DUF659 domain-containing protein

Overview
NameDUF659 domain-containing protein
Smed IDSMED30021337
Length (bp)2136
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF659 domain-containing protein (SMED30021337) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF659 domain-containing protein (SMED30021337) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF659 domain-containing protein (SMED30021337) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF659 domain-containing protein (SMED30021337) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of DUF659 domain-containing protein vs. TrEMBL
Match: A0A177AU62 (Uncharacterized protein OS=Intoshia linei OX=1819745 GN=A3Q56_07514 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 3.881e-20
Identity = 45/130 (34.62%), Postives = 71/130 (54.62%), Query Frame = 3
Query: 1602 AKSAWAEPNLMKDLL-VKKCYEVLIYTLENLAQDRYNISTAYYEINRLNLKHDPLELKNYISQRLADNDAKSICELQNENMSPTIYSFLRNCPPTSIVAERSFSMVKRILAIGRNFDPKNVANYINVYYN 1988
             K A    NL ++L+ +   Y  L   ++     +Y IS A  ++N LN K +   +K Y+ +RL ++D K I  L  E+++P+ Y+ L  C  TSI  ER FS++  I A  RNF  +N+A Y+ + YN
Sbjct:  205 VKVAVNHLNLCRELVDIMHNYYFLYTLIKQSCSVKYTISDAIDDLNNLNFKRNHASIKLYVEKRLINSDIKGIEHLIREDITPSQYAKLLMCQATSISVERRFSILHTINAKERNFKAENLAEYVLLKYN 334          

HSP 2 Score: 46.595 bits (109), Expect = 3.881e-20
Identity = 26/72 (36.11%), Postives = 38/72 (52.78%), Query Frame = 1
Query: 1384 RIRAAYKNIDKVIGSLKALTIKNKERQNPFSEIGSPPSVVLTRWTSWLRVVIYYCKNLLAIKNIV*NIGDDG 1599
            +I + YKN + ++ S+     K+K R   F  I   P+   TR+  WL+V+ Y+ K  L IKNIV     DG
Sbjct:  128 KIASYYKNANNLVISMNLALSKSKARNKLFKNIPLHPTFCKTRFGDWLKVIEYFSKYYLYIKNIVDAFETDG 199          

HSP 3 Score: 34.2686 bits (77), Expect = 3.881e-20
Identity = 20/57 (35.09%), Postives = 29/57 (50.88%), Query Frame = 2
Query: 1244 NVKTSSFMMLISDAASYMKNAGEVYKSRN-----------HDFLYVKCLNHLIHNSS 1381
            N+  ++F++LI+DAASYM   GE  K               +  +V C+ HL HN S
Sbjct:   70 NLNPNNFILLITDAASYMVLGGEKLKYEKFILENNVEIAFKNLFHVTCVVHLYHNMS 126          
BLAST of DUF659 domain-containing protein vs. TrEMBL
Match: A0A1Y1S4J3 (C2H2-type domain-containing protein OS=Enterospora canceri OX=1081671 GN=ECANGB1_289 PE=4 SV=1)

HSP 1 Score: 92.4337 bits (228), Expect = 1.742e-19
Identity = 65/235 (27.66%), Postives = 118/235 (50.21%), Query Frame = 2
Query:  680 LIRRYTRQYSQKFGVGPHKTLYRNICNTSVDFKKKFNVCVHRKTKAHIIPYRTVLTQTFFSPTDKEFTFLVVEAFLSADISXXXXXXXXXXXXXXRMKHKLPSESTARNYVKQVSAQFDLKVQSKLQNRKIFIVFDENEILGQRYCNVMCGCIESPHEIWLINSVAITTPVNSTLVVSIIDNSL*KYNNVKTSSFMMLISDAASYMKNAGEVYKSRNHDFLYVKCLNHLIHNSSI 1384
            +++ Y  ++ Q   V  +  L    C     F     +  H  T +H+   +T+L         ++    V +AFL ADI L+KL    +K LF  M    P+EST R +V +++ + +++++S L N+ +F++FD +   G  Y N+M G IE P + +LIN +       S  + + I++SL  + N+  +   M+ISD A Y     ++ K +    +++ C  HL+HN ++
Sbjct:    1 MLKEYAMRFKQHGIVLRYNKLMCKFCRCRAIFLNLSGIKQHISTNSHLSNEQTILESRKKQLIQEQLPEKVAKAFLEADIPLKKLRIPAIKELFQSMGFICPAESTTRRFVDKINNEMNMQIKSHLYNKLLFLMFDGSCKAGLHYINIMAGDIEEPSKKYLINQIVTVESETSERLFTYINDSLSLF-NLHFTDVKMIISDGAPYNTKLKKLIKRQERSIVFITCFMHLLHNCAM 234          

