G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30021335
Length (bp)1113
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30021335) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30021335) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30021335) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30021335) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021335

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30021335h1SMcG0021011 dd_Smed_v4_11488_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30021335h1SMcG0021011 dd_Smed_v4_11488_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021335h1SMcG0021011 dd_Smed_v4_11488_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021335h1SMcG0021011 dd_Smed_v4_11488_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021335h1SMcG0021011 dd_Smed_v4_11488_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021335h1SMcG0021011 Contig49116uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021335h1SMcG0021011 Contig49116newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: NPSR1 (neuropeptide S receptor 1 [Source:HGNC Symbol;Acc:HGNC:23631])

HSP 1 Score: 48.9062 bits (115), Expect = 7.668e-6
Identity = 39/133 (29.32%), Postives = 66/133 (49.62%), Query Frame = 2
Query:  107 VIGIFGNSIILF-LFIRMKIRRFEYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFP 502
            V  I GNS++LF  + R K  R  ++   LAI++ F  + N L D      + +  +G ++  P+L     CR++ +   ++ + S YVLV  ++DR   + YP KF+      + + V  I   LS + S P
Sbjct:   61 VFTIVGNSVVLFSTWRRKKKSRMTFFVTQLAITDSFTGLVNILTD------INWRFTGDFT-APDL----VCRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGEKQARVLIV--IAWSLSFLFSIP 180          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: NPSR1 (neuropeptide S receptor 1 [Source:HGNC Symbol;Acc:HGNC:23631])

HSP 1 Score: 48.9062 bits (115), Expect = 9.619e-6
Identity = 39/133 (29.32%), Postives = 66/133 (49.62%), Query Frame = 2
Query:  107 VIGIFGNSIILF-LFIRMKIRRFEYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFP 502
            V  I GNS++LF  + R K  R  ++   LAI++ F  + N L D      + +  +G ++  P+L     CR++ +   ++ + S YVLV  ++DR   + YP KF+      + + V  I   LS + S P
Sbjct:   61 VFTIVGNSVVLFSTWRRKKKSRMTFFVTQLAITDSFTGLVNILTD------INWRFTGDFT-APDL----VCRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGEKQARVLIV--IAWSLSFLFSIP 180          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: CNMaR (gene:FBgn0053696 transcript:FBtr0091684)

HSP 1 Score: 54.6842 bits (130), Expect = 7.692e-8
Identity = 45/202 (22.28%), Postives = 90/202 (44.55%), Query Frame = 2
Query:   32 ESMEAYRVIQLMDNIYRAFMAPVAAVIGIFGNSIILFLFIRMKIRRFE--YYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFP-LTFSHHLFITKNISNSCEVSKSHLSVVSL--YIKSLLIFVSP 622
            E  E  R+   + +    +  PV    G  GN + +F+F R K+R+    +Y   LA+S+         L     + + +L    ++       N  C+   FF  +  FCS + +V FT++R + + YP K      + +   V F L L+ C+   P +  +  +F+ K  +  C+++  +   ++L  Y  +++++  P
Sbjct:   46 EDEEMLRIAFFIGHFVHQYYIPVLCCTGSIGNILSVFVFFRTKLRKLSSSFYLAALAVSD------TCFLAGLFAQWLNFLNVDIYN------QNYFCQFFTFFSYLASFCSVWFVVAFTVERFIAVIYPLKRQTMCTVRRAKIVLFCLTLVGCLHCLPYIVIAKPVFMPKLNTTICDLNSEYKEQLALFNYWDTIVVYAVP 235          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: tacr3l (tachykinin receptor 3-like [Source:ZFIN;Acc:ZDB-GENE-061207-19])

HSP 1 Score: 53.9138 bits (128), Expect = 1.410e-7
Identity = 41/137 (29.93%), Postives = 64/137 (46.72%), Query Frame = 2
Query:  107 VIGIFGNSIILFLFIRMKIRRF--EYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTF 511
             + +FGN I++++ +  K  R    Y+ + LA S+     FNTL++ F+     Y T G W F         C+   FFP    F S Y +    +DR + + +P K  P    T T  V   +  L+ I++FPL F
Sbjct:   37 AVAVFGNLIVIWIILAHKRMRTVTNYFLLNLAFSDASMAAFNTLIN-FI-----YATHGEWYF-----GEVYCKFHNFFPVTAVFASIYSMTAIAVDRYMAIIHPLK--PRLSATATKVVIVCIWALAVILAFPLCF 160          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: tacr3a (tachykinin receptor 3a [Source:ZFIN;Acc:ZDB-GENE-090312-106])

HSP 1 Score: 53.5286 bits (127), Expect = 1.689e-7
Identity = 39/137 (28.47%), Postives = 63/137 (45.99%), Query Frame = 2
Query:  107 VIGIFGNSIILFLFIRMKIRRF--EYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTF 511
             I +FGN I++++ +  K  R    Y+ + LA S+     FNTL++        Y T G W F         C+   FFP    F S Y +    +DR + + +P K  P    T T  +   + +L+ +++FPL F
Sbjct:   34 AIAVFGNLIVMWIILAHKRMRTVTNYFLLNLAFSDASMAAFNTLIN------FVYATHGDWYF-----GEAYCKFHNFFPVTSVFASIYSMSAIAVDRYMAIIHPLK--PRLSATATKVIIVCIWVLAVVLAFPLCF 157          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: FO904943.1 (neuromedin-K receptor-like [Source:NCBI gene;Acc:100333270])

