  + IA K  + + P++ EF Y+T+       +V ME  ML+ L +
Sbjct:   53 ERDRHFLDRHPALTA---RMRAVLLDWLMQVCEVYRLHRETLYLALDYFDRFLATQTDVCKSQLQLIGITALFIAAKTEEIYPPKLTEFAYVTDGACTEEDIVVMELNMLQSLKW 164          
BLAST of Cyclin domain protein vs. Ensembl Yeast
Match: CLB4 (B-type cyclin involved in cell cycle progression; activates Cdc28p to promote the G2/M transition; may be involved in DNA replication and spindle assembly; accumulates during S phase and G2, then targeted for ubiquitin-mediated degradation; CLB4 has a paralog, CLB3, that arose from the whole genome duplication [Source:SGD;Acc:S000004200])

HSP 1 Score: 82.8037 bits (203), Expect = 2.489e-17
Identity = 59/218 (27.06%), Postives = 109/218 (50.00%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKN-YLALNGFEES--FRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQH--YTFYSVTQL 1380
            EY   +F YL  RE E+K+  N Y   N  E +  FR T++DWL+++    ++  ETL + + ++D F S   +  + +QLVG++ + IA K  +   P + +  Y+ E+ Y    +++ E+ M++ L F +  P P  F  R  ++  +  D         ++ +  I+ P       S  +A A F++R I  +    W+  L+H  Y+ Y+ +Q+
Sbjct:  206 EYASDIFYYL--RELEVKYRPNPYYMQNQVELTWPFRRTMIDWLVQLHFRFQLLPETLYLTINIVDRFLSKKTVTLNRFQLVGVSALFIAAKFEEINCPTLDDLVYMLENTYTRDDIIRAEQYMIDTLEFEIGWPGPMPFLRR--ISKADDYDFE-PRTLAKYLLETTIVEPKLVAAAPSWLAAGAYFLSRTILGSN--DWS--LKHVFYSGYTSSQI 414          
BLAST of Cyclin domain protein vs. Ensembl Yeast
Match: CLB3 (B-type cyclin involved in cell cycle progression; activates Cdc28p to promote the G2/M transition; may be involved in DNA replication and spindle assembly; accumulates during S phase and G2, then targeted for ubiquitin-mediated degradation; relative distribution to the nucleus increases upon DNA replication stress; CLB3 has a paralog, CLB4, that arose from the whole genome duplication [Source:SGD;Acc:S000002314])

HSP 1 Score: 81.6481 bits (200), Expect = 4.221e-17
Identity = 59/218 (27.06%), Postives = 105/218 (48.17%), Query Frame = 1
Query:  757 MFKYLYEREREIKFNKNYLALNG-FEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYME 1407
            +F+Y+ + E   K N  Y+        SFR+TL+DW+++V    ++  ETL + + +ID +    ++  + +QLVG A + IA K  +   P IK+F Y++E+CY    ++  ER +L  L F +  P P  F  R   A     DT  +     ++ +  I+       + S  +A A F+++ I       W+    +Y+ Y+  Q+     I +E
Sbjct:  172 IFEYMRKLEDLYKPNPYYMDKQPELRWSFRSTLIDWIVQVHEKFQLLPETLYLCINIIDRYLCKEVVPVNKFQLVGAASLFIAAKYEEINCPTIKDFVYMSENCYSRNDLLDAERTILNGLEFELGWPGPMSFLRRISKADDYEHDTRTL---AKYLLESTIMDHRLVSAQPSWLAAGAYFLSKIILGQN--QWSLAHVYYSNYTQEQILPLATIILE 384          
BLAST of Cyclin domain protein vs. Ensembl Yeast
Match: CLB6 (B-type cyclin involved in DNA replication during S phase; activates Cdc28p to promote initiation of DNA synthesis; functions in formation of mitotic spindles along with Clb3p and Clb4p; most abundant during late G1; CLB6 has a paralog, CLB5, that arose from the whole genome duplication [Source:SGD;Acc:S000003341])

HSP 1 Score: 74.7146 bits (182), Expect = 6.119e-15
Identity = 63/227 (27.75%), Postives = 105/227 (46.26%), Query Frame = 1
Query:  718 MKIDENFF--EYYPYMFKYLYEREREIKFNKNYLALNG----FEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAF-------CNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYT 1359
            +++D+ F   EY   +F +LYE+E ++    NYL         + S R  L+DWL++V        ETL + + L+D F S  ++K +  QL+ I  + IACK  +   P+I  F Y+T+       + + E  +L  L + +++P P +F  R   A    I+T  M  F       CN    L          + S  +A ++++AR I   E   W +   HY+
Sbjct:  109 IEMDDPFMVAEYTDSIFSHLYEKEIQMLPTHNYLMDTQSPYHLKSSMRALLIDWLVEVHEKFHCLPETLFLAINLLDRFLSQNVVKLNKLQLLCITCLFIACKFEEVKLPKITNFAYVTDGAATVEGIRKAELFVLSSLGYNISLPNPLNFIRRISKADNYCIETRNMAKFIMEYSICCNKFIHL----------KPSYLAAMSMYIARKI-KNENSKWDETFIHYS 324          
BLAST of Cyclin domain protein vs. Ensembl Yeast
Match: CLB5 (B-type cyclin involved in DNA replication during S phase; activates Cdc28p to promote initiation of DNA synthesis; functions in formation of mitotic spindles along with Clb3p and Clb4p; most abundant during late G1 phase; CLB5 has a paralog, CLB6, that arose from the whole genome duplication [Source:SGD;Acc:S000006324])