HSP 2 Score: 34.6538 bits (78), Expect = 1.742e-19
Identity = 15/40 (37.50%), Postives = 25/40 (62.50%), Query Frame = 1
Query: 1384 RIRAAYKNIDKVIGSLKALTIKNKERQNPFSEIGSPPSVV 1503
            +IR  YK  D+ I S+K +T++  + ++    +G PPSVV
Sbjct:  235 KIRQTYKLTDQFIASVKDITVRCNKYRDLIEFVGKPPSVV 274          
BLAST of DUF659 domain-containing protein vs. TrEMBL
Match: A0A2S2QMU3 (CGG triplet repeat-binding protein 1 (Fragment) OS=Sipha flava OX=143950 GN=Cggbp1_4 PE=4 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 1.855e-19
Identity = 75/257 (29.18%), Postives = 129/257 (50.19%), Query Frame = 2
Query:  650 MIRPKQNDNDLIRRYTRQYSQKFGVGPHKTLYRNICNTSVDFKKKFNVCVHRKTKAHII--------PYRT-VLTQTFFSPTDKEFTFLVVEAFLSADISXXXXXXXX-XXXXXXRMKHKLPSESTAR-NYVKQVSAQFDLKVQSKLQNRKIFIVFDE-NEILGQRYCNVMCG--CIESPHEIWLINSVAITTPVNSTLVVSIIDNS--L*KYNNVKTSSFMMLISDAASYMKNAGEVYKSRNHDFLYVKCLNHLIH 1372
            M RPK    D +  + +++ +   +  +  L+  IC+  V  +K+F V  H KT  HI         P +T  L  T FS  + +F   + +A LSA+I L KL N +  + L L  K ++P E+T R  YV  +  +   K+++ +  +KI++  DE  +  G+   NV+ G   ++ P  I+L+NS  +    +ST +  + D S  L     VK +  ++ ++DAA YM  AG+  ++     ++V CL H +H
Sbjct:    1 MPRPKPKTYDRLNNFIKEFGETIFLADNSVLFCKICDIKVSVEKRFTVIQHIKTAKHIQGLNRLQLKPTKTQQLVSTSFSKKN-DFNRDLCKAMLSANIPLYKLENKQFREFLELYTKKEIPKEATLRKGYVDDLFLETIEKIKNCVDGKKIWVSIDETTDAEGRFIANVIIGTLTVDDPGSIFLLNSEKLEKSNHST-IFKLFDQSMNLLWPQGVKYNEVLLFVTDAAPYMIKAGKTIQNLYTKIIHVTCLAHGLH 255          

HSP 2 Score: 50.447 bits (119), Expect = 1.855e-19
Identity = 23/69 (33.33%), Postives = 36/69 (52.17%), Query Frame = 1
Query: 1384 RIRAAYKNIDKVIGSLKALTIKNKERQNPFSEIGS----PPSVVLTRWTSWLRVVIYYCKNLLAIKNIV 1578
             IR  YKN+D+++  +K   +K   R      + S    PP  +LTRW +W+   +YYCK    IK ++
Sbjct:  260 EIRNQYKNVDQLVSIVKKTFLKAPSRIQTLKSVASDIPLPPQPILTRWGTWIDAALYYCKYFEIIKQVI 328          
BLAST of DUF659 domain-containing protein vs. TrEMBL
Match: A0A2S2R3M2 (DUF659 domain-containing protein OS=Sipha flava OX=143950 GN=g.122712 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 5.379e-18
Identity = 72/257 (28.02%), Postives = 124/257 (48.25%), Query Frame = 2
Query:  650 MIRPKQNDNDLIRRYTRQYSQKFGVGPHKTLYRNICNTSVDFKKKFNVCVHRKTKAHI----IPYRTVLTQTFFSPT-----DKEFTFLVVEAFLSADISXXXXXXXXXXXXXXR-MKHKLPSESTAR-NYVKQVSAQFDLKVQSKLQNRKIFIVFDENEILGQRY-CNVMCGCIES--PHEIWLINSVAITTPVNSTLVVSIIDNSL*KY--NNVKTSSFMMLISDAASYMKNAGEVYKSRNHDFLYVKCLNHLIH 1372
            M + K + +  +R Y  ++         K L+  IC+  V  +KKF +  H     H+    +      TQ FF+ T     +K+  F    A LS++I L KL  S  +N   + M  ++P EST R NYV     +    +++ ++N+KI++  DE   +  RY  NV+ G +E+  P + +L+NS A+    N + +  + DNS+       +K  S ++ +SDAA YM  A +   +     ++V C+ H +H
Sbjct:    1 MPKVKPSSSLRLREYINEFGDDVFSTDGKILFCKICSVKVASEKKFTITQHLSRDKHVKGLEMNKAKNKTQAFFTDTLTNSFNKDLCF----AMLSSNIPLAKLKQSNFRNFLEKYMNRQIPEESTIRKNYVSTCYDETLASIRAYVENKKIWVSIDETTDVEGRYVANVIVGTLENNCPGKTFLLNS-AVLEKANFSTISKLFDNSMSILWPTGIKHDSVLLFLSDAAPYMVKAAKSISALYSKMIHVTCIAHGLH 252          