HSP 1 Score: 49.6766 bits (117), Expect = 3.025e-6
Identity = 36/137 (26.28%), Postives = 66/137 (48.18%), Query Frame = 2
Query:  107 VIGIFGNSIILFLFIRMKIRRF--EYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTF 511
            ++ + GN I++++ +  K  R    Y+ + LA+S++     N L++   G        G W F     S+  CR   F+P    F S Y +    LDR + + +P K   ++ +T+ + V   + +L+  +SFPL F
Sbjct:   35 LVAVTGNLIVIWIIVAHKRMRTVTNYFLLNLAVSDVCVAALNALVNFVYG------AHGHWYF-----SSAYCRFQNFYPVAAVFASIYSMSAIALDRYMAIIHPMKPRLSAKVTKAVIV--CVWILAAFLSFPLCF 158          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: AVPR1A (arginine vasopressin receptor 1A [Source:NCBI gene;Acc:100488869])

HSP 1 Score: 49.6766 bits (117), Expect = 5.515e-6
Identity = 76/346 (21.97%), Postives = 149/346 (43.06%), Query Frame = 2
Query:   98 VAAVIGIFGNSIILFLFI-RMKIRRFEYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTFSHHLFITKNISNSCEVSKSHLSVVS-----LYIKSLL--IFVSPTXXXXXXXXXXXYQL-------TQMQKYQ----------RITTMLPVSRPEMNRIFGHMALSIAFLILTIPLSLVIILRLSLNKSEINNDPNSILTQLSKLFSSIKDISYCCNIFLYVIFLPNFRKQCMSLFYCNYNKLTTIFKISDSTTQAKHSRKRNRFER 1060
            VAAV+G    S+++ L+  + K  R   +   L++++L    F  L    L   + Y   G     P++     CR+++       F SAY+LVV T DR + + +P K      L Q    S+++++ + I+SF L+   +   + +  N  EV       +       YI  +   IFV P  I+      I Y +       T+ ++ +           ++++  +SR ++  +   + +  A+++   P   ++ +R   +K+    D   I T ++ L  S+     CCN ++Y+ F  +  +  +  F C + K+   F   DS +    +R++  F R
Sbjct:   62 VAAVLG--NCSVLIGLYKSKKKTSRMHLFIKHLSLADLAVAFFQVLPQ--LCWEVTYRFRG-----PDI----LCRIVKHLQVFGMFASAYMLVVMTADRYIAICHPLK-----TLQQPTKRSYVMIISAWIISFLLSIPQYFIFSFSPVNGSEVYDCWAHFIQPWGARAYITWMTASIFVVPVAILTTCYGFICYNIWRNIQCKTKREENEGRKSHGLLSTSVSSVKTISRAKIRTVKMTLVIVTAYILCWAPF-FIVQMRSVWDKNFEWTDSEDIATTVTALLGSLNS---CCNPWIYMFFSGHLLQDFIHSFPC-FQKIKQTFSKEDSDSS---TRRQTSFTR 381          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Npsr1 (neuropeptide S receptor 1 [Source:MGI Symbol;Acc:MGI:2441738])

HSP 1 Score: 49.2914 bits (116), Expect = 1.678e-6
Identity = 32/113 (28.32%), Postives = 54/113 (47.79%), Query Frame = 2
Query:  107 VIGIFGNSIILFLFIRMKIR-RFEYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNN-SCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSH 439
            V+ I GNS++LF   R K + R  ++   LAI++ F  + N L D              W F  +  + +  CR++ +   ++ + S YVLV  ++DR   + YP KF+    
Sbjct:   61 VVTIVGNSVVLFSTCRRKRKSRMTFFVTQLAITDSFTGLINILTDII------------WRFTGDFMAPDLVCRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGEK 161          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Tacr3 (tachykinin receptor 3 [Source:MGI Symbol;Acc:MGI:892968])

HSP 1 Score: 49.6766 bits (117), Expect = 4.000e-6
Identity = 39/134 (29.10%), Postives = 60/134 (44.78%), Query Frame = 2
Query:  107 VIGIFGNSIILFLFIRMKIRRF--EYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFP 502
             + +FGN I++++ +  K  R    Y+ V LA S+     FNTL++   G   E      W F  N      CR   FFP    F S Y +    +DR + +  P K  P    T T  V   + +L+ +++FP
Sbjct:   84 AVAVFGNLIVIWIILAHKRMRTVTNYFLVNLAFSDASVAAFNTLVNFIYGVHSE------WYFGANY-----CRFQNFFPITAVFASIYSMTAIAVDRYMAIIDPLK--PRLSATATKIVIGSIWILAFLLAFP 204          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Npsr1 (neuropeptide S receptor 1 [Source:MGI Symbol;Acc:MGI:2441738])

HSP 1 Score: 48.521 bits (114), Expect = 6.936e-6
Identity = 35/120 (29.17%), Postives = 57/120 (47.50%), Query Frame = 2
Query:  107 VIGIFGNSIILFLFIRMKIR-RFEYYCVILAISNLFAVIFNTLLD---DFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTI 454
            V+ I GNS++LF   R K + R  ++   LAI++ F  + N L D    F G  M           P+L     CR++ +   ++ + S YVLV  ++DR   + YP KF+      + +
Sbjct:   61 VVTIVGNSVVLFSTCRRKRKSRMTFFVTQLAITDSFTGLINILTDIIWRFTGDFM----------APDL----VCRVVRYLQVVLLYASTYVLVSLSIDRYHAIVYPMKFLQGEKQAKVL 166          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KUG5 (GCR157 OS=Schmidtea mediterranea OX=79327 GN=gcr157 PE=2 SV=1)