HSP 1 Score: 74.3294 bits (181), Expect = 1.057e-14
Identity = 62/217 (28.57%), Postives = 98/217 (45.16%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLALNG----FEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLA-CVEIIDTNLME-----AFCNFMFDLIILHPASPGIRSSCKSAAAIFMA-RFIFYTEYPSWTKILQHYT 1359
            EY   +F +LY RE E   + NYL           S RT L+DWL++V    +   ETL + + L+D F +   +  +  QL+ +  + IA K  +   P++ E+ Y+T+       +   E  ML  L F +  P P +F  R   A   + ++ N+ +     A+C   F  I L P       S  SA A+++A R     +   W   LQHY+
Sbjct:  161 EYSAEIFAFLYRRELETLPSHNYLLDKTSKYYLRPSMRTILVDWLVEVHEKFQCYPETLFLSINLMDRFLAKNKVTMNKLQLLAVTSLFIAAKFEEVNLPKLAEYAYITDGAASKNDIKNAEMFMLTSLEFNIGWPNPLNFLRRISKADDYDPVNRNIGKFILEYAYCCHQF--IHLPP-------STVSAMAMYIARRMTNRNKNELWNGTLQHYS 368          
BLAST of Cyclin domain protein vs. Ensembl Yeast
Match: CLB2 (B-type cyclin involved in cell cycle progression; activates Cdc28p to promote the transition from G2 to M phase; accumulates during G2 and M, then targeted via a destruction box motif for ubiquitin-mediated degradation by the proteasome; CLB2 has a paralog, CLB1, that arose from the whole genome duplication [Source:SGD;Acc:S000006323])

HSP 1 Score: 72.7886 bits (177), Expect = 3.841e-14
Identity = 59/234 (25.21%), Postives = 109/234 (46.58%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYT-FYSVTQLKECVLIYMEMLINIFISTKY 1440
            EY   +F+YL++ E      K  L  +      R  L++WL+K+     +  ETL + + ++D F    L++    QLVG + + IA K  + + P IK F   T+       + + E+ +L+ L F +N P P +F  R  ++  +  D         F+ ++ ++     GI  S  +AAA+FM+R +       W   L HY+  Y+  +L     + M+ L++  +  ++
Sbjct:  228 EYVNDIFEYLHQLEVITLPKKEDLYQHRNIHQNRDILVNWLVKIHNKFGLLPETLYLAINIMDRFLGKELVQLDKLQLVGTSCLFIASKYEEVYSPSIKHFASETDGACTEDEIKEGEKFILKTLKFNLNYPNPMNFLRR--ISKADDYDIQ-SRTLAKFLLEISLVDFRFIGILPSLCAAAAMFMSRKMLGK--GKWDGNLIHYSGGYTKEELAPVCHMIMDYLVSPIVHDEF 456          
BLAST of Cyclin domain protein vs. Ensembl Nematostella
Match: EDO34387 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPG5])

HSP 1 Score: 102.449 bits (254), Expect = 3.594e-24
Identity = 68/244 (27.87%), Postives = 119/244 (48.77%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLA-LNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYS 1470
            EY   + ++L   E     +  Y+       E  R  L+DWL++V L  ++  ETL + + +ID F ++  + K   QLVG+  ML+A K  + F P I +F Y+T+  Y    + QME ++  KL+F +  P+  HF  R   A     + + M     ++ +L ++   S     S  +AA++ +A  +   +   WT  L+HY+ YS  +L  C+    ++++    S +   KAV  KY+
Sbjct:   34 EYAKEIMRFLRAMEEHYSVSPTYMNNQQEVNEKMRAILLDWLVQVHLKFRLLQETLYITMSIIDRFLAVHQVSKRELQLVGVGAMLLASKYEEMFAPEIGDFVYITDHAYTKKQIRQMESLIFRKLDFSLGKPLCLHFLRRNSKAGAVGAEEHTM---AKYLMELTLIDYQSIKFLPSEIAAASLSLAMRVM-GKGSEWTPTLEHYSGYSEKKLSTCMQRLAQLVLGARDSKQ---KAVYNKYA 270          
BLAST of Cyclin domain protein vs. Ensembl Nematostella
Match: EDO39942 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8H6])