HSP 2 Score: 47.7506 bits (112), Expect = 5.379e-18
Identity = 26/69 (37.68%), Postives = 36/69 (52.17%), Query Frame = 1
Query: 1384 RIRAAYKNIDKVIGSLKALTIKNKERQNPFS----EIGSPPSVVLTRWTSWLRVVIYYCKNLLAIKNIV 1578
             IR  +  ID +I ++K + +K   R   F     EI  PP  +LTRW +WL    YYC++   IK IV
Sbjct:  257 EIRNNFPEIDALISNVKKIFLKAPSRVLIFKSIAPEISMPPEPILTRWGTWLSAANYYCEHFHVIKAIV 325          
BLAST of DUF659 domain-containing protein vs. TrEMBL
Match: J9M5B4 (DUF659 domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 2.958e-17
Identity = 68/256 (26.56%), Postives = 125/256 (48.83%), Query Frame = 2
Query:  650 MIRPKQNDNDLIRRYTRQYSQKFGVGPHKTLYRNICNTSVDFKKKFNVCVHRKTKAHIIPY------RTVLTQTFFSPTDKEFTF--LVVEAFLSADISXXXXXXXXXXX-XXXRMKHKLPSESTAR-NYVKQVSAQFDLKVQSKLQNRKIFIVFDENEILGQRY-CNVMCGCIES--PHEIWLINSVAITTPVNSTLVVSIIDNS--L*KYNNVKTSSFMMLISDAASYMKNAGEVYKSRNHDFLYVKCLNHLIH 1372
            M + K   + +++ Y  ++ +         L+  +C T V  ++++ V  H +T  H          +T  +Q   +   K+ TF   + +A LSA+I L K+NN   +  L   MK  +P+EST R NYV +V +    K++  ++  KI++  DE   +  RY  NV+ G +++  P +++L+N+  +    N + +  + D S  L   + ++     + +SDAA YM  AG   K+     ++V CL H +H
Sbjct:    1 MPKIKPTISTVVKNYVLEFGEDVFSCDESVLFCKLCETKVSAERRYTVTHHIETAKHKRAVNRKNNTKTSTSQLQVTSFSKKSTFNKDLCKAMLSANIPLHKINNEDFRLFLETYMKRDIPNESTLRKNYVNEVYSDTLNKIRDNIKGNKIWVSIDETTDVNGRYVANVVIGTLQTDQPGKVYLLNT-EVLDKANYSTITKLFDKSMFLLWPDGIRHDDVFLFLSDAAPYMIKAGTTIKALYSKMVHVTCLAHGMH 255          

HSP 2 Score: 50.447 bits (119), Expect = 2.958e-17
Identity = 27/84 (32.14%), Postives = 43/84 (51.19%), Query Frame = 1
Query: 1387 IRAAYKNIDKVIGSLKALTIKNKER----QNPFSEIGSPPSVVLTRWTSWLRVVIYYCKNLLAIKNIV*NIG-DDGVQNQHGQN 1623
            IR  +  IDK+I  +K + +K   R    +N   +   PP  ++TRW +WL    YYCK    +K++V  +  D+ V  +  QN
Sbjct:  261 IRGKFPEIDKLIAKIKQIFLKAPSRTILFKNKVPDTPLPPQPIITRWGTWLEAASYYCKYFNEVKSVVQELDPDEAVSIKISQN 344          
BLAST of DUF659 domain-containing protein vs. Planmine SMEST
Match: SMESG000069957.1 (SMESG000069957.1)