HSP 1 Score: 204.527 bits (519), Expect = 5.021e-59
Identity = 122/315 (38.73%), Postives = 185/315 (58.73%), Query Frame = 2
Query:   68 DNIYRAFMAPVAAVIGIFGNSIILFLFIRMKIRRFEYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTFSHHLFITKNISNS----------CEVSKSHLSVVSLYIKSLLIFVSPTXXXXXXXXXXXYQLTQMQKYQRITTMLPVSRPEMNRIFGHMALSIAFLILTIPLSLVIILRLSLNKSEINNDPNSILTQLSKLFSSIKDISYCCNIFLYVIFLPNFRKQCMSLFYCNYN 982
            D I+RA+ +P+ AVIGI GN  ++ +FI+ +  RF  Y  +LAI N+  ++FNT LDDFLGRG+ Y T      K +++S  +CR + F P  MY  +AY++V  ++DR L+++ P K+  +  +  T     I++ ++ +++FPL  ++ L I   ++NS          C +  S L+   LY KSL     PT III LN  II++L      Q        S  E +R  GH+A+S  F +L +PLS+VI++RL L+ S+ +N     L  LSK  SS+KDIS+  NIFLY++F+PNFRK+C  +  C YN
Sbjct:   19 DFIFRAYFSPIIAVIGIVGNVFVISIFIKYRRNRFAIYSSVLAIVNIVILVFNTFLDDFLGRGISYATDWKIVIKIDVYSTGTCRFMNFIPNAMYCANAYIIVALSVDRYLLLTKPLKYNADKGVRGTCLTCVIIVGMALVLNFPLLLTYQLVINDFVNNSVENILNPEFECSLDNSALAHFELYSKSLFTLAIPTGIIIFLNAFIIFKLLFRYSSQSFIIQGANSLSEQSRFVGHLAVSCLFSVLFLPLSIVIVMRL-LHNSKADNFDYLFLKALSKFLSSVKDISFGGNIFLYLLFMPNFRKRCKQMVTCYYN 332          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3WDJ4 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS8839 PE=4 SV=1)

HSP 1 Score: 192.586 bits (488), Expect = 1.337e-54
Identity = 110/311 (35.37%), Postives = 187/311 (60.13%), Query Frame = 2
Query:   71 NIYRAFMAPVAAVIGIFGNSIILFLFIRMKIR-RFEYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTFSHHLFITKNISNSCEVSKSH--LSVVSLYIKSLLIFVSPTXXXXXXXXXXXYQLTQMQKYQRITTMLPVSRPEMNRIFGHMALSIAFLILTIPLSLVIILRLSLNKS-EINNDPNSI-LTQLSKLFSSIKDISYCCNIFLYVIFLPNFRKQCMSL--FYCNYN 982
             ++RA+ +P+ A+ G  GN++I+ LF R K R RF  + + LA+++  ++I NT+LDDFLGRG+ Y T GA+S K +  S  +C+LLE+ P  MYF ++Y++VVF++DR L   YP +F    +  + I    ++ +L    + P      L +    + +C + +S   L+  ++   +++ F  P +I++VLN+VI+ QL +  +++   T+      EM RI GH+A+S  FL+L +PL +V+++RL +  S    N P +I +  +SK  SS+KD+SY  N  +Y +FLP FR + +SL  + C +N
Sbjct:   25 GVFRAYASPIIAITGGLGNALIICLFWREKPRTRFSVFAISLALAHTISLIINTVLDDFLGRGLHYATGGAFSIKLDATSEVNCKLLEYLPNTMYFVASYLVVVFSIDRVLSTYYPIRFHACRYRKEAILACLMVAILGASGNIPTLLVQTLMVETEGNIACRMDRSRAMLADFAIVFTTIVTFFLPVIIVLVLNLVIVQQLWRAHRWRTTMTVGGRGAQEMGRITGHLAMSTCFLLLYLPLGIVVLMRLHVTVSLGEENTPRAIRIINMSKFLSSLKDVSYAVNCLIYAVFLPKFRARLVSLCGYRCTHN 335          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A0R3WI18 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS213 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 3.642e-54
Identity = 114/309 (36.89%), Postives = 190/309 (61.49%), Query Frame = 2
Query:   77 YRAFMAPVAAVIGIFGNSIILFLFIRMKIR-RFEYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTFSHHLFITKNISNSCEVSKSH--LSVVSLYIKSLLIFVSPTXXXXXXXXXXXYQLTQMQKYQRITTMLPVSRP--EMNRIFGHMALSIAFLILTIPLSLVIILRLSLNKS-EINNDPNSI-LTQLSKLFSSIKDISYCCNIFLYVIFLPNFRKQCMSLFYCNYN 982
            +RA+ +P   +IG+ GN++I++LF R K R RF  + + LA+++  ++I NT LDDFLGRG+ Y T GA+S K +  S  SC++LE+ P  MYF ++Y++VVF++DR L + YP +F    +  + I    ++ +L    + P      L   K  + +C ++++   L+  ++   +++ F  P ++++VLN++II QL +  +++  TTM    R   EM RI GH+A+S  FL+L +PL +V+++RL +  S +  N P +I +  LSK  SS+KDISY  N  +Y +FLP FR + +SL  C+Y 
Sbjct:   27 FRAYASPAIVIIGVLGNALIMYLFWREKPRTRFSVFAISLALAHTSSLIINTALDDFLGRGLHYATGGAFSLKLDATSEISCKMLEYLPNTMYFIASYLVVVFSIDRVLSVYYPIRFHACYYRREAILACLMVAILGASGNIPTLLVQTLKTEKEGNIACRMNRNRAMLADFAIVFTTVVTFFLPVIMVLVLNLIIIQQLRRAHQWR--TTMSNGGRGAQEMGRITGHLAMSTCFLLLYLPLGIVVLMRLHVTVSLDEENTPRAIRIINLSKFLSSLKDISYAVNFLIYTVFLPKFRARLISL--CSYR 331          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: W6U7H8 (Neuropeptide S receptor OS=Echinococcus granulosus OX=6210 GN=EGR_08861 PE=4 SV=1)