HSP 1 Score: 95.5153 bits (236), Expect = 2.078e-22
Identity = 73/237 (30.80%), Postives = 112/237 (47.26%), Query Frame = 1
Query:  835 SFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILH----PASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYSLNVKKAIAKNDKLINFIEDLN 1533
            S R  L+DWL++VQ   ++  ETL +GV ++D +   + +++   QLVG   + IACK+ +R  P + +F Y+ +D Y+    V ME+ +L  L F +N+PIP  F  R   A V   D   +     F+ +  + H       P   ++     A+ M           WT  + HYT YSV QL  CV+   EM+       K     V+ KYS  V   +A    LI  ++ LN
Sbjct:   10 SMRAILVDWLVEVQESFELYHETLYLGVRVLDNYLMRSYVERENLQLVGAVSLYIACKVEERHPPCLDDFLYICDDAYQQKAFVAMEKKILNSLEFNINMPIPYRFLRR--FAKVASADVKTL-TLSRFILETTLHHYKFIVHKPSFLAAACLRLALRMKGC------DDWTPTVVHYTGYSVAQLDGCVIELNEMISE---PPKQNLMTVRNKYSHKVFHEVA----LIPPLDSLN 230          
BLAST of Cyclin domain protein vs. Ensembl Nematostella
Match: EDO37884 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEI5])

HSP 1 Score: 95.5153 bits (236), Expect = 8.440e-22
Identity = 68/227 (29.96%), Postives = 114/227 (50.22%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLALN-GFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNL-------MEAFCNFMFDLIILHPASPGIR--SSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECV 1392
            EY   +FKYL + E   +    Y+        S R  L+DWL++V    K+  +TL + V  ID F S   + +   QLVG A ML+A K  + + P + EF Y+T+D Y    V++ME+++L+ L F ++VP   +F  R + A      TN+       +EA   ++ ++ +L  + P ++   S  +A+AI ++       Y  W   L HYT + +  L+ C+
Sbjct:   40 EYASDIFKYLKQAELNNRAKPGYMRKQPDINNSMRAILVDWLVEVAEEYKLLPQTLYLTVNYIDRFLSAMSVLRGKLQLVGTACMLLASKFEEIYPPEVSEFVYITDDTYTAKQVLKMEQLVLKVLTFDLSVPTILNFLERFIKA------TNVPESMAPKVEALARYLCEISLLD-SEPFLKYLPSTIAASAIVLSLHTLGLSY--WNNTLSHYTGFELHDLQTCI 257          
BLAST of Cyclin domain protein vs. Ensembl Nematostella
Match: EDO32608 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUL2])

HSP 1 Score: 73.1738 bits (178), Expect = 5.091e-15
Identity = 44/155 (28.39%), Postives = 77/155 (49.68%), Query Frame = 1
Query:  841 RTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMAR 1305
            R  L+DWLI+V L+     + L + V L+D + S+  +  + +QL+G+A +L+ACK   RF P  +E   + +  +    ++ ME  +L  L F +  P+P  F      A    ++T ++     F+ +  +L       + S  +A A FMAR
Sbjct:   46 RAVLIDWLIEVHLFYNFPQDCLYLIVALVDRYMSLRTVPVAHFQLLGMACLLVACKYEDRFVPTREELVAMADQAFDQSELMHMETRLLTCLEFDLAQPLPTFFLRPIARASAIDLETYVVS---KFIMEAAMLDAIMVTFKPSIIAATAFFMAR 197          
BLAST of Cyclin domain protein vs. Ensembl Nematostella
Match: EDO33920 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQU4])

HSP 1 Score: 69.3218 bits (168), Expect = 3.562e-13
Identity = 40/126 (31.75%), Postives = 70/126 (55.56%), Query Frame = 1
Query:  757 MFKYLYEREREIKFNKNYLALNG---FEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITL-IKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNF 1122
            ++ Y+ E++R  K+ K++L L      +   R  L+DWLI+V    ++  ET  + V  +D + S+   I K   QLVG   + IA K+ + + P++ EF Y+T+   K   ++Q E +ML+ LN+
Sbjct:   14 LWSYMLEKDR--KYTKDHLYLRQHPHLQPRMRAILLDWLIEVCEVYRLHRETYFLAVDFVDRYLSVKKDIPKQRLQLVGTTALFIAAKLEEIYPPKLSEFAYVTDGACKEDEILQQELLMLQDLNW 137          
BLAST of Cyclin domain protein vs. Ensembl Medaka
Match: ccnb2 (cyclin B2 [Source:NCBI gene;Acc:100049213])

HSP 1 Score: 114.775 bits (286), Expect = 1.929e-27
Identity = 87/338 (25.74%), Postives = 156/338 (46.15%), Query Frame = 1
Query:  550 KPTRFTFSHNRTSFKHGSKITDLSSEDNLVMICQ-----LLLIRTVTPKSKEMSNLSEQFDMKIDENFFEYYPYMFKYLYEREREIKFNKNYLALNGFE--ESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYSLNVKKAIAKNDKL--INFIEDLNS 1536
            KPT+   S  +T     + +    S      +CQ     LL ++ V  +  +   L  Q+   I           +KYL+  E +     NY+   G+E  E  R  L+DWL++V    ++  ETL + V ++D F  +  + +   QLVG+  ML+ACK  + + P + +F Y+T++ +    +V+ME+++L  L+F +  P+P HF  R        ++ +       ++ +L +L       R S  +AAA+ +++ +   +   W+   Q Y+ Y    LK  ++ +M   + +    +  F AVK+KYS         + KL  I+ I  LNS
Sbjct:   65 KPTQLVASMIQTGAAASAPVLAKPSVKEEQELCQAFSEVLLAVQDVDEQDADQPQLCSQYVKDI-----------YKYLHILEEQQPVRANYM--QGYEVTERMRALLVDWLVQVHSRFQLLQETLYLTVAILDRFLQVHPVSRRKLQLVGVTAMLVACKYEEMYAPEVGDFAYITDNAFTKSQIVEMEQVILRSLSFQLGRPLPLHFLRRATKVAGADVEKH---TLAKYLMELTLLDYHMVHYRPSEVAAAALCLSQLLL--DGLPWSLTQQQYSTYEEQHLKP-IMQHMAKNVVLVNEGRTKFLAVKKKYS---------SSKLMKISLIPQLNS 374          
BLAST of Cyclin domain protein vs. Ensembl Medaka
Match: ccnb3 (cyclin B3 [Source:NCBI gene;Acc:101158560])

HSP 1 Score: 106.686 bits (265), Expect = 1.970e-24
Identity = 75/250 (30.00%), Postives = 117/250 (46.80%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDT-NLMEAFCNFMF---DLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYSLNV 1479
            EY   +F YL ERE +   +   L         R  L+DWL++VQ   ++  ETL + V + D + S   I +   QLVG   MLIA K  +R  P + +F Y+ +D YK   ++ ME  +L+ L+F +N+PIP  F  R        ++T  L   +C       DL+         R S  ++A + MA  +   +  SW+ ILQ   F+S  Q  E   +  ++ + +        +AV+ KYS  V
Sbjct:  167 EYAKDIFDYLKEREEKFVLSNYMLTHTSLNPEMRAILVDWLVEVQENFELYHETLYLAVKMTDHYLSKASIHREMLQLVGSTAMLIASKFEERSPPCVDDFLYICDDAYKREELISMEASILQTLSFDINIPIPYRFLRRYAKCVSASMETLTLARYYCEMSLMEMDLV-------SERGSLLASACLLMA--LITKDLGSWSPILQ---FHSGYQASEVAPVVRKLHLMLQGPADDKLRAVRNKYSHKV 404          
BLAST of Cyclin domain protein vs. Ensembl Medaka
Match: ccnb3 (cyclin B3 [Source:NCBI gene;Acc:101158560])

HSP 1 Score: 105.916 bits (263), Expect = 2.213e-24
Identity = 75/250 (30.00%), Postives = 117/250 (46.80%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDT-NLMEAFCNFMF---DLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYSLNV 1479
            EY   +F YL ERE +   +   L         R  L+DWL++VQ   ++  ETL + V + D + S   I +   QLVG   MLIA K  +R  P + +F Y+ +D YK   ++ ME  +L+ L+F +N+PIP  F  R        ++T  L   +C       DL+         R S  ++A + MA  +   +  SW+ ILQ   F+S  Q  E   +  ++ + +        +AV+ KYS  V
Sbjct:  123 EYAKDIFDYLKEREEKFVLSNYMLTHTSLNPEMRAILVDWLVEVQENFELYHETLYLAVKMTDHYLSKASIHREMLQLVGSTAMLIASKFEERSPPCVDDFLYICDDAYKREELISMEASILQTLSFDINIPIPYRFLRRYAKCVSASMETLTLARYYCEMSLMEMDLV-------SERGSLLASACLLMA--LITKDLGSWSPILQ---FHSGYQASEVAPVVRKLHLMLQGPADDKLRAVRNKYSHKV 360          
BLAST of Cyclin domain protein vs. Ensembl Medaka
Match: ccna2 (cyclin A2 [Source:NCBI gene;Acc:101166612])

HSP 1 Score: 100.908 bits (250), Expect = 1.959e-22
Identity = 82/265 (30.94%), Postives = 125/265 (47.17%), Query Frame = 1
Query:  697 NLSEQFDMKIDEN-FFEYYPYMFKYLYEREREIKFNKNYLALN-GFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPN-----HFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFIS-TKYTFKAVKEKY 1467
            +L E  D +++ N   EY   +  YL E E + +    Y+        S R  L+DWL++V    K+  ETL + V  ID F S   + +   QLVG A ML+A K  + + P + EF Y+T+D Y    V++ME ++L+ L+F +  P  N     +FCH G+   VE +   L E        LI   P    + S   +AA I     +      SW K L   T Y +  L  C+    E L  +F+S  ++  ++V+EKY
Sbjct:  158 SLVEVDDKQVNVNEVPEYAAEIHLYLREMEVKTRPKAGYMKKQPDITNSMRAILVDWLVEVGEEYKLHNETLYLAVNYIDRFLSSMSVLRGKLQLVGTAAMLLAAKFEEIYPPEVAEFVYITDDTYTKKQVLRMEHLVLKVLSFDLAAPTINQFLTQYFCHHGVNKQVESLAMYLGE------LSLIDSDPFLKYLPSQTAAAAYILANHAVTGG---SWPKSLAEMTGYMLVDLMPCI----EDLHKMFLSAAQHAQQSVREKY 409          
BLAST of Cyclin domain protein vs. Ensembl Medaka
Match: ccnb1 (cyclin B1 [Source:NCBI gene;Acc:100049212])

HSP 1 Score: 90.1225 bits (222), Expect = 3.275e-19
Identity = 69/267 (25.84%), Postives = 122/267 (45.69%), Query Frame = 1
Query:  742 EYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYSLNVKKAIAKNDKL-INFIEDLNSK 1539
            EY   ++KYL + E E     NYL       + R  L+DWL++V L  ++  ET+ + V +ID F     + K   QLVG+  M +A K  + + P I +F Y+T+  Y    +  ME  +L  L F +  P+P  F  R      E+  T        ++ +L ++         S  ++AA+ +   +   +   W   LQHY  Y+   L   +    + ++ +  + +    A+K KYS + +  IA   +L  + ++DL ++
Sbjct:  103 EYVKDIYKYLRQLEMEQSVKPNYLEGQEITGNMRAILIDWLVQVGLKFRLLQETMYMTVGIIDRFLQDHPVPKKQLQLVGVTAMFLASKYEEMYPPEISDFAYVTDRAYTTAQIRDMEMTILRVLKFQLGRPLPLQFLRRA-SKIYEV--TAEQHTLAKYLLELSMVDYDMAHFPPSLVASAALALTLKVL--DAGEWDVTLQHYMEYTAETLTPVMAHIAKNVVKVN-NGQTKHMAIKGKYSTSKQMRIATISQLKSSVVKDLATQ 363          
BLAST of Cyclin domain protein vs. Planmine SMEST
Match: SMESG000048937.1 (SMESG000048937.1)

HSP 1 Score: 926.776 bits (2394), Expect = 0.000e+0
Identity = 482/482 (100.00%), Postives = 482/482 (100.00%), Query Frame = 1
Query:  121 MPIYTSSQRKSLIPDAYKKGSSLQKFYKTTPYYERRKSSPYIQEKNVTENKLEFASDSLLQQRKSKISLSKVKRMKCFIRRYXXXXXXXXXXXXXETRKSNLSSDRFSQLRHIWXXXXXXXXXXXXXXXXQSERKHVSNTPTSKPTRFTFSHNRTSFKHGSKITDLSSEDNLVMICQLLLIRTVTPKSKEMSNLSEQFDMKIDENFFEYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYSLNVKKAIAKNDKLINFIEDLNSKQRIINYFEK 1566
            MPIYTSSQRKSLIPDAYKKGSSLQKFYKTTPYYERRKSSPYIQEKNVTENKLEFASDSLLQQRKSKISLSKVKRMKCFIRRYSKSTKLSSSNSNNETRKSNLSSDRFSQLRHIWSKERSKPKPKPIIPRRQSERKHVSNTPTSKPTRFTFSHNRTSFKHGSKITDLSSEDNLVMICQLLLIRTVTPKSKEMSNLSEQFDMKIDENFFEYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYSLNVKKAIAKNDKLINFIEDLNSKQRIINYFEK
Sbjct:    1 MPIYTSSQRKSLIPDAYKKGSSLQKFYKTTPYYERRKSSPYIQEKNVTENKLEFASDSLLQQRKSKISLSKVKRMKCFIRRYSKSTKLSSSNSNNETRKSNLSSDRFSQLRHIWSKERSKPKPKPIIPRRQSERKHVSNTPTSKPTRFTFSHNRTSFKHGSKITDLSSEDNLVMICQLLLIRTVTPKSKEMSNLSEQFDMKIDENFFEYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYSLNVKKAIAKNDKLINFIEDLNSKQRIINYFEK 482          
BLAST of Cyclin domain protein vs. Planmine SMEST
Match: SMESG000077303.1 (SMESG000077303.1)

HSP 1 Score: 48.9062 bits (115), Expect = 3.213e-6
Identity = 48/194 (24.74%), Postives = 85/194 (43.81%), Query Frame = 1
Query:  859 WLIKVQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQRFHPRIKEFCYLTEDCYKP--GHVVQMERIMLEKLNFFVNVPIPNHFCHRGLLACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYTEYP----SWTKILQHYTFYSVTQLKECVLIYMEMLINI 1422
            W I +   ++++ +++ + + L D +  I  +KK +   +GI  + IA KI   F   +K     T   Y    G    ME  +L +L+F VN+P P  F  R     V   +T    A   F+ DL +      G+  S  +A++ F        + P    SW  +L+ Y+ +  + +   +   + MLIN+
Sbjct:    2 WFITIANKTEISNDSIHLAIALFDYYYQI--VKKDYNLYIGIIMLWIASKIEDSFPISLKNIINHTHLNYDEIHGQCKTMELDILNELDFDVNLPTPIQFL-RHFTKIVHTTETCHQTA--KFIIDLTLTDNKFIGLNYSLMAASS-FCIALDLIKKVPEMGDSWNTLLKRYSSFDKSNILPVMKEMVAMLINL 189          
The following BLAST results are available for this feature:
BLAST of Cyclin domain protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CCNB12.647e-2229.84cyclin B1 [Source:HGNC Symbol;Acc:HGNC:1579][more]
CCNB25.890e-2226.28cyclin B2 [Source:HGNC Symbol;Acc:HGNC:1580][more]
CCNB18.650e-2230.09cyclin B1 [Source:HGNC Symbol;Acc:HGNC:1579][more]
CCNA11.511e-2129.43cyclin A1 [Source:HGNC Symbol;Acc:HGNC:1577][more]
CCNA11.511e-2129.43cyclin A1 [Source:HGNC Symbol;Acc:HGNC:1577][more]
back to top
BLAST of Cyclin domain protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cya-12.131e-1525.40G2/mitotic-specific cyclin-A1 [Source:UniProtKB/S... [more]
cyb-2.28.426e-1526.62CYclin B [Source:UniProtKB/TrEMBL;Acc:Q9BLB5][more]
cyb-2.28.426e-1526.62CYclin B [Source:UniProtKB/TrEMBL;Acc:Q9BLB5][more]
cyb-16.538e-1425.00G2/mitotic-specific cyclin-B1 [Source:UniProtKB/S... [more]
cyb-16.538e-1425.00G2/mitotic-specific cyclin-B1 [Source:UniProtKB/S... [more]
back to top
BLAST of Cyclin domain protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CycB32.147e-2027.70gene:FBgn0015625 transcript:FBtr0334578[more]
CycB32.147e-2027.70gene:FBgn0015625 transcript:FBtr0084728[more]
CycB3.571e-2025.59gene:FBgn0000405 transcript:FBtr0071914[more]
CycB4.194e-2025.59gene:FBgn0000405 transcript:FBtr0071913[more]
CycB5.098e-2025.59gene:FBgn0000405 transcript:FBtr0309858[more]
back to top
BLAST of Cyclin domain protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccnb35.708e-2429.46cyclin B3 [Source:ZFIN;Acc:ZDB-GENE-060929-684][more]
ccnb35.708e-2429.46cyclin B3 [Source:ZFIN;Acc:ZDB-GENE-060929-684][more]
ccnb35.708e-2429.46cyclin B3 [Source:ZFIN;Acc:ZDB-GENE-060929-684][more]
ccnb28.328e-2325.68cyclin B2 [Source:ZFIN;Acc:ZDB-GENE-030429-12][more]
ccna22.460e-2029.39cyclin A2 [Source:ZFIN;Acc:ZDB-GENE-020418-1][more]
back to top
BLAST of Cyclin domain protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000018933.13.338e-2327.38cyclin B5 [Source:NCBI gene;Acc:394448][more]
ENSXETT00000033191.14.095e-2327.38cyclin B5 [Source:NCBI gene;Acc:394448][more]
ENSXETT00000016677.14.544e-2329.68cyclin B3 [Source:NCBI gene;Acc:100494711][more]
ENSXETT00000033175.15.329e-2327.38cyclin B5 [Source:NCBI gene;Acc:394448][more]
ENSXETT00000016648.16.551e-2330.23cyclin B3 [Source:NCBI gene;Acc:100494711][more]
back to top
BLAST of Cyclin domain protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ccnb21.525e-2225.91cyclin B2 [Source:MGI Symbol;Acc:MGI:88311][more]
Ccnb12.166e-2231.67cyclin B1 [Source:MGI Symbol;Acc:MGI:88302][more]
Ccna28.787e-2228.04cyclin A2 [Source:MGI Symbol;Acc:MGI:108069][more]
Ccna22.309e-2127.88cyclin A2 [Source:MGI Symbol;Acc:MGI:108069][more]
Ccna11.099e-2028.62cyclin A1 [Source:MGI Symbol;Acc:MGI:108042][more]
back to top
BLAST of Cyclin domain protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9FMH5|CCA31_ARATH1.111e-2830.98Putative cyclin-A3-1 OS=Arabidopsis thaliana OX=37... [more]
sp|A0MEB5|CCA33_ARATH6.668e-2830.65Cyclin-A3-3 OS=Arabidopsis thaliana OX=3702 GN=CYC... [more]
sp|Q9DG99|CCNB2_ORYJA1.026e-2727.61G2/mitotic-specific cyclin-B2 OS=Oryzias javanicus... [more]
sp|Q9C6Y3|CCA11_ARATH3.152e-2731.47Cyclin-A1-1 OS=Arabidopsis thaliana OX=3702 GN=CYC... [more]
sp|Q9C6A9|CCA32_ARATH5.072e-2631.85Cyclin-A3-2 OS=Arabidopsis thaliana OX=3702 GN=CYC... [more]
back to top
BLAST of Cyclin domain protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D2DJT49.517e-62100.00CyclinA-like protein (Fragment) OS=Schmidtea medit... [more]
A0A183AY117.762e-3636.84Cyclin N-terminal domain-containing protein OS=Ech... [more]