HSP 1 Score: 168.318 bits (425), Expect = 5.403e-110
Identity = 86/119 (72.27%), Postives = 97/119 (81.51%), Query Frame = 3
Query: 1602 AKSAWAEPNLMKDLLV-KKCYEVLIYTLENLAQDRYNISTAYYEINRLNLKHDPLELKNYISQRLADNDAKSICELQNENMSPTIYSFLRNCPPTSIVAERSFSMVKRILAIGRNFDPK 1955
            AKSA AEPNLMKDLLV K+CYEVL+Y LENL Q RYNISTAY EINRLNLKH+ LELKNYISQRLADND +SIC++QNEN+SPTIYSFLRNCPP    + + F   +R +   RNFD K
Sbjct:  164 AKSALAEPNLMKDLLVVKECYEVLMYRLENLEQGRYNISTAYEEINRLNLKHNLLELKNYISQRLADNDVRSICKIQNENISPTIYSFLRNCPPYIDCSRKEFLNAERNIGHSRNFDHK 282          

HSP 2 Score: 142.124 bits (357), Expect = 5.403e-110
Identity = 72/87 (82.76%), Postives = 77/87 (88.51%), Query Frame = 2
Query: 1124 MCGCIESPHEIWLINSVAITTPVNSTLVVSIIDNSL*KYNNVKTSSFMMLISDAASYMKNAGEVYKSRNHDFLYVKCLNHLIHNSSI 1384
            MC CIESPHEIWLIN VAITTP NSTLVVSIID+ L K NNVKTSSFMMLISDA SYMK AGEVYKSRNHDFL+VKCL +LI+N S+
Sbjct:    1 MCVCIESPHEIWLINPVAITTPENSTLVVSIIDDFLEK-NNVKTSSFMMLISDATSYMKKAGEVYKSRNHDFLHVKCLAYLIYNCSM 86          

HSP 3 Score: 130.183 bits (326), Expect = 5.403e-110
Identity = 64/73 (87.67%), Postives = 67/73 (91.78%), Query Frame = 1
Query: 1384 RIRAAYKNIDKVIGSLKALTIKNKERQNPFSEIGSPPSVVLTRWTSWLRVVIYYCKNLLAIKNIV*NIGDDGV 1602
            RIRAAY+NIDKVIGSLKALTIKNKERQN FSEI SPPSVVLTRWTSWLR VIYYC NL A+KNIV NIG+DGV
Sbjct:   87 RIRAAYENIDKVIGSLKALTIKNKERQNLFSEIESPPSVVLTRWTSWLRAVIYYCNNLPALKNIVSNIGNDGV 159          
BLAST of DUF659 domain-containing protein vs. Planmine SMEST
Match: SMESG000013476.1 (SMESG000013476.1)

HSP 1 Score: 226.098 bits (575), Expect = 2.240e-91
Identity = 112/145 (77.24%), Postives = 124/145 (85.52%), Query Frame = 3
Query: 1602 AKSAWAEPNLMKDL-LVKKCYEVLIYTLENLAQDRYNISTAYYEINRLNLKHDPLELKNYISQRLADNDAKSICELQNENMSPTIYSFLRNCPPTSIVAERSFSMVKRILAIGRNFDPKNVANYINVYYNQKVEDANLQDKQEND 2033
            AKSA+AEPNLMKDL +VK+CYEVL+Y +          S AY EINRLNLKHDPLELKNYIS RLADND +SICELQNENMSPTIY FLRNCPPTSIV ERS+S+ K+IL +GRNF+PKN+ANYINVYYNQKVEDANLQDKQE D
Sbjct:   79 AKSAFAEPNLMKDLRVVKECYEVLLYYIRKSRARPIKFSIAYEEINRLNLKHDPLELKNYISIRLADNDVRSICELQNENMSPTIYFFLRNCPPTSIVVERSYSIPKKILVVGRNFNPKNMANYINVYYNQKVEDANLQDKQEKD 223          