HSP 1 Score: 191.43 bits (485), Expect = 3.648e-54
Identity = 108/310 (34.84%), Postives = 184/310 (59.35%), Query Frame = 2
Query:   71 NIYRAFMAPVAAVIGIFGNSIILFLFIRMKIR-RFEYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTFSHHLFITKNISNSCEVSKSH--LSVVSLYIKSLLIFVSPTXXXXXXXXXXXYQLTQMQKYQRITTMLPVSRPEMNRIFGHMALSIAFLILTIPLSLVIILRLSLNKS-EINNDPNSI-LTQLSKLFSSIKDISYCCNIFLYVIFLPNFRKQCMSLFYCNYNK 985
              +RA+++P+ A+ GI GN +I++LF R K R RF  + + LA+++  +++ NT++DDFLGRG+ Y T GA+S K +  S  SC+LLE+ P  MYF ++Y++ VF++DR L   +P +F    +  Q I    I+ +L    + P  F   L +    + +C + +S   L+  ++   +++ F  P +I++VLN++II QL +  +++   T        M RI GH+A++  FL+L +PL +V+++RL +       N P +I +  +SK  SS+KD++Y  N  +Y IFLP FR +  SL  C Y++
Sbjct:   25 GAFRAYVSPIIAITGILGNGLIIYLFWREKPRTRFSVFAISLALAHTISLVINTIMDDFLGRGLHYATGGAFSVKLDATSEASCKLLEYLPNTMYFTASYLVAVFSIDRVLTTYHPIRFHACRYRKQAILACLIVAILGASGNIPTLFVQTLRLETEGNIACRMDRSRALLADFAIVFTTIVTFFLPVIIVLVLNLIIIQQLWRAHRWRTTMTGGARGAQGMGRITGHLAMTTCFLLLYLPLGIVVLMRLHVTVCLGEENTPRAIRIINMSKFLSSLKDVAYAVNCLIYAIFLPKFRARLTSL--CGYHR 332          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: G4VJR3 (Putative peptide (Allatostatin/somatostatin)-like receptor OS=Schistosoma mansoni OX=6183 GN=Smp_041880 PE=4 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 7.120e-49
Identity = 108/301 (35.88%), Postives = 184/301 (61.13%), Query Frame = 2
Query:   77 YRAFMAPVAAVIGIFGNSIILFLFIRMK-IRRFEYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTFSHHLF--ITKNISNSCEVSKSH-LSVVSLYIKSLLIFVSPTXXXXXXXXXXXYQLTQMQKYQRITTMLPVS----RPEMNRIFGHMALSIAFLILTIPLSLVIILRLSLNKSEIN-NDPNSI-LTQLSKLFSSIKDISYCCNIFLYVIFLPNFRK 949
            +RA++ P+ A+IG+ GNS I+ +F++ K + RF  Y + LAI+N+  +I NT +DDFLGRG+ YLT+  + FK +  S   C+ +E+    MYF S+Y++V+F++DR L +  P KF    H    +    ++  +  I + PL F   L   I+   + +C +   H ++  ++  ++++ F  P  +++ LN+ I  +L +++ ++  T +LP      R EM R+FGH+ALS AFL+L +P+   +++RLS   S ++ + P ++ +  LS+LFSS+KDI+Y  N FLY+IFL NFR 
Sbjct:   17 FRAYLCPIIAMIGVIGNSFIILIFLKEKPLSRFSIYSIFLAIANMITLIMNTFIDDFLGRGLYYLTNHQFYFKLDTISKFWCKSVEYLSNTMYFTSSYLIVIFSIDRLLTIHKPIKFYSIYHKHWALIACLLVYFIGIISNSPLLFVQTLMIDISSRTNFTCRMISEHPIAKFTIAFETIVTFTIPFCLVLFLNIFICIELWKLKVHR--TALLPADCSRNRMEMGRVFGHLALSTAFLLLYLPMVCFVLIRLSQTLSHVDRHKPYAMNIIDLSRLFSSVKDITYAVNFFLYLIFLRNFRH 315          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: tacr3a (tachykinin receptor 3 [Source:NCBI gene;Acc:103046712])

HSP 1 Score: 54.6842 bits (130), Expect = 6.997e-8
Identity = 38/136 (27.94%), Postives = 64/136 (47.06%), Query Frame = 2
Query:  110 IGIFGNSIILFLFIRMKIRRF--EYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTF 511
            + +FGN +++++ +  K  R    Y+ + LA S+     FNTL++        Y T G W F         C+   FFP    F S Y +    +DR + + +P K  P+   T T  V   + +L+ +++FPL F
Sbjct:   44 VAVFGNLVVMWIILAHKRMRTVTNYFLLNLAFSDASMAAFNTLVN------FVYATHGDWYF-----GEAYCKFHNFFPVTSVFASIYSMTAIAVDRYMAIIHPLK--PHLSATATKVVIVFIWVLAVVLAFPLCF 166          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: tacr3a (tachykinin receptor 3 [Source:NCBI gene;Acc:103046712])

HSP 1 Score: 54.6842 bits (130), Expect = 7.348e-8
Identity = 38/136 (27.94%), Postives = 64/136 (47.06%), Query Frame = 2
Query:  110 IGIFGNSIILFLFIRMKIRRF--EYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTF 511
            + +FGN +++++ +  K  R    Y+ + LA S+     FNTL++        Y T G W F         C+   FFP    F S Y +    +DR + + +P K  P+   T T  V   + +L+ +++FPL F
Sbjct:   38 VAVFGNLVVMWIILAHKRMRTVTNYFLLNLAFSDASMAAFNTLVN------FVYATHGDWYF-----GEAYCKFHNFFPVTSVFASIYSMTAIAVDRYMAIIHPLK--PHLSATATKVVIVFIWVLAVVLAFPLCF 160          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: tacr3l (neuromedin-K receptor-like [Source:NCBI gene;Acc:103047822])

HSP 1 Score: 53.1434 bits (126), Expect = 2.003e-7
Identity = 38/137 (27.74%), Postives = 62/137 (45.26%), Query Frame = 2
Query:  107 VIGIFGNSIILFLFIRMKIRRF--EYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTF 511
             + +FGN +++++ +  K  R    Y+ + LA S+     FNTL++        Y T G W F         C+   FFP    F S Y +    +DR + + +P K  P    T T  V   +  L+ +++FPL F
Sbjct:   38 AVAVFGNLVVMWIILAHKRMRTVTNYFLLNLAFSDASMAAFNTLVN------FVYATHGDWYF-----GEAYCKFHNFFPVTSVFASIYSMTAIAVDRYMAIIHPLK--PRLSATATKVVIVCIWCLAVVLAFPLCF 161          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: tacr3l (neuromedin-K receptor-like [Source:NCBI gene;Acc:103047822])

HSP 1 Score: 53.1434 bits (126), Expect = 2.026e-7
Identity = 38/137 (27.74%), Postives = 62/137 (45.26%), Query Frame = 2
Query:  107 VIGIFGNSIILFLFIRMKIRRF--EYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTF 511
             + +FGN +++++ +  K  R    Y+ + LA S+     FNTL++        Y T G W F         C+   FFP    F S Y +    +DR + + +P K  P    T T  V   +  L+ +++FPL F
Sbjct:   39 AVAVFGNLVVMWIILAHKRMRTVTNYFLLNLAFSDASMAAFNTLVN------FVYATHGDWYF-----GEAYCKFHNFFPVTSVFASIYSMTAIAVDRYMAIIHPLK--PRLSATATKVVIVCIWCLAVVLAFPLCF 162          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: tacr3 (tachykinin receptor 3 [Source:NCBI gene;Acc:101159167])

HSP 1 Score: 49.6766 bits (117), Expect = 2.548e-6
Identity = 40/157 (25.48%), Postives = 70/157 (44.59%), Query Frame = 2
Query:   59 QLMDNIYRAFMAPVAA----VIGIFGNSIILFLFIRMKIRRF--EYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTF 511
            Q +  ++R  +  VA      + +FGN I++++ +  K  R    Y+ + LA S+     FNTL++ F+     Y   G W F         C+   FFP    F S Y +    +DR + + +P K  P      T  +   +  L+ +++FPL +
Sbjct:   17 QFVQPVWRVALWSVAYSLVLAVAVFGNVIVIWIILAHKRMRTVTNYFLLNLAFSDASMAAFNTLIN-FI-----YAAHGEWYF-----GEAYCKFHNFFPVTSVFASIYSMTAIAVDRYMAIIHPLK--PRLSAKATTGIIVCIWSLAIVLAFPLCY 160          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: tacr3 (tachykinin receptor 3 [Source:NCBI gene;Acc:101159167])

HSP 1 Score: 49.6766 bits (117), Expect = 2.624e-6
Identity = 41/157 (26.11%), Postives = 72/157 (45.86%), Query Frame = 2
Query:   59 QLMDNIYRAFMAPVAA----VIGIFGNSIILFLFIRMKIRRF--EYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTF 511
            Q +  ++R  +  VA      + +FGN I++++ +  K  R    Y+ + LA S+     FNTL++ F+     Y   G W F         C+   FFP    F S Y +    +DR + + +P K   ++  T  I V   +  L+ +++FPL +
Sbjct:   17 QFVQPVWRVALWSVAYSLVLAVAVFGNVIVIWIILAHKRMRTVTNYFLLNLAFSDASMAAFNTLIN-FI-----YAAHGEWYF-----GEAYCKFHNFFPVTSVFASIYSMTAIAVDRYMAIIHPLKPRLSAKATTGIIVC--IWSLAIVLAFPLCY 160          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: tacr3 (tachykinin receptor 3 [Source:NCBI gene;Acc:101159167])

HSP 1 Score: 49.2914 bits (116), Expect = 3.886e-6
Identity = 41/157 (26.11%), Postives = 72/157 (45.86%), Query Frame = 2
Query:   59 QLMDNIYRAFMAPVA----AVIGIFGNSIILFLFIRMKIRRF--EYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTF 511
            Q +  ++R  +  VA      + +FGN I++++ +  K  R    Y+ + LA S+     FNTL++ F+     Y   G W F         C+   FFP    F S Y +    +DR + + +P K   ++  T  I V   +  L+ +++FPL +
Sbjct:   17 QFVQPVWRVALWSVAYSLVLAVAVFGNVIVIWIILAHKRMRTVTNYFLLNLAFSDASMAAFNTLIN-FI-----YAAHGEWYF-----GEAYCKFHNFFPVTSVFASIYSMTAIAVDRYMAIIHPLKPRLSAKATTGIIVC--IWSLAIVLAFPLCY 160          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000016714.1 (SMESG000016714.1)

HSP 1 Score: 675.626 bits (1742), Expect = 0.000e+0
Identity = 347/347 (100.00%), Postives = 347/347 (100.00%), Query Frame = 2
Query:   38 MEAYRVIQLMDNIYRAFMAPVAAVIGIFGNSIILFLFIRMKIRRFEYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTFSHHLFITKNISNSCEVSKSHLSVVSLYIKSLLIFVSPTXXXXXXXXXXXYQLTQMQKYQRITTMLPVSRPEMNRIFGHMALSIAFLILTIPLSLVIILRLSLNKSEINNDPNSILTQLSKLFSSIKDISYCCNIFLYVIFLPNFRKQCMSLFYCNYNKLTTIFKISDSTTQAKHSRKRNRFERNLLNTI 1078
            MEAYRVIQLMDNIYRAFMAPVAAVIGIFGNSIILFLFIRMKIRRFEYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTFSHHLFITKNISNSCEVSKSHLSVVSLYIKSLLIFVSPTLIIIVLNVVIIYQLTQMQKYQRITTMLPVSRPEMNRIFGHMALSIAFLILTIPLSLVIILRLSLNKSEINNDPNSILTQLSKLFSSIKDISYCCNIFLYVIFLPNFRKQCMSLFYCNYNKLTTIFKISDSTTQAKHSRKRNRFERNLLNTI
Sbjct:    1 MEAYRVIQLMDNIYRAFMAPVAAVIGIFGNSIILFLFIRMKIRRFEYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTFSHHLFITKNISNSCEVSKSHLSVVSLYIKSLLIFVSPTLIIIVLNVVIIYQLTQMQKYQRITTMLPVSRPEMNRIFGHMALSIAFLILTIPLSLVIILRLSLNKSEINNDPNSILTQLSKLFSSIKDISYCCNIFLYVIFLPNFRKQCMSLFYCNYNKLTTIFKISDSTTQAKHSRKRNRFERNLLNTI 347          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000072348.1 (SMESG000072348.1)

HSP 1 Score: 217.238 bits (552), Expect = 1.046e-67
Identity = 132/320 (41.25%), Postives = 193/320 (60.31%), Query Frame = 2
Query:   32 ESMEAYRVIQLMDNIYRAFMAPVAAVIGIFGNSIILFLFIRMKIRRFEYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTFSHHLFITKNISN--SCEVSKSHLSVVSLYIKSLLIFVSPTXXXXXXXXXXXYQLTQMQKYQRITTMLPVSRP---EMNRIFGHMALSIAFLILTIPLSLVIILRLSLNKSEINNDPNSI---LTQLSKLFSSIKDISYCCNIFLYVIFLPNFRKQCMSLF 967
            E++ A   I+ + ++YR +  PV +++GI GN  I+F F      +F  YC  LA+ N FA++ NT LDDFLGRG+ +LT   +S K       SC  +E+ P +MYF S+YV+V F+LDR LV++ P K+ P      TIF+   + ++  IV+ PL FS+ L  T   S   SC++  S +    LY+KSL+IFV PT+ +   N+VI   L Q +K ++  +    +R    EM RI  H+ALS  FL+LTIPLS+ IILRL + K+ + N   S    +  L+KL SSIKD+SY  N FLY+IF+P+F+ +  S+F
Sbjct:    2 ENLTAINPIEYVTDVYRGYFCPVISILGILGNIFIIFTFAYNFNNKFVIYCCALALYNSFALLTNTFLDDFLGRGLGFLTKNKFSIKIEELCQGSCLFMEYVPNVMYFASSYVMVAFSLDRMLVLALPIKYSPYRGYRYTIFICLAVGVMGAIVAGPLLFSYSLEKTNANSTEMSCQMINSKMVTFGLYLKSLVIFVIPTVFVASFNIVIYCLLLQTKKRRQNLSSRKTNRGSSSEMGRIVAHLALSTVFLLLTIPLSITIILRLIIKKNSLYNYSYSYKNNVIHLTKLLSSIKDLSYAVNFFLYLIFIPSFKYEFFSIF 321          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000006006.1 (SMESG000006006.1)

HSP 1 Score: 209.534 bits (532), Expect = 8.499e-65
Identity = 127/307 (41.37%), Postives = 186/307 (60.59%), Query Frame = 2
Query:   71 NIYRAFMAPVAAVIGIFGNSIILFLFIRMKIRRFEYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSCIVSFPLTFSHHLFITKNI----SNSCEVS--KSHLSVVSLYIKSLLIFVSPTXXXXXXXXXXXYQLTQMQKYQRITTMLP--VSRPEMNRIFGHMALSIAFLILTIPLSLVIILRLSLNKSEINNDPNSILTQLSKLFSSIKDISYCCNIFLYVIFLPNFRKQCMSLF 967
            NIYRA++ P  A+ GI GN +++ +F+R +I RF  Y + L I+N  A+  N+ LDDFLGRG+ Y TSG    K +  S +SC  +E+FP +MYF S +V+V+FT DR  V+ +PFKF     + ++I     +  L  I   PL  SH L  + +        C++S   SHL+ +SLY +S++++V PT++I ++N  IIY++ +M K  R T +L    +  EM RI G +A+S  FL+ TIPLS+VII+RL ++     N     L  LSKLFSS+KDI+Y  N F+Y IFL  F+     LF
Sbjct:    8 NIYRAYLIPFIAIFGIVGNVLVILVFLRKRISRFNVYSIALLIANSLALFINSFLDDFLGRGLYYATSGKSYVKFDTISKSSCIAMEYFPNVMYFSSGFVMVIFTFDRFFVLMWPFKFKGTGGVRKSIIACVAVYFLGFITGIPLGISHQLKASNDKWGIEGKICQISSNDSHLATLSLYYESVIVYVIPTVLIFIVNTFIIYEIIKMTKI-RSTIILDKQANHLEMCRIVGMLAVSSTFLLFTIPLSVVIIIRLQIDHPNGKN-----LRALSKLFSSLKDINYSINFFIYFIFLSYFKYDLKMLF 308          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000040060.1 (SMESG000040060.1)

HSP 1 Score: 179.874 bits (455), Expect = 3.904e-53
Identity = 115/351 (32.76%), Postives = 204/351 (58.12%), Query Frame = 2
Query:   26 LPESMEAYRVIQLMDNIYRAFMAPVAAVIGIFGNSIILFLFIRMKIRRFEYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKF-VPNSHLTQTIFVSFILLLLSCIVSFPLTFSHHL----FITKNISN-SCEVSKSHLSVVSLYIKSLLIFVSPTXXXXXXXXXXXYQLTQMQKYQRITTMLPVSRPEMN----RIFGHMALSIAFLILTIPLSLVIILRLSLNK--SEINNDPNSILTQLSKLFSSIKDISYCCNIFLYVIFLPNFRKQCMSLFYCNYNKLTTIFKISDSTTQAKHSRK 1042
            + E+M A++ I+  ++IYRA + P   + G+FGN +I+ +  R  + RFE YC  LA+    A+IFN+ LDDFLGRG+++L+SG  + K +   N  C+LLEF P +MYF SAYV+VV  +DR  V++   +F  PN H+ +  F+   ++ +  I+S PL + +++    +  ++ +N SC+++++  S + +Y +SL++FV P  I+I+ N+ I+ +L + +  ++  +     + + N    ++ G++A+S  FL++++PL++ II+R           +D    L++ SK  SSIKD+ Y  N +L + FL  FRK    LF  N        +I +  +  +H  K
Sbjct:    1 MTENM-AHQTIENANDIYRAIIIPFVVLFGVFGNVVIIVVLSRQFVGRFEVYCFTLAVVQSVALIFNSFLDDFLGRGLDFLSSGRINIKIDQSVNFMCKLLEFIPRVMYFASAYVMVVMAVDRYFVINKGAQFPAPNLHVFRAKFICIFIVTIGAILSSPLLWYYNINNITYENRHFANTSCKLTETVFSEILMYFQSLIVFVLPIFIVIICNIFIVNKLLKRRTLRKRLSSSSSIKKDPNSGSMKLIGYLAISSGFLLISMPLAINIIVRNVKTGPFKATKSDVGVTLSEASKFTSSIKDMHYAINFYLNITFLERFRKDVKKLFSFNRR------QIENENSTKRHLTK 344          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000040061.1 (SMESG000040061.1)

HSP 1 Score: 177.563 bits (449), Expect = 2.283e-52
Identity = 116/338 (34.32%), Postives = 195/338 (57.69%), Query Frame = 2
Query:   56 IQLMDNIYRAFMAPVAAVIGIFGNSIILFLFIRMKIRRFEYYCVILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFFPTMMYFCSAYVLVVFTLDRCLVMSYPFKF-VPNSHLTQTIFVSFILLLLSCIVSFPLTFSHHL----FITKNISN-SCEVSKSHLSVVSLYIKSLLIFVSPTXXXXXXXXXXXYQLTQMQKYQRITTMLPVSRPEMN----RIFGHMALSIAFLILTIPLSLVIILRLSLNK--SEINNDPNSILTQLSKLFSSIKDISYCCNIFLYVIFLPNFRKQCMSLFYCNYNKLTTIFKISDSTTQAKH 1033
            I+  ++IYRA + P   + G+FGN +I+ +  R  + RFE YC  LA+    A+IFN+ LDDF GRG+++L+SG  + K +   N  C+L+EF P +MYF SAYV+VV  +DR  V+S   +F  P+  + +  F+  ++L +  I+  PL + +++    +   + SN SC++  S  S + LY +SLL+FV P +I+I+ N  I+ ++ Q +  ++  +     + + N    ++ G++A+S  FL++++PL++ II+R  +        +D    L++ SK  SSIKD+ Y  N +L V FL  FRK   SLF       T   K +D+  ++KH
Sbjct:    6 IEYANDIYRAIIIPFVVLFGVFGNVVIIVVLSRQFVGRFEVYCFTLAVVQSVALIFNSFLDDFFGRGLDFLSSGRINIKIDQSVNFMCKLMEFIPRVMYFASAYVMVVMAVDRYFVISKGSQFPAPSRQVKRAKFICVLVLFIGMILCSPLLWYYNINNLSYENSHFSNKSCKLYDSVFSEILLYFQSLLVFVLPIIIVIICNFFIVNKVRQRRILRKRLSSASSIKKDPNSGSMKLIGYLAISSGFLLISMPLAINIIVRSIITGPFKASKSDVGVTLSEASKFTSSIKDLHYAINFYLNVAFLEQFRKDVKSLF-------TGSGKETDTICESKH 336          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NPSR17.668e-629.32neuropeptide S receptor 1 [Source:HGNC Symbol;Acc:... [more]
NPSR19.619e-629.32neuropeptide S receptor 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CNMaR7.692e-822.28gene:FBgn0053696 transcript:FBtr0091684[more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tacr3l1.410e-729.93tachykinin receptor 3-like [Source:ZFIN;Acc:ZDB-GE... [more]
tacr3a1.689e-728.47tachykinin receptor 3a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
FO904943.13.025e-626.28neuromedin-K receptor-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
AVPR1A5.515e-621.97arginine vasopressin receptor 1A [Source:NCBI gene... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Npsr11.678e-628.32neuropeptide S receptor 1 [Source:MGI Symbol;Acc:M... [more]
Tacr34.000e-629.10tachykinin receptor 3 [Source:MGI Symbol;Acc:MGI:8... [more]
Npsr16.936e-629.17neuropeptide S receptor 1 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUG55.021e-5938.73GCR157 OS=Schmidtea mediterranea OX=79327 GN=gcr15... [more]
A0A0R3WDJ41.337e-5435.37G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A0R3WI183.642e-5436.89G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
W6U7H83.648e-5434.84Neuropeptide S receptor OS=Echinococcus granulosus... [more]
G4VJR37.120e-4935.88Putative peptide (Allatostatin/somatostatin)-like ... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tacr3a6.997e-827.94tachykinin receptor 3 [Source:NCBI gene;Acc:103046... [more]
tacr3a7.348e-827.94tachykinin receptor 3 [Source:NCBI gene;Acc:103046... [more]
tacr3l2.003e-727.74neuromedin-K receptor-like [Source:NCBI gene;Acc:1... [more]
tacr3l2.026e-727.74neuromedin-K receptor-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tacr32.548e-625.48tachykinin receptor 3 [Source:NCBI gene;Acc:101159... [more]
tacr32.624e-626.11tachykinin receptor 3 [Source:NCBI gene;Acc:101159... [more]
tacr33.886e-626.11tachykinin receptor 3 [Source:NCBI gene;Acc:101159... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016714.10.000e+0100.00SMESG000016714.1[more]
SMESG000072348.11.046e-6741.25SMESG000072348.1[more]
SMESG000006006.18.499e-6541.37SMESG000006006.1[more]
SMESG000040060.13.904e-5332.76SMESG000040060.1[more]
SMESG000040061.12.283e-5234.32SMESG000040061.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021335 ID=SMED30021335|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1113bp
TTGTTACAATCGAAATTAATAATTATTACCAGAATCCATGGAAGCCTATC
GAGTAATTCAACTGATGGACAACATCTATCGAGCATTTATGGCACCTGTT
GCAGCAGTCATTGGAATTTTCGGAAATTCGATCATCCTTTTTTTGTTTAT
TCGAATGAAAATAAGAAGATTTGAGTATTATTGTGTGATTTTAGCCATTT
CAAATTTGTTCGCTGTTATTTTTAATACGCTTCTTGACGACTTTTTAGGA
AGAGGCATGGAATATTTAACCAGCGGTGCTTGGTCTTTTAAGCCAAATTT
GTGGTCGAATAATTCTTGTAGACTTCTTGAATTTTTTCCAACGATGATGT
ACTTTTGTTCTGCTTATGTGCTGGTTGTATTTACTCTTGATAGATGTTTA
GTCATGTCATATCCTTTCAAATTCGTACCAAATAGTCACTTGACTCAAAC
AATTTTTGTTTCATTTATTTTGCTTTTACTTAGCTGTATTGTGAGTTTTC
CCTTGACTTTTAGTCATCATTTATTCATTACAAAAAATATTTCAAACTCT
TGTGAAGTATCTAAATCCCATTTATCAGTAGTATCTTTATATATAAAGTC
TCTCTTGATATTTGTGTCACCGACTTTAATTATCATTGTGTTGAATGTCG
TAATAATTTATCAACTTACTCAAATGCAAAAGTATCAAAGAATAACTACA
ATGTTACCAGTATCTCGCCCAGAAATGAATCGGATTTTCGGGCACATGGC
GTTAAGTATTGCATTTCTAATTCTAACAATACCCTTATCGTTGGTTATCA
TTTTACGACTGAGTCTAAACAAGAGTGAAATAAATAATGATCCCAATTCA
ATCTTGACTCAATTATCAAAATTATTCTCCAGCATTAAAGACATCAGTTA
TTGTTGTAACATTTTCCTCTATGTTATATTTCTGCCGAATTTCCGTAAAC
AGTGCATGTCACTTTTTTACTGCAATTATAATAAATTAACCACTATTTTC
AAGATTAGCGATTCAACAACTCAAGCCAAACATTCCAGAAAAAGAAACCG
ATTCGAACGAAATTTATTAAACACAATTTGAGTTTTATTTTTTTAATAAA
ATATTTGTTGAAA
back to top

protein sequence of SMED30021335-orf-1

>SMED30021335-orf-1 ID=SMED30021335-orf-1|Name=SMED30021335-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=348bp
MEAYRVIQLMDNIYRAFMAPVAAVIGIFGNSIILFLFIRMKIRRFEYYCV
ILAISNLFAVIFNTLLDDFLGRGMEYLTSGAWSFKPNLWSNNSCRLLEFF
PTMMYFCSAYVLVVFTLDRCLVMSYPFKFVPNSHLTQTIFVSFILLLLSC
IVSFPLTFSHHLFITKNISNSCEVSKSHLSVVSLYIKSLLIFVSPTLIII
VLNVVIIYQLTQMQKYQRITTMLPVSRPEMNRIFGHMALSIAFLILTIPL
SLVIILRLSLNKSEINNDPNSILTQLSKLFSSIKDISYCCNIFLYVIFLP
NFRKQCMSLFYCNYNKLTTIFKISDSTTQAKHSRKRNRFERNLLNTI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 277..303
score: 20.76
coord: 184..207
score: 21.21
coord: 14..38
score: 16.2
coord: 101..123
score: 22.29
coord: 45..66
score: 22.72
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 23..310
e-value: 3.3E-4
score: -47.4
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 32..267
e-value: 2.9E-11
score: 43.2
IPR000276G protein-coupled receptor, rhodopsin-likePROSITEPS00237G_PROTEIN_RECEP_F1_1coord: 107..123
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 6..321
e-value: 2.9E-32
score: 113.9
NoneNo IPR availablePANTHERPTHR24229NEUROPEPTIDES RECEPTORcoord: 22..339
NoneNo IPR availablePANTHERPTHR24229:SF40GH14208Pcoord: 22..339
NoneNo IPR availableCDDcd006377tm_classA_rhodopsin-likecoord: 21..193
e-value: 2.35219E-7
score: 49.1982
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 18..324
NoneNo IPR availableTMHMMTMhelixcoord: 190..212
NoneNo IPR availableTMHMMTMhelixcoord: 138..160
NoneNo IPR availableTMHMMTMhelixcoord: 44..66
NoneNo IPR availableTMHMMTMhelixcoord: 95..117
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 233..255
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 29..295
score: 22.378