A0A4Z2DTV01.458e-3538.27G2/mitotic-specific cyclin-B1 isoform 1 OS=Schisto... [more]
A0A4E0R5N25.446e-3532.33Putative cyclin OS=Fasciola hepatica OX=6192 GN=D9... [more]
A0A074ZNV43.230e-3433.22Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
back to top
BLAST of Cyclin domain protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccnb28.616e-2528.90G2/mitotic-specific cyclin-B2 [Source:NCBI gene;Ac... [more]
ccnb31.901e-2428.19G2/mitotic-specific cyclin-B3-like [Source:NCBI ge... [more]
ccnb32.932e-2428.11G2/mitotic-specific cyclin-B3-like [Source:NCBI ge... [more]
ccnb25.708e-2429.28G2/mitotic-specific cyclin-B2 [Source:NCBI gene;Ac... [more]
ccnb21.009e-2228.02G2/mitotic-specific cyclin-B2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Cyclin domain protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ccnb22.204e-2227.15cyclin B2 [Source:ZFIN;Acc:ZDB-GENE-030429-12][more]
ccna16.336e-1533.08cyclin A1 [Source:ZFIN;Acc:ZDB-GENE-040311-2][more]
ccne12.874e-932.17cyclin E1 [Source:NCBI gene;Acc:30188][more]
back to top
BLAST of Cyclin domain protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CLB42.489e-1727.06B-type cyclin involved in cell cycle progression; ... [more]
CLB34.221e-1727.06B-type cyclin involved in cell cycle progression; ... [more]
CLB66.119e-1527.75B-type cyclin involved in DNA replication during S... [more]
CLB51.057e-1428.57B-type cyclin involved in DNA replication during S... [more]
CLB23.841e-1425.21B-type cyclin involved in cell cycle progression; ... [more]
back to top
BLAST of Cyclin domain protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO343873.594e-2427.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399422.078e-2230.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378848.440e-2229.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326085.091e-1528.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339203.562e-1331.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cyclin domain protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccnb21.929e-2725.74cyclin B2 [Source:NCBI gene;Acc:100049213][more]
ccnb31.970e-2430.00cyclin B3 [Source:NCBI gene;Acc:101158560][more]
ccnb32.213e-2430.00cyclin B3 [Source:NCBI gene;Acc:101158560][more]
ccna21.959e-2230.94cyclin A2 [Source:NCBI gene;Acc:101166612][more]
ccnb13.275e-1925.84cyclin B1 [Source:NCBI gene;Acc:100049212][more]
back to top
BLAST of Cyclin domain protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000048937.10.000e+0100.00SMESG000048937.1[more]
SMESG000077303.13.213e-624.74SMESG000077303.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021342 ID=SMED30021342|Name=Cyclin domain protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1655bp
GATAAATAGAACAACCAAACGCGTTGTCATAACGCAAAACGCAACGTACC
TTGGCACTTCGATATCTTAATCATTACAAAATCTAGTTCTTCATTTTCAT
AATAAATTTTTTAAAAACGTATGCCTATCTATACGAGTTCACAAAGGAAA
TCACTCATTCCCGATGCCTATAAAAAAGGCTCGAGCTTGCAAAAGTTTTA
TAAAACCACGCCATATTATGAAAGAAGGAAATCATCACCTTATATTCAAG
AAAAAAATGTTACTGAGAACAAGTTAGAATTCGCCAGTGATTCTCTATTG
CAGCAAAGGAAATCTAAAATTTCGTTGTCAAAAGTGAAAAGAATGAAATG
CTTTATTCGACGATATTCAAAATCGACGAAACTCTCGTCGAGTAACTCAA
ACAATGAAACAAGGAAATCAAACCTGTCATCAGACCGATTTTCACAATTA
CGACACATTTGGAGTAAAGAACGGTCAAAACCAAAACCCAAGCCAATAAT
TCCAAGACGACAAAGTGAAAGAAAGCATGTCTCAAATACACCGACATCAA
AACCTACTCGTTTTACCTTTTCACATAATCGAACGAGTTTTAAACACGGT
TCGAAGATCACGGACCTTTCAAGTGAGGATAATCTAGTGATGATTTGCCA
GTTGTTACTTATACGAACTGTAACACCAAAGAGTAAAGAAATGTCGAATT
TATCGGAGCAATTCGACATGAAAATAGATGAAAACTTCTTTGAATATTAT
CCTTATATGTTCAAGTATCTTTATGAGAGAGAGCGAGAGATAAAATTCAA
CAAAAACTACTTAGCTTTGAATGGGTTCGAGGAAAGCTTCCGTACTACTC
TAATGGATTGGCTGATAAAGGTCCAGTTATATTCGAAAATGACTACCGAA
ACTCTACAGGTCGGAGTGGTACTCATTGACATGTTCACATCCATTACTCT
TATAAAGAAGTCTTTCTATCAACTCGTTGGGATTGCCGGGATGTTAATTG
CTTGCAAAATTGTGCAGAGATTTCACCCAAGAATCAAGGAGTTCTGTTAT
CTTACTGAAGACTGCTATAAACCAGGACATGTTGTGCAAATGGAAAGGAT
AATGTTGGAAAAATTGAACTTCTTCGTCAACGTTCCCATTCCAAATCATT
TTTGTCATCGTGGTTTATTGGCCTGTGTTGAGATCATTGACACGAATTTA
ATGGAAGCATTCTGCAATTTCATGTTTGATCTGATAATCCTTCATCCAGC
GAGCCCAGGGATAAGATCTTCGTGTAAATCAGCAGCTGCCATATTTATGG
CTAGGTTTATATTCTACACCGAATACCCGTCTTGGACAAAGATCTTACAG
CATTATACATTTTACAGTGTTACCCAATTGAAGGAATGCGTTTTGATTTA
TATGGAAATGCTGATCAACATTTTCATATCTACCAAATACACATTCAAAG
CTGTCAAAGAAAAGTATTCCTTGAATGTGAAAAAAGCAATTGCAAAGAAT
GATAAGCTCATCAACTTTATAGAAGACCTCAATTCCAAACAAAGAATTAT
TAATTACTTCGAAAAGTAAATGGAAAACACTAGCACGGTTCAGCTGACCC
CGGCGTAAAGGTGAGAACTCAAATTTTGTGCTTCACCTATGCGGTCATGG
CTGAT
back to top

protein sequence of SMED30021342-orf-1

>SMED30021342-orf-1 ID=SMED30021342-orf-1|Name=SMED30021342-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=483bp
MPIYTSSQRKSLIPDAYKKGSSLQKFYKTTPYYERRKSSPYIQEKNVTEN
KLEFASDSLLQQRKSKISLSKVKRMKCFIRRYSKSTKLSSSNSNNETRKS
NLSSDRFSQLRHIWSKERSKPKPKPIIPRRQSERKHVSNTPTSKPTRFTF
SHNRTSFKHGSKITDLSSEDNLVMICQLLLIRTVTPKSKEMSNLSEQFDM
KIDENFFEYYPYMFKYLYEREREIKFNKNYLALNGFEESFRTTLMDWLIK
VQLYSKMTTETLQVGVVLIDMFTSITLIKKSFYQLVGIAGMLIACKIVQR
FHPRIKEFCYLTEDCYKPGHVVQMERIMLEKLNFFVNVPIPNHFCHRGLL
ACVEIIDTNLMEAFCNFMFDLIILHPASPGIRSSCKSAAAIFMARFIFYT
EYPSWTKILQHYTFYSVTQLKECVLIYMEMLINIFISTKYTFKAVKEKYS
LNVKKAIAKNDKLINFIEDLNSKQRIINYFEK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0042025host cell nucleus
GO:0005634nucleus
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR039361Cyclin
IPR036915Cyclin-like_sf
IPR013763Cyclin-like
IPR004367Cyclin_C-dom
IPR006671Cyclin_N
Vocabulary: biological process
TermDefinition
GO:0000079regulation of cyclin-dependent protein serine/threonine kinase activity
GO:0010389regulation of G2/M transition of mitotic cell cycle
Vocabulary: molecular function
TermDefinition
GO:0019901protein kinase binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004367Cyclin, C-terminal domainSMARTSM01332Cyclin_C_2coord: 339..463
e-value: 7.2E-9
score: 45.5
IPR004367Cyclin, C-terminal domainPFAMPF02984Cyclin_Ccoord: 339..453
e-value: 2.4E-12
score: 47.0
IPR013763Cyclin-likeSMARTSM00385cyclin_7coord: 342..429
e-value: 0.87
score: 11.3
coord: 246..330
e-value: 5.7E-12
score: 55.8
IPR013763Cyclin-likeCDDcd00043CYCLINcoord: 241..329
e-value: 3.9287E-12
score: 59.9448
IPR006671Cyclin, N-terminalPFAMPF00134Cyclin_Ncoord: 213..335
e-value: 2.1E-25
score: 88.9
NoneNo IPR availableGENE3DG3DSA:1.10.472.10coord: 213..458
e-value: 2.1E-53
score: 182.9
NoneNo IPR availableGENE3DG3DSA:1.10.472.10coord: 226..337
e-value: 2.1E-53
score: 182.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 113..137
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 113..148
NoneNo IPR availablePANTHERPTHR10177:SF212CYCLIN-A2-1coord: 191..458
IPR039361CyclinPIRSFPIRSF001771Cyclin_A_B_D_Ecoord: 16..474
e-value: 1.4E-52
score: 177.1
IPR039361CyclinPANTHERPTHR10177CYCLINEcoord: 191..458
IPR036915Cyclin-like superfamilySUPERFAMILYSSF47954Cyclin-likecoord: 338..459
IPR036915Cyclin-like superfamilySUPERFAMILYSSF47954Cyclin-likecoord: 206..334