HSP 2 Score: 130.568 bits (327), Expect = 2.240e-91
Identity = 64/73 (87.67%), Postives = 66/73 (90.41%), Query Frame = 1
Query: 1384 RIRAAYKNIDKVIGSLKALTIKNKERQNPFSEIGSPPSVVLTRWTSWLRVVIYYCKNLLAIKNIV*NIGDDGV 1602
            RI A Y+NIDKVIGSLKALTIKNKERQN FSEIGSPPSVVLTRWTSWLR VIY+C NL AIKNIV NIGDDGV
Sbjct:    2 RIHATYENIDKVIGSLKALTIKNKERQNLFSEIGSPPSVVLTRWTSWLRAVIYFCNNLRAIKNIVSNIGDDGV 74          
BLAST of DUF659 domain-containing protein vs. Planmine SMEST
Match: SMESG000049900.1 (SMESG000049900.1)

HSP 1 Score: 261.536 bits (667), Expect = 2.703e-76
Identity = 146/210 (69.52%), Postives = 161/210 (76.67%), Query Frame = 3
Query: 1416 SYWEFKSANNKK*RKTKSVFRNWKSAVSGFDKV---DKLVTSGNLLL*KPPRD*EYCMKYRR*WCAKSAWAEPNLMKDLL-VKKCYEVLIYTLENLAQDRYNISTAYYEINRLNLKHDPLELKNYISQRLADNDAKSICELQNENMSPTIYSFLRNCPPTSIVAERSFSMVKRILAIGRNFDPKNVANYINVYYNQKVEDANLQDKQEND 2033
            SY EFKSANNKK RKT+S+FRNWKSAVSGFDK+   DKLV S         RD +  +       AKSA AE NL+KDLL VK+CYEVLIY LENL Q RYNIST Y EI RLNLKHD LELK+YISQRLAD D +SIC L N+NMSPTIYSFLR         + SFSM+K+ILA+GRNFDP+NVANYINVYYNQKVEDANLQDKQEND
Sbjct:  498 SYLEFKSANNKKLRKTESIFRNWKSAVSGFDKMEKWDKLVAS---------RDEDVLVNK-----AKSALAELNLIKDLLGVKECYEVLIYALENLEQGRYNISTVYKEIKRLNLKHDALELKSYISQRLADKDVRSICGLPNQNMSPTIYSFLR---------KNSFSMLKKILAVGRNFDPENVANYINVYYNQKVEDANLQDKQEND 684          
BLAST of DUF659 domain-containing protein vs. Planmine SMEST
Match: SMESG000037000.1 (SMESG000037000.1)

HSP 1 Score: 194.897 bits (494), Expect = 9.680e-59
Identity = 111/135 (82.22%), Postives = 116/135 (85.93%), Query Frame = 2
Query:  650 MIRPKQNDNDLIRRYTRQYSQKFGVGPHKTLYRNICNTSVDFKKKFNVCVHRKTKAHIIPYRTVLTQTFFSPTDKEFTFLVVEAFLSADISXXXXXXXXXXXXXXRMKHKLPSESTARNYVKQVSAQFDLKVQSK 1054
            M RPKQNDNDLIRRYT+QY QKF VG H TLY NICNTSVDFKKKFNV  HRKTK H+IP RTVLTQ FFSPTDKEF FLV +AFLSADI +EKLNN+KLKNLFLRMKHKLPSES ARNYV QV  Q DLKVQSK
Sbjct:    1 MPRPKQNDNDLIRRYTQQYPQKFCVGQHNTLYCNICNTSVDFKKKFNVDAHRKTKGHVIPDRTVLTQKFFSPTDKEFAFLVAKAFLSADIPIEKLNNAKLKNLFLRMKHKLPSESKARNYVHQVLGQVDLKVQSK 135          
BLAST of DUF659 domain-containing protein vs. Planmine SMEST
Match: SMESG000037883.1 (SMESG000037883.1)

HSP 1 Score: 143.28 bits (360), Expect = 1.626e-50
Identity = 70/89 (78.65%), Postives = 77/89 (86.52%), Query Frame = 2
Query: 1124 MCGCIESPHEIWLINSVAITTPVNSTLVVSIIDNSL*KYNNVKTSSFMMLISDAASYMKNAGEVYKSRNHDFLYVKCLNHLIHNSSIAF 1390
            MCGCIESPHE W+INSVA+TTP NSTLVVSIID+SL K NNVKTSSF+MLISDAASYMK  GEVY SRNHDF +VKCL+HLI N S+  
Sbjct:    1 MCGCIESPHETWIINSVALTTPANSTLVVSIIDDSLEK-NNVKTSSFIMLISDAASYMKKVGEVYISRNHDFPHVKCLDHLIDNCSMCI 88          

HSP 2 Score: 76.6406 bits (187), Expect = 1.626e-50
Identity = 45/84 (53.57%), Postives = 56/84 (66.67%), Query Frame = 3
Query: 1464 KSVFRNWKSAVSGFDKVDKLVTSGNLLL*KPPRD*EYCMKYRR*WCAKSAWAEPNLMKDLLV-KKCYEVLIYTLENLAQDRYNI 1712
            K+ FRNWKSAVSGFD++D L+   N++      D +  +        KSA AEP +MKDLLV K+CY VL+YTLENL Q RYNI
Sbjct:  108 KNNFRNWKSAVSGFDEIDNLLAIKNIV--SNIGDDDVLVNK-----TKSALAEPGVMKDLLVVKECYAVLVYTLENLEQRRYNI 184          

HSP 3 Score: 56.9954 bits (136), Expect = 4.410e-9
Identity = 40/77 (51.95%), Postives = 42/77 (54.55%), Query Frame = 1
Query: 1387 IRAAYKNIDKVIGSLKALTIKNKERQ-----NPFSEIGSPPSVVLTRWTSWLRVVIYYCKNLLAIKNIV*NIGDDGV 1602
            IRAAY+NIDKVIGSLKALTIKN  R      + F EI                       NLLAIKNIV NIGDD V
Sbjct:   88 IRAAYENIDKVIGSLKALTIKNNFRNWKSAVSGFDEID----------------------NLLAIKNIVSNIGDDDV 142          
The following BLAST results are available for this feature:
BLAST of DUF659 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A177AU623.881e-2034.62Uncharacterized protein OS=Intoshia linei OX=18197... [more]
A0A1Y1S4J31.742e-1927.66C2H2-type domain-containing protein OS=Enterospora... [more]
A0A2S2QMU31.855e-1929.18CGG triplet repeat-binding protein 1 (Fragment) OS... [more]
A0A2S2R3M25.379e-1828.02DUF659 domain-containing protein OS=Sipha flava OX... [more]
J9M5B42.958e-1726.56DUF659 domain-containing protein OS=Acyrthosiphon ... [more]
back to top
BLAST of DUF659 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF659 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069957.15.403e-11072.27SMESG000069957.1[more]
SMESG000013476.12.240e-9177.24SMESG000013476.1[more]
SMESG000049900.12.703e-7669.52SMESG000049900.1[more]
SMESG000037000.19.680e-5982.22SMESG000037000.1[more]
SMESG000037883.11.626e-5078.65SMESG000037883.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021337 ID=SMED30021337|Name=DUF659 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2136bp
CAGAGTTTAGTGTTCCCCGAGTTCAAAAAGTTTGAGAACCAATGGGTTAG
ATAATGTTTATTAGAAAAAATAATAATTCCTAAGTTTTTATCTACGAAAT
ATAAAAAAACGAAAAAAGTAGAAGTTATTTTATAGATCAGCATATAGAAT
ATATTATCTAAAATTGGATGGGTAATTTAGATTGTTTATGTTATTATTAT
GGTTTAAAACTCATTTTTTAAATATGATCATTATCATCTAGTGAAACTTT
TTAAAAAACATAAATTTGTTTTTTAACTATAAAAACAAATAAAAATCATT
CCTATTCAAGCAACATCGGAGTCAAATAGATCTGCAATGAATGGACATTT
AAGTGCCATGAAAGTGTTGTTTTATTGACTTTGTAAAAATCGTAGTTTTT
AACATATTTTAAAGTGTTTTATAATCAGGATTATTTTTTTAACAATCTAA
TTTAATTTTTCTACCATCAAATCTTTTTATCTCATCTAAGCTAACAATAT
CTGATGCATCATCCAGAGTATCATCAATAGGGCGGTTTTTTGCTATAAAT
GCTAAAAATGCTATTTATTATAGTTATGTAAAATTTAAATGATTCTGGAA
AATTTTTAAATTTTAATCAATCTTTAATATTATTTGGTAAATTAATTCCA
TGATTCGACCAAAACAGAACGATAATGATTTGATTAGAAGATACACTCGA
CAATACTCACAAAAATTCGGTGTTGGACCACACAAAACATTATATCGCAA
TATTTGTAATACCAGTGTAGATTTTAAGAAGAAGTTTAATGTGTGTGTTC
ATCGAAAGACAAAAGCTCATATTATACCCTACAGAACTGTATTAACACAA
ACATTCTTTAGTCCTACAGATAAGGAATTTACATTTTTGGTGGTGGAAGC
ATTTTTATCGGCTGATATTTCGCTTGAAAAATTAAATAATTCAAAGTTAA
AGAATTTATTTTTGCGTATGAAACATAAATTACCAAGCGAATCGACAGCT
CGTAACTACGTAAAGCAAGTCTCAGCTCAATTTGATCTAAAAGTACAAAG
TAAATTACAAAACAGAAAGATTTTTATTGTTTTTGATGAAAACGAAATAC
TCGGACAAAGATATTGTAACGTAATGTGTGGGTGCATAGAATCTCCGCAT
GAAATCTGGCTTATAAACTCAGTTGCTATAACAACACCGGTAAACTCAAC
TCTTGTTGTAAGTATAATAGATAATTCTCTCTAAAAATATAATAATGTTA
AAACTTCTAGTTTTATGATGCTTATTTCGGATGCAGCATCTTATATGAAA
AATGCTGGTGAAGTGTACAAATCAAGAAATCATGATTTTCTATATGTAAA
ATGTCTTAACCATTTAATTCATAACAGTTCTATCGCATTCGTGCGGCCTA
TAAAAATATTGATAAAGTTATTGGGAGTTTAAAAGCGCTAACAATAAAAA
ATAAAGAAAGACAAAATCCGTTTTCCGAAATTGGAAGTCCGCCGTCAGTG
GTTTTGACAAGGTGGACAAGTTGGTTACGAGTGGTAATTTACTACTGTAA
AAACCTCCTCGCGATTAAGAATATTGTATGAAATATAGGAGATGATGGTG
TGCAAAATCAGCATGGGCAGAACCCAATCTAATGAAGGATTTACTGGTTA
AAAAGTGCTATGAAGTATTAATATATACATTAGAAAATCTAGCACAAGAC
CGATATAATATTTCAACGGCCTACTACGAAATCAACAGACTAAATTTAAA
ACATGATCCTCTTGAATTAAAAAATTATATTTCCCAACGTCTAGCTGACA
ACGATGCTAAATCTATTTGCGAACTACAAAACGAAAATATGTCACCAACT
ATTTATTCCTTTTTAAGAAATTGTCCCCCTACATCGATTGTTGCAGAAAG
GAGTTTCTCAATGGTGAAGAGAATATTGGCCATAGGCAGAAATTTTGATC
CTAAAAATGTGGCCAATTACATAAATGTGTATTACAATCAAAAAGTGGAA
GATGCCAATTTGCAAGATAAACAGGAAAATGATTGTTTATCATTAAAAAA
ATAAATGCTATTTTTACGAAAATAAATACTATAAAAAACCGCCCTAATTA
TCAGCAATGATGACAAATATTATTGGTAAAATTTGA
back to top

protein sequence of SMED30021337-orf-1

>SMED30021337-orf-1 ID=SMED30021337-orf-1|Name=SMED30021337-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=195bp
MIRPKQNDNDLIRRYTRQYSQKFGVGPHKTLYRNICNTSVDFKKKFNVCV
HRKTKAHIIPYRTVLTQTFFSPTDKEFTFLVVEAFLSADISLEKLNNSKL
KNLFLRMKHKLPSESTARNYVKQVSAQFDLKVQSKLQNRKIFIVFDENEI
LGQRYCNVMCGCIESPHEIWLINSVAITTPVNSTLVVSIIDNSL*
back to top

protein sequence of SMED30021337-orf-2

>SMED30021337-orf-2 ID=SMED30021337-orf-2|Name=SMED30021337-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=141bp
MKDLLVKKCYEVLIYTLENLAQDRYNISTAYYEINRLNLKHDPLELKNYI
SQRLADNDAKSICELQNENMSPTIYSFLRNCPPTSIVAERSFSMVKRILA
IGRNFDPKNVANYINVYYNQKVEDANLQDKQENDCLSLKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0006357regulation of transcription from RNA polymerase II promoter
Vocabulary: molecular function
TermDefinition
GO:0001227transcriptional repressor activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003690double-stranded DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus