deoxyhypusine synthase

Overview
Namedeoxyhypusine synthase
Smed IDSMED30021321
Uniprot Best hitDeoxyhypusine synthase OS=Rattus norvegicus OX=10116 GN=Dhps PE=2 SV=1 (E=4.91513e-143)
Length (bp)1238
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of deoxyhypusine synthase (SMED30021321) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for deoxyhypusine synthase (SMED30021321) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021321

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Category 4 cellSMED30021321SMESG000049425.1 SMESG000049421.1 dd_Smed_v4_12485_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021321SMESG000049425.1 SMESG000049421.1 dd_Smed_v4_12485_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30021321SMESG000049425.1 SMESG000049421.1 dd_Smed_v4_12485_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of deoxyhypusine synthase vs. Ensembl Human
Match: DHPS (deoxyhypusine synthase [Source:HGNC Symbol;Acc:HGNC:2869])

HSP 1 Score: 412.92 bits (1060), Expect = 8.222e-143
Identity = 204/345 (59.13%), Postives = 267/345 (77.39%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLF-DEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRV 1170
            +LK S  LP    +V +GYDFNRG++Y  +L+++ + G Q TN       +N M++ K EPL  DE+  ++    +RPLT+CTIFLGYT+N+IS G+RE IRY+V+HNMVDV+V +AGG+EEDLIKC APT++G+F     ++LREN INRIGN+LVPN NY KF DWL PIL QM  EQ      WTPSK+I RLGKEINN ESVYYW  KN+IPVF P LTDGS+GD+++FHS ++PG  +D+VED+ L++ QA  AK +G+IILGGG++KHHI NANLMR GA+++VYINT  EF+ SDSGA PDEAVSWGKI+ +A+ VK+ ++ASLVFPL+VAETFA+++
Sbjct:   17 VLKHSSTLPPESTQV-RGYDFNRGVNYRALLEAFGTTGFQATNFGRAVQQVNAMIEKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLIKCLAPTYLGEFS-LRGKELRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTPSKMIARLGKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKCTGMIILGGGVVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLLVAETFAQKM 359          
BLAST of deoxyhypusine synthase vs. Ensembl Human
Match: DHPS (deoxyhypusine synthase [Source:HGNC Symbol;Acc:HGNC:2869])

HSP 1 Score: 404.06 bits (1037), Expect = 2.415e-139
Identity = 203/347 (58.50%), Postives = 266/347 (76.66%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLF-DEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRG--GANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRV 1170
            +LK S  LP    +V +GYDFNRG++Y  +L+++ + G Q TN       +N M++ K EPL  DE+  ++    +RPLT+CTIFLGYT+N+IS G+RE IRY+V+HNMVDV+V +AGG+EEDLIKC APT++G+F     ++LREN INRIGN+LVPN NY KF DWL PIL QM  EQ      WTPSK+I RLGKEINN ESVYYW  KN+IPVF P LTDGS+GD+++FHS ++PG  +D+VED+ L++ QA  AK +G+IILGGG++KHHI NANLM    GA+++VYINT  EF+ SDSGA PDEAVSWGKI+ +A+ VK+ ++ASLVFPL+VAETFA+++
Sbjct:   16 VLKHSSTLPPESTQV-RGYDFNRGVNYRALLEAFGTTGFQATNFGRAVQQVNAMIEKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLIKCLAPTYLGEFS-LRGKELRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTPSKMIARLGKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKCTGMIILGGGVVKHHIANANLMVSGNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLLVAETFAQKM 360          
BLAST of deoxyhypusine synthase vs. Ensembl Human
Match: DHPS (deoxyhypusine synthase [Source:HGNC Symbol;Acc:HGNC:2869])

HSP 1 Score: 370.163 bits (949), Expect = 1.020e-126
Identity = 185/292 (63.36%), Postives = 235/292 (80.48%), Query Frame = 1
Query:  298 MLDLKSEPLF-DEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRV 1170
            M++ K EPL  DE+  ++    +RPLT+CTIFLGYT+N+IS G+RE IRY+V+HNMVDV+V +AGG+EEDLIKC APT++G+F     E LREN INRIGN+LVPN NY KF DWL PIL QM  EQ      WTPSK+I RLGKEINN ESVYYW  KN+IPVF P LTDGS+GD+++FHS ++PG  +D+VED+ L++ QA  AK +G+IILGGG++KHHI NANLMR GA+++VYINT  EF+ SDSGA PDEAVSWGKI+ +A+ VK+ ++ASLVFPL+VAETFA+++
Sbjct:   27 MIEKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLIKCLAPTYLGEFSLRGKE-LRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTPSKMIARLGKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKCTGMIILGGGVVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLLVAETFAQKM 317          
BLAST of deoxyhypusine synthase vs. Ensembl Human
Match: DHPS (deoxyhypusine synthase [Source:HGNC Symbol;Acc:HGNC:2869])

HSP 1 Score: 347.821 bits (891), Expect = 5.476e-118
Identity = 174/345 (50.43%), Postives = 227/345 (65.80%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLF-DEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRV 1170
            +LK S  LP    +V +GYDFNRG++Y  +L+++ + G Q TN       +N M++ K EPL  DE+  ++    +RPLT+CTIFLGYT+N+IS G+RE IRY+V+HNMVDV+V +AGG+EEDLIKC APT++G+F     ++LREN INRIGN+LVPN NY KF DWL PIL QM  EQ      WTPSK+I RLGKEINN ESVYYW  KN+IPVF P LTDGS+GD+++FHS ++PG  +D+VE                                                 EF+ SDSGA PDEAVSWGKI+ +A+ VK+ ++ASLVFPL+VAETFA+++
Sbjct:   17 VLKHSSTLPPESTQV-RGYDFNRGVNYRALLEAFGTTGFQATNFGRAVQQVNAMIEKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLIKCLAPTYLGEF-SLRGKELRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTPSKMIARLGKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVE-----------------------------------------------AQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLLVAETFAQKM 312          
BLAST of deoxyhypusine synthase vs. Ensembl Human
Match: DHPS (deoxyhypusine synthase [Source:HGNC Symbol;Acc:HGNC:2869])

HSP 1 Score: 299.671 bits (766), Expect = 8.555e-100
Identity = 141/247 (57.09%), Postives = 183/247 (74.09%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLF-DEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVE 876
            +LK S  LP    +V +GYDFNRG++Y  +L+++ + G Q TN       +N M++ K EPL  DE+  ++    +RPLT+CTIFLGYT+N+IS G+RE IRY+V+HNMVDV+V +AGG+EEDLIKC APT++G+F     ++LREN INRIGN+LVPN NY KF DWL PIL QM  EQ      WTPSK+I RLGKEINN ESVYYW  KN+IPVF P LTDGS+GD+++FHS ++PG  +D+VE
Sbjct:   17 VLKHSSTLPPESTQV-RGYDFNRGVNYRALLEAFGTTGFQATNFGRAVQQVNAMIEKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLIKCLAPTYLGEFS-LRGKELRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTPSKMIARLGKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVE 261          
BLAST of deoxyhypusine synthase vs. Ensembl Celegans
Match: dhps-1 (Deoxyhypusine synthase [Source:UniProtKB/Swiss-Prot;Acc:Q9XXJ0])

HSP 1 Score: 352.829 bits (904), Expect = 1.144e-119
Identity = 187/355 (52.68%), Postives = 247/355 (69.58%), Query Frame = 1
Query:  121 VMNQELILKESKDLPEGVNEVVKGYDFN--RGIDYG--TILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLF-DEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSME-HPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKR 1167
             + Q  +L +S  +P+G +  ++G+DF+   G D+    IL SY S G Q T+L      +N+ML L+  PL  D++      P  R   +CTIFLGYT+N+++ G+RE +RY V+ N+VD IV SAGGIEEDLIKC  P+++G F   D  KLR N +NR GN+L+PN NY  F DWL PIL +   EQ   + NWTPSK+I RLG+ I +  S+ YW  K+ IPVFCP LTDGS+GD+LYFHS++  PG R+D+VEDV  ++  A  +  +G IILGGG++KHHI NANLMR GA+ +VYINTG EF+ SDSGA PDEAVSWGK+K +A  VK+ +EA+LVFPL+VAETFAK 
Sbjct:   14 ALAQGAVLVKSCQVPDG-SIPIRGFDFSTASGPDFSLSAILSSYMSTGFQATHLAQAIQQVNQMLSLRDTPLTCDDDEKLFPYPEGRQKRSCTIFLGYTSNLVTSGLREVLRYCVQRNLVDCIVTSAGGIEEDLIKCLKPSYLGTFT-MDGAKLRSNGMNRAGNVLIPNDNYCAFEDWLMPILDECLVEQEEKHLNWTPSKLIQRLGERIGDESSILYWAAKHRIPVFCPALTDGSLGDMLYFHSVKSSPGLRVDIVEDVRHINTIAVKSFKTGSIILGGGVVKHHINNANLMRNGADHTVYINTGQEFDGSDSGAQPDEAVSWGKVKPSAGAVKVHAEATLVFPLLVAETFAKH 366          
BLAST of deoxyhypusine synthase vs. Ensembl Fly
Match: CG8005 (gene:FBgn0035854 transcript:FBtr0076695)

HSP 1 Score: 385.956 bits (990), Expect = 1.183e-132
Identity = 188/347 (54.18%), Postives = 253/347 (72.91%), Query Frame = 1
Query:  130 QELILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLFDEEMSSN-SNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKR 1167
            ++ +LK S+ L E   +V  GYDFN G+DY  + +SY + G Q TNL +    IN MLD + +PL  +++ S+ ++   R  + CT+FLGYT+N++S G+RE IR++ EH M+D IV +AGG+EED IKC APTF+G F+      LRE  INRIGN+LVPN NY KF DW+ P+L +M +EQ +    W+PSK+IHRLG+ I +  S+YYW  KN IPVFCP LTDGS+GD++YFHS   PG  +D++ D+  ++  A  A NSG+II+GGG+IKHHI NANLMR GA++SV+INT +EF+ SDSGA PDEA+SWGKI+ +A  VK+ +EASLVFPL+V ETFAKR
Sbjct:    9 KDAVLKRSEALAENTPQV-SGYDFNEGLDYSKLFESYVNTGFQATNLGLAIREINRMLDCRDQPLEADQIDSHETDDFIRRRSKCTVFLGYTSNLVSSGLRETIRFLAEHRMIDCIVTTAGGVEEDFIKCLAPTFMGSFE-LSGRDLRERGINRIGNLLVPNDNYCKFEDWVMPLLDEMLEEQKSQGTIWSPSKIIHRLGERIGDPSSIYYWAAKNQIPVFCPALTDGSLGDMMYFHSFRQPGLVVDILSDLRRLNTMAVKAVNSGMIIVGGGVIKHHICNANLMRNGADYSVFINTASEFDGSDSGARPDEAISWGKIRKDATPVKVYAEASLVFPLIVGETFAKR 353          
BLAST of deoxyhypusine synthase vs. Ensembl Fly
Match: CG8005 (gene:FBgn0035854 transcript:FBtr0332137)

HSP 1 Score: 49.6766 bits (117), Expect = 8.237e-8
Identity = 24/57 (42.11%), Postives = 34/57 (59.65%), Query Frame = 1
Query:  130 QELILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEM 300
            ++ +LK S+ L E   +V  GYDFN G+DY  + +SY + G Q TNL +    IN M
Sbjct:    9 KDAVLKRSEALAENTPQV-SGYDFNEGLDYSKLFESYVNTGFQATNLGLAIREINRM 64          
BLAST of deoxyhypusine synthase vs. Ensembl Zebrafish
Match: dhps (deoxyhypusine synthase [Source:ZFIN;Acc:ZDB-GENE-040426-2001])

HSP 1 Score: 399.823 bits (1026), Expect = 5.655e-138
Identity = 196/347 (56.48%), Postives = 267/347 (76.95%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLFDEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRVANV 1179
            +LKES  LP+ + ++ +GYDFN+G+++  +L+S+ + G Q ++  +    IN+M++ + EP+ +E   S+S   ++    CTIFLGYT+N+IS GVRE IRY+ +H MVDVIV +AGGIEEDLIKC APTF+G+F     ++LR+  INRIGN+LVPN NY KF DWL PIL QM  EQ     +WTPSK+IHRLGKEINN +SVYYW YKN+IPVF P LTDGS+GD++YFHS ++PG  +D+VED+  ++ +A  AK++G+IILGGG++KHHI NANLMR GA+F+V++NTG EF+ SDSGA PDEA+SWGKI+ +A  VK+ ++ASLVFPL+VAETFA   + +
Sbjct:   13 VLKESTPLPDNLPQI-RGYDFNQGLNHRALLQSFITTGFQASSFGLAVQEINKMIEKRLEPVQEECEDSDS---RQSALGCTIFLGYTSNLISSGVRESIRYLTQHKMVDVIVTTAGGIEEDLIKCLAPTFLGEFS-LKGKELRQQGINRIGNLLVPNENYCKFEDWLMPILDQMVLEQKTEGTHWTPSKMIHRLGKEINNPDSVYYWAYKNDIPVFSPALTDGSLGDMIYFHSYKNPGLVLDIVEDIRRLNSKAVFAKSTGMIILGGGLVKHHIANANLMRNGADFAVFVNTGQEFDGSDSGARPDEAISWGKIRMDASPVKVYADASLVFPLLVAETFAHNASRL 354          
BLAST of deoxyhypusine synthase vs. Ensembl Zebrafish
Match: dhps (deoxyhypusine synthase [Source:ZFIN;Acc:ZDB-GENE-040426-2001])

HSP 1 Score: 399.823 bits (1026), Expect = 5.655e-138
Identity = 196/347 (56.48%), Postives = 267/347 (76.95%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLFDEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRVANV 1179
            +LKES  LP+ + ++ +GYDFN+G+++  +L+S+ + G Q ++  +    IN+M++ + EP+ +E   S+S   ++    CTIFLGYT+N+IS GVRE IRY+ +H MVDVIV +AGGIEEDLIKC APTF+G+F     ++LR+  INRIGN+LVPN NY KF DWL PIL QM  EQ     +WTPSK+IHRLGKEINN +SVYYW YKN+IPVF P LTDGS+GD++YFHS ++PG  +D+VED+  ++ +A  AK++G+IILGGG++KHHI NANLMR GA+F+V++NTG EF+ SDSGA PDEA+SWGKI+ +A  VK+ ++ASLVFPL+VAETFA   + +
Sbjct:   13 VLKESTPLPDNLPQI-RGYDFNQGLNHRALLQSFITTGFQASSFGLAVQEINKMIEKRLEPVQEECEDSDS---RQSALGCTIFLGYTSNLISSGVRESIRYLTQHKMVDVIVTTAGGIEEDLIKCLAPTFLGEFS-LKGKELRQQGINRIGNLLVPNENYCKFEDWLMPILDQMVLEQKTEGTHWTPSKMIHRLGKEINNPDSVYYWAYKNDIPVFSPALTDGSLGDMIYFHSYKNPGLVLDIVEDIRRLNSKAVFAKSTGMIILGGGLVKHHIANANLMRNGADFAVFVNTGQEFDGSDSGARPDEAISWGKIRMDASPVKVYADASLVFPLLVAETFAHNASRL 354          
BLAST of deoxyhypusine synthase vs. Ensembl Zebrafish
Match: dhps (deoxyhypusine synthase [Source:ZFIN;Acc:ZDB-GENE-040426-2001])

HSP 1 Score: 235.343 bits (599), Expect = 1.089e-75
Identity = 113/210 (53.81%), Postives = 153/210 (72.86%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLFDEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCY 768
            +LKES  LP+ + ++ +GYDFN+G+++  +L+S+ + G Q ++  +    IN+M++ + EP+ +E   S+S   ++    CTIFLGYT+N+IS GVRE IRY+ +H MVDVIV +AGGIEEDLIKC APTF+G+F     ++LR+  INRIGN+LVPN NY KF DWL PIL QM  EQ     +WTPSK+IHRLGKEINN +SVYYW Y
Sbjct:   13 VLKESTPLPDNLPQI-RGYDFNQGLNHRALLQSFITTGFQASSFGLAVQEINKMIEKRLEPVQEECEDSDS---RQSALGCTIFLGYTSNLISSGVRESIRYLTQHKMVDVIVTTAGGIEEDLIKCLAPTFLGEF-SLKGKELRQQGINRIGNLLVPNENYCKFEDWLMPILDQMVLEQKTEGTHWTPSKMIHRLGKEINNPDSVYYWAY 217          
BLAST of deoxyhypusine synthase vs. Ensembl Xenopus
Match: dhps (deoxyhypusine synthase [Source:NCBI gene;Acc:394501])

HSP 1 Score: 381.719 bits (979), Expect = 6.999e-131
Identity = 197/348 (56.61%), Postives = 254/348 (72.99%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLFDEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDF--QGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRVAN 1176
            +L  S  LPEG  +V +GYDFNRG++Y  +L+SY + G Q T+       IN M++ K               +  P   CTIFLGYT+N+IS GVRE IRY+VEH+MVD++V +AGGIEEDLIKC APT++GDF  +G D   LR   INRIGN+LVPN+NY  F DW+ PIL QM  EQ      WTPSK+I RLGKEIN+ +SVYYW YKNNIPVF P LTDGS+GD++YFHS ++PG ++D+VED+  ++     AK +G+IILGGG+IKHHI NANLMR GA+++VY+NT  EF+ SD+GA PDEAVSWGKI+  AK VK+ +EA+LVFPL+VA+TFA++ A+
Sbjct:   15 VLMPSDSLPEGSVQV-RGYDFNRGVNYEALLQSYLTTGFQATHFGQAAKEINNMIEAK---------------LASP-GGCTIFLGYTSNLISSGVRETIRYLVEHSMVDIVVTTAGGIEEDLIKCLAPTYLGDFSLKGAD---LRPRGINRIGNLLVPNNNYCLFEDWVTPILDQMVLEQDTEGTKWTPSKMIARLGKEINHPDSVYYWAYKNNIPVFSPALTDGSLGDMMYFHSYKNPGLKLDIVEDIQKLNSNVIFAKKTGMIILGGGLIKHHICNANLMRNGADYAVYVNTAQEFDGSDAGARPDEAVSWGKIRMEAKPVKIYAEATLVFPLLVAQTFAQKQAD 342          
BLAST of deoxyhypusine synthase vs. Ensembl Xenopus
Match: dhps (deoxyhypusine synthase [Source:NCBI gene;Acc:394501])

HSP 1 Score: 381.719 bits (979), Expect = 7.946e-131
Identity = 197/348 (56.61%), Postives = 254/348 (72.99%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLFDEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDF--QGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRVAN 1176
            +L  S  LPEG  +V +GYDFNRG++Y  +L+SY + G Q T+       IN M++ K               +  P   CTIFLGYT+N+IS GVRE IRY+VEH+MVD++V +AGGIEEDLIKC APT++GDF  +G D   LR   INRIGN+LVPN+NY  F DW+ PIL QM  EQ      WTPSK+I RLGKEIN+ +SVYYW YKNNIPVF P LTDGS+GD++YFHS ++PG ++D+VED+  ++     AK +G+IILGGG+IKHHI NANLMR GA+++VY+NT  EF+ SD+GA PDEAVSWGKI+  AK VK+ +EA+LVFPL+VA+TFA++ A+
Sbjct:   20 VLMPSDSLPEGSVQV-RGYDFNRGVNYEALLQSYLTTGFQATHFGQAAKEINNMIEAK---------------LASP-GGCTIFLGYTSNLISSGVRETIRYLVEHSMVDIVVTTAGGIEEDLIKCLAPTYLGDFSLKGAD---LRPRGINRIGNLLVPNNNYCLFEDWVTPILDQMVLEQDTEGTKWTPSKMIARLGKEINHPDSVYYWAYKNNIPVFSPALTDGSLGDMMYFHSYKNPGLKLDIVEDIQKLNSNVIFAKKTGMIILGGGLIKHHICNANLMRNGADYAVYVNTAQEFDGSDAGARPDEAVSWGKIRMEAKPVKIYAEATLVFPLLVAQTFAQKQAD 347          
BLAST of deoxyhypusine synthase vs. Ensembl Xenopus
Match: dhps (deoxyhypusine synthase [Source:NCBI gene;Acc:394501])

HSP 1 Score: 381.333 bits (978), Expect = 8.908e-131
Identity = 197/348 (56.61%), Postives = 254/348 (72.99%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLFDEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDF--QGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRVAN 1176
            +L  S  LPEG  +V +GYDFNRG++Y  +L+SY + G Q T+       IN M++ K               +  P   CTIFLGYT+N+IS GVRE IRY+VEH+MVD++V +AGGIEEDLIKC APT++GDF  +G D   LR   INRIGN+LVPN+NY  F DW+ PIL QM  EQ      WTPSK+I RLGKEIN+ +SVYYW YKNNIPVF P LTDGS+GD++YFHS ++PG ++D+VED+  ++     AK +G+IILGGG+IKHHI NANLMR GA+++VY+NT  EF+ SD+GA PDEAVSWGKI+  AK VK+ +EA+LVFPL+VA+TFA++ A+
Sbjct:   16 VLMPSDSLPEGSVQV-RGYDFNRGVNYEALLQSYLTTGFQATHFGQAAKEINNMIEAK---------------LASP-GGCTIFLGYTSNLISSGVRETIRYLVEHSMVDIVVTTAGGIEEDLIKCLAPTYLGDFSLKGAD---LRPRGINRIGNLLVPNNNYCLFEDWVTPILDQMVLEQDTEGTKWTPSKMIARLGKEINHPDSVYYWAYKNNIPVFSPALTDGSLGDMMYFHSYKNPGLKLDIVEDIQKLNSNVIFAKKTGMIILGGGLIKHHICNANLMRNGADYAVYVNTAQEFDGSDAGARPDEAVSWGKIRMEAKPVKIYAEATLVFPLLVAQTFAQKQAD 343          
BLAST of deoxyhypusine synthase vs. Ensembl Xenopus
Match: dhps (deoxyhypusine synthase [Source:NCBI gene;Acc:394501])

HSP 1 Score: 381.333 bits (978), Expect = 1.225e-130
Identity = 197/348 (56.61%), Postives = 254/348 (72.99%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLFDEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDF--QGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRVAN 1176
            +L  S  LPEG  +V +GYDFNRG++Y  +L+SY + G Q T+       IN M++ K               +  P   CTIFLGYT+N+IS GVRE IRY+VEH+MVD++V +AGGIEEDLIKC APT++GDF  +G D   LR   INRIGN+LVPN+NY  F DW+ PIL QM  EQ      WTPSK+I RLGKEIN+ +SVYYW YKNNIPVF P LTDGS+GD++YFHS ++PG ++D+VED+  ++     AK +G+IILGGG+IKHHI NANLMR GA+++VY+NT  EF+ SD+GA PDEAVSWGKI+  AK VK+ +EA+LVFPL+VA+TFA++ A+
Sbjct:   18 VLMPSDSLPEGSVQV-RGYDFNRGVNYEALLQSYLTTGFQATHFGQAAKEINNMIEAK---------------LASP-GGCTIFLGYTSNLISSGVRETIRYLVEHSMVDIVVTTAGGIEEDLIKCLAPTYLGDFSLKGAD---LRPRGINRIGNLLVPNNNYCLFEDWVTPILDQMVLEQDTEGTKWTPSKMIARLGKEINHPDSVYYWAYKNNIPVFSPALTDGSLGDMMYFHSYKNPGLKLDIVEDIQKLNSNVIFAKKTGMIILGGGLIKHHICNANLMRNGADYAVYVNTAQEFDGSDAGARPDEAVSWGKIRMEAKPVKIYAEATLVFPLLVAQTFAQKQAD 345          
BLAST of deoxyhypusine synthase vs. Ensembl Mouse
Match: Dhps (deoxyhypusine synthase [Source:MGI Symbol;Acc:MGI:2683592])

HSP 1 Score: 411.379 bits (1056), Expect = 1.814e-142
Identity = 204/345 (59.13%), Postives = 264/345 (76.52%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPL-FDEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRV 1170
            +LK S  LP    +V +GYDFNRG+DY  +L +Y + G Q TN       +N M++ K EPL  DE+  ++    +RPLT CTIFLGYT+N+IS G+RE IRY+V+HNMVDV+V +AGG+EEDLIKC APT++G+F     ++LRE+ INRIGN+LVPN NY KF DWL PIL QM  EQ      WTPSK+I RLGKEINN +SVYYW +KN+IPV  P LTDGS+GD+++FHS ++PG  +D+VED+ L++ QA  AK SG+IILGGG++KHHI NANLMR GA+++VYINT  EF+ SDSGA PDEAVSWGKI+ +A+ VK+ ++ASLVFPL+VAETFA++ 
Sbjct:   17 VLKHSSALPPESAQV-QGYDFNRGVDYHALLDAYRTTGFQATNFGRAVQQVNAMIEKKLEPLAVDEDHHADLTQSRRPLTGCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLIKCLAPTYLGEFS-LRGKELRESGINRIGNLLVPNDNYCKFEDWLMPILDQMVLEQNTEGVKWTPSKMISRLGKEINNPDSVYYWAHKNHIPVLSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKRSGMIILGGGVVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRMDAQPVKVYADASLVFPLLVAETFAQKA 359          
BLAST of deoxyhypusine synthase vs. Ensembl Mouse
Match: Dhps (deoxyhypusine synthase [Source:MGI Symbol;Acc:MGI:2683592])

HSP 1 Score: 114.775 bits (286), Expect = 3.257e-30
Identity = 54/109 (49.54%), Postives = 73/109 (66.97%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPL-FDEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNM 462
            +LK S  LP    +V +GYDFNRG+DY  +L +Y + G Q TN       +N M++ K EPL  DE+  ++    +RPLT CTIFLGYT+N+IS G+RE IRY+V+HNM
Sbjct:   34 VLKHSSALPPESAQV-QGYDFNRGVDYHALLDAYRTTGFQATNFGRAVQQVNAMIEKKLEPLAVDEDHHADLTQSRRPLTGCTIFLGYTSNLISSGIRETIRYLVQHNM 141          
BLAST of deoxyhypusine synthase vs. UniProt
Match: sp|Q6AY53|DHYS_RAT (Deoxyhypusine synthase OS=Rattus norvegicus OX=10116 GN=Dhps PE=2 SV=1)

HSP 1 Score: 415.231 bits (1066), Expect = 4.915e-143
Identity = 205/345 (59.42%), Postives = 265/345 (76.81%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPL-FDEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRV 1170
            +LK S  LP    +V +GYDFNRG+DY  +L++Y + G Q TN       +N M++ K EPL  DE+   +    +RPLT CTIFLGYT+N+IS G+RE IRY+V+HNMVDV+V +AGG+EEDLIKC APT++G+F     ++LREN INRIGN+LVPN NY KF DWL PIL QM +EQ      WTPSK+I RLGKEINN ESVYYW +KN+IPV  P LTDGS+GD+++FHS ++PG  +D+VED+ L++ QA  AK +G+IILGGG++KHHI NANLMR GA+++VYINT  EF+ SDSGA PDEAVSWGKI+ +A+ VK+ ++ASLVFPL+VAETFA++ 
Sbjct:   17 VLKHSSALPPESAQV-QGYDFNRGVDYHALLEAYGTTGFQATNFGRAVQQVNAMIEKKLEPLAVDEDHHEDLTQSRRPLTGCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLIKCLAPTYLGEFS-LRGKELRENGINRIGNLLVPNDNYCKFEDWLMPILDQMVQEQNTEGVKWTPSKMISRLGKEINNPESVYYWAHKNHIPVLSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLRLINMQAIFAKRTGMIILGGGVVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRMDAQPVKVYADASLVFPLLVAETFAQKA 359          
BLAST of deoxyhypusine synthase vs. UniProt
Match: sp|P49366|DHYS_HUMAN (Deoxyhypusine synthase OS=Homo sapiens OX=9606 GN=DHPS PE=1 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 3.948e-142
Identity = 204/345 (59.13%), Postives = 267/345 (77.39%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLF-DEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRV 1170
            +LK S  LP    +V +GYDFNRG++Y  +L+++ + G Q TN       +N M++ K EPL  DE+  ++    +RPLT+CTIFLGYT+N+IS G+RE IRY+V+HNMVDV+V +AGG+EEDLIKC APT++G+F     ++LREN INRIGN+LVPN NY KF DWL PIL QM  EQ      WTPSK+I RLGKEINN ESVYYW  KN+IPVF P LTDGS+GD+++FHS ++PG  +D+VED+ L++ QA  AK +G+IILGGG++KHHI NANLMR GA+++VYINT  EF+ SDSGA PDEAVSWGKI+ +A+ VK+ ++ASLVFPL+VAETFA+++
Sbjct:   17 VLKHSSTLPPESTQV-RGYDFNRGVNYRALLEAFGTTGFQATNFGRAVQQVNAMIEKKLEPLSQDEDQHADLTQSRRPLTSCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLIKCLAPTYLGEFS-LRGKELRENGINRIGNLLVPNENYCKFEDWLMPILDQMVMEQNTEGVKWTPSKMIARLGKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKCTGMIILGGGVVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLLVAETFAQKM 359          
BLAST of deoxyhypusine synthase vs. UniProt
Match: sp|Q6EWQ6|DHYS_BOVIN (Deoxyhypusine synthase OS=Bos taurus OX=9913 GN=DHPS PE=2 SV=2)

HSP 1 Score: 412.535 bits (1059), Expect = 4.550e-142
Identity = 205/345 (59.42%), Postives = 265/345 (76.81%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLF-DEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRV 1170
            +LK S  LP    +V +GYDFNRG+DY  +L+++S+ G Q TN       +N M++ K EPL  DE+  ++    +RPLT CTIFLGYT+N+IS G+RE IRY+V+HNMVDV+V +AGG+EED IKC APT++G+F     ++LREN INRIGN+LVPN NY KF DWL PIL QM  EQ      WTPSK+I RLGKEINN ESVYYW  KN+IPV  P LTDGS+GD+++FHS ++PG  +D+VED+ L++ QA  AK +G+IILGGG++KHHI NANLMR GA+++VYINT  EF+ SDSGA PDEAVSWGKI+ +A+ VK+ ++ASLVFPL+VAETFA++V
Sbjct:   17 VLKHSSALPFETAQV-RGYDFNRGVDYRALLEAFSTTGFQATNFGRAVQQVNAMIEKKLEPLSEDEDQHADLTQSRRPLTGCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDFIKCLAPTYLGEFS-LRGKELRENGINRIGNLLVPNDNYCKFEDWLMPILDQMVLEQNTEGVKWTPSKMIARLGKEINNPESVYYWAQKNHIPVLSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLKLINTQAIFAKRTGMIILGGGMVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRMDAQPVKVYADASLVFPLLVAETFAQKV 359          
BLAST of deoxyhypusine synthase vs. UniProt
Match: sp|Q3TXU5|DHYS_MOUSE (Deoxyhypusine synthase OS=Mus musculus OX=10090 GN=Dhps PE=1 SV=2)

HSP 1 Score: 411.379 bits (1056), Expect = 1.269e-141
Identity = 204/345 (59.13%), Postives = 264/345 (76.52%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPL-FDEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRV 1170
            +LK S  LP    +V +GYDFNRG+DY  +L +Y + G Q TN       +N M++ K EPL  DE+  ++    +RPLT CTIFLGYT+N+IS G+RE IRY+V+HNMVDV+V +AGG+EEDLIKC APT++G+F     ++LRE+ INRIGN+LVPN NY KF DWL PIL QM  EQ      WTPSK+I RLGKEINN +SVYYW +KN+IPV  P LTDGS+GD+++FHS ++PG  +D+VED+ L++ QA  AK SG+IILGGG++KHHI NANLMR GA+++VYINT  EF+ SDSGA PDEAVSWGKI+ +A+ VK+ ++ASLVFPL+VAETFA++ 
Sbjct:   17 VLKHSSALPPESAQV-QGYDFNRGVDYHALLDAYRTTGFQATNFGRAVQQVNAMIEKKLEPLAVDEDHHADLTQSRRPLTGCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLIKCLAPTYLGEFS-LRGKELRESGINRIGNLLVPNDNYCKFEDWLMPILDQMVLEQNTEGVKWTPSKMISRLGKEINNPDSVYYWAHKNHIPVLSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKRSGMIILGGGVVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRMDAQPVKVYADASLVFPLLVAETFAQKA 359          
BLAST of deoxyhypusine synthase vs. UniProt
Match: sp|Q9VSF4|DHYS_DROME (Probable deoxyhypusine synthase OS=Drosophila melanogaster OX=7227 GN=CG8005 PE=2 SV=2)

HSP 1 Score: 385.956 bits (990), Expect = 1.186e-131
Identity = 188/347 (54.18%), Postives = 253/347 (72.91%), Query Frame = 1
Query:  130 QELILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLFDEEMSSN-SNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKR 1167
            ++ +LK S+ L E   +V  GYDFN G+DY  + +SY + G Q TNL +    IN MLD + +PL  +++ S+ ++   R  + CT+FLGYT+N++S G+RE IR++ EH M+D IV +AGG+EED IKC APTF+G F+      LRE  INRIGN+LVPN NY KF DW+ P+L +M +EQ +    W+PSK+IHRLG+ I +  S+YYW  KN IPVFCP LTDGS+GD++YFHS   PG  +D++ D+  ++  A  A NSG+II+GGG+IKHHI NANLMR GA++SV+INT +EF+ SDSGA PDEA+SWGKI+ +A  VK+ +EASLVFPL+V ETFAKR
Sbjct:    9 KDAVLKRSEALAENTPQV-SGYDFNEGLDYSKLFESYVNTGFQATNLGLAIREINRMLDCRDQPLEADQIDSHETDDFIRRRSKCTVFLGYTSNLVSSGLRETIRFLAEHRMIDCIVTTAGGVEEDFIKCLAPTFMGSFE-LSGRDLRERGINRIGNLLVPNDNYCKFEDWVMPLLDEMLEEQKSQGTIWSPSKIIHRLGERIGDPSSIYYWAAKNQIPVFCPALTDGSLGDMMYFHSFRQPGLVVDILSDLRRLNTMAVKAVNSGMIIVGGGVIKHHICNANLMRNGADYSVFINTASEFDGSDSGARPDEAISWGKIRKDATPVKVYAEASLVFPLIVGETFAKR 353          
BLAST of deoxyhypusine synthase vs. TrEMBL
Match: gnl|BL_ORD_ID|17006207 (tr|A0A1S3I4A4|A0A1S3I4A4_LINUN deoxyhypusine synthase OS=Lingula unguis OX=7574 GN=LOC106160869 PE=4 SV=1)

HSP 1 Score: 427.557 bits (1098), Expect = 2.533e-145
Identity = 212/343 (61.81%), Postives = 271/343 (79.01%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLFDE-EMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAK 1164
            +L +S+++PEG +E V+GYDFN G+DY  +LK Y++ G Q TN  +  + IN+M++ K EPL +E    +N NP+ R  TNCTIFLGYT+N+IS GVRE IRY+V+HNMVDV+V +AGGIEED IKC APT++GDF     ++LRE  INRIGN+LVPN+NY  F DW+ PIL QM  EQ     NWTPSK+I RLGKEI+N +SVYYW YKNNIPVF P LTDGS+GD+LYFHS ++PG  +D+VED+  M+ QA  A+NSG+IILGGG++KHHI NAN+MR GA+FS+++NT  EF+ SDSGA PDEAVSWGKIK +AK VK+ ++ASLVFPL+VAETFA+
Sbjct:   15 VLLKSEEMPEG-SETVQGYDFNNGVDYHQLLKMYTTSGFQATNFGLAVEQINKMIEKKLEPLPEEVRQEANFNPVGREKTNCTIFLGYTSNLISSGVRETIRYLVQHNMVDVLVTTAGGIEEDFIKCMAPTYLGDFH-LKGKELREKGINRIGNLLVPNNNYCLFEDWIMPILDQMLVEQQEQKVNWTPSKMIARLGKEIDNPQSVYYWAYKNNIPVFSPALTDGSLGDMLYFHSYKNPGLVLDIVEDIRRMNSQAIFAQNSGMIILGGGLVKHHICNANMMRNGADFSLFVNTAQEFDGSDSGARPDEAVSWGKIKKDAKPVKVYADASLVFPLLVAETFAR 355          
BLAST of deoxyhypusine synthase vs. TrEMBL
Match: gnl|BL_ORD_ID|176233890 (tr|A0A4W3H1R7|A0A4W3H1R7_CALMI Uncharacterized protein OS=Callorhinchus milii OX=7868 PE=4 SV=1)

HSP 1 Score: 424.091 bits (1089), Expect = 4.698e-144
Identity = 208/343 (60.64%), Postives = 268/343 (78.13%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLFDEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKR 1167
            +LK S+ +PEG  +V +GYDFN+G+DY  +L+SY + G Q TNL +  + IN M++ K EPL D +  +N NP +R  T CTIFLGYT+N+IS G+RE IRY+V+HNMVD +V +AGGIEED IKC APTF+GDF     + LR++ INRIGN+LVPN NY KF DW+ PIL QM  EQ      WTPSK+I RLGKEI+N ESVYYW YKNNIPVF P LTDGS+GD++YFHS ++PG  +D+VED+  M+ QA  AK +G+IILGGG++KHHI NANLMR GA+++VY+NT +EF+ SDSGA PDEAVSWGKI+ +AK VK+ ++A+LVFPL+VAETFA++
Sbjct:   19 VLKRSEAIPEGTPQV-RGYDFNKGLDYPALLQSYLTTGYQATNLGLAVEQINAMIEAKLEPLDDCDNPNNLNPCQRDKTGCTIFLGYTSNLISSGIRETIRYLVQHNMVDCVVTTAGGIEEDFIKCLAPTFLGDFS-LKGKDLRQSGINRIGNLLVPNDNYCKFEDWVTPILDQMLLEQKQQGTKWTPSKMIARLGKEIDNPESVYYWTYKNNIPVFSPALTDGSLGDMIYFHSYKNPGLVLDIVEDIQRMNSQAVFAKRTGMIILGGGVVKHHISNANLMRNGADYAVYVNTAHEFDGSDSGAKPDEAVSWGKIRMDAKPVKVSADATLVFPLLVAETFARK 359          
BLAST of deoxyhypusine synthase vs. TrEMBL
Match: gnl|BL_ORD_ID|176243753 (tr|V9KQS3|V9KQS3_CALMI Deoxyhypusine synthase OS=Callorhinchus milii OX=7868 PE=2 SV=1)

HSP 1 Score: 423.705 bits (1088), Expect = 1.425e-143
Identity = 208/343 (60.64%), Postives = 268/343 (78.13%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLFDEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKR 1167
            +LK S+ +PEG  +V +GYDFN+G+DY  +L+SY + G Q TNL +  + IN M++ K EPL D +  +N NP +R  T CTIFLGYT+N+IS G+RE IRY+V+HNMVD +V +AGGIEED IKC APTF+GDF     + LR++ INRIGN+LVPN NY KF DW+ PIL QM  EQ      WTPSK+I RLGKEI+N ESVYYW YKNNIPVF P LTDGS+GD++YFHS ++PG  +D+VED+  M+ QA  AK +G+IILGGG++KHHI NANLMR GA+++VY+NT +EF+ SDSGA PDEAVSWGKI+ +AK VK+ ++A+LVFPL+VAETFA++
Sbjct:   42 VLKRSEAIPEGTPQV-RGYDFNKGLDYPALLQSYLTTGYQATNLGLAVEQINAMIEAKLEPLDDCDNPNNLNPCQRDKTGCTIFLGYTSNLISSGIRETIRYLVQHNMVDCVVTTAGGIEEDFIKCLAPTFLGDFS-LKGKDLRQSGINRIGNLLVPNDNYCKFEDWVTPILDQMLLEQKQQGTKWTPSKMIARLGKEIDNPESVYYWTYKNNIPVFSPALTDGSLGDMIYFHSYKNPGLVLDIVEDIQRMNSQAVFAKRTGMIILGGGVVKHHISNANLMRNGADYAVYVNTAHEFDGSDSGAKPDEAVSWGKIRMDAKPVKVSADATLVFPLLVAETFARK 382          
BLAST of deoxyhypusine synthase vs. TrEMBL
Match: gnl|BL_ORD_ID|27039137 (tr|F6PGR5|F6PGR5_MONDO Uncharacterized protein OS=Monodelphis domestica OX=13616 GN=DHPS PE=4 SV=2)

HSP 1 Score: 420.239 bits (1079), Expect = 2.098e-142
Identity = 206/346 (59.54%), Postives = 268/346 (77.46%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLFDEEMSS-NSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRVA 1173
            +L+ S  LP G  +V +GYDFNRG+DYG +L+++ + G Q T+       +N M++ K EPL +EE +  + NP +RP++ CTIFLGYT+N+IS GVRE IRY+V+HNMVDV+V +AGGIEEDLIKC APT++G+F     + LR+N INRIGN+LVPN NY KF DWL PIL QM  EQ      WTPSK+I RLGKEINN ESVYYW  KNNIPV  P LTDGS+GD+++FHS ++PG  +D+VED+ L++ QA  AK +G+IILGGG++KHHI NANLMR GA+++VYINT  EF+ SDSGA PDEAVSWGKI+ +A+ VK+ ++ASLVFPL+VAETFA+++ 
Sbjct:   25 VLRHSSALPAGTVQV-RGYDFNRGLDYGALLRAFGTTGFQATSFGRAVQQVNAMIEKKLEPLGEEEENHMDLNPSRRPMSGCTIFLGYTSNLISSGVRETIRYLVQHNMVDVLVTTAGGIEEDLIKCLAPTYLGEFS-LKGKDLRQNGINRIGNLLVPNDNYCKFEDWLMPILDQMVLEQNTEGVKWTPSKMIARLGKEINNPESVYYWAQKNNIPVLSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLRLINAQAIFAKRTGMIILGGGLVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRMDARPVKVYADASLVFPLLVAETFAQKIG 368          
BLAST of deoxyhypusine synthase vs. TrEMBL
Match: gnl|BL_ORD_ID|27538698 (tr|A0A0D9R2Q6|A0A0D9R2Q6_CHLSB Uncharacterized protein OS=Chlorocebus sabaeus OX=60711 PE=4 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 5.059e-142
Identity = 207/345 (60.00%), Postives = 267/345 (77.39%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLF-DEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRV 1170
            +LK S  LP    +V +GYDFNRG+DY T+LK++ + G Q TN       +N M++ K EPL  DE+  ++    +RPLT CTIFLGYT+N+IS G+RE IRY+V+HNMVDV+V +AGG+EEDLIKC APT++G+F     ++LREN INRIGN+LVPN NY KF DWL PIL QM  EQ      WTPSK+I RLGKEINN ESVYYW  KN+IPVF P LTDGS+GD+++FHS ++PG  +D+VED+ L++ QA  AK +G+IILGGG++KHHI NANLMR GA+++VYINT  EF+ SDSGA PDEAVSWGKI+ +A+ VK+ ++ASLVFPL+VAETFA+++
Sbjct:   17 VLKHSSTLPPESTQV-RGYDFNRGVDYRTLLKAFGTTGFQATNFGRAVQQVNAMIEKKLEPLSQDEDQHADLTQSRRPLTGCTIFLGYTSNLISSGIRETIRYLVQHNMVDVLVTTAGGVEEDLIKCLAPTYLGEFS-LRGKELRENGINRIGNLLVPNDNYCKFEDWLMPILDQMVLEQNTEGIKWTPSKMIARLGKEINNPESVYYWAQKNHIPVFSPALTDGSLGDMIFFHSYKNPGLVLDIVEDLRLINTQAIFAKGTGMIILGGGVVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRVDAQPVKVYADASLVFPLLVAETFAQKI 359          
BLAST of deoxyhypusine synthase vs. Ensembl Cavefish
Match: dhps (deoxyhypusine synthase [Source:NCBI gene;Acc:103031482])

HSP 1 Score: 390.963 bits (1003), Expect = 1.264e-134
Identity = 195/351 (55.56%), Postives = 262/351 (74.64%), Query Frame = 1
Query:  130 QELILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLK-SEPLFDEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRVANV 1179
            ++ +LKES  LPE V  + +GYDFN+G+D+  +L SY + G Q ++  +    IN+M++ +       EE   +    ++  + CTIFLGYT+N+IS GVRE IRY+ +H MVDVIV +AGG+EED IKC APT++G+F     ++LR+  INRIGN+LVPN NY KF DWL PIL QM  EQ     +WTPSK+IHRLGKEINN +SVYYW YKN+IPVF P LTDGS+GD++YFHS ++PG  +D+VED+  ++ +A  AK++G+IILGGG++KHHI NANLMR GA+F+V++NTG EF+ SDSGA PDEAVSWGKI+ +AK VK+ ++AS+VFPL+VAETFA     +
Sbjct:   10 RDAVLKESAALPEDVPRI-RGYDFNQGVDHRALLHSYLTTGFQASSFGLAVQEINKMIEKRLEVVEEPEEEQQDVGDSQQGRSGCTIFLGYTSNLISSGVRETIRYLAQHKMVDVIVTTAGGVEEDFIKCLAPTYLGEFS-LPGKELRQRGINRIGNLLVPNDNYCKFEDWLMPILDQMVLEQKTEGTHWTPSKMIHRLGKEINNPDSVYYWAYKNDIPVFSPALTDGSLGDMIYFHSYKNPGLVLDIVEDIRRLNSKAVFAKSTGMIILGGGLVKHHIANANLMRNGADFAVFVNTGQEFDGSDSGARPDEAVSWGKIRMDAKPVKVYADASIVFPLLVAETFAHHAGRL 358          
BLAST of deoxyhypusine synthase vs. Ensembl Cavefish
Match: dhps (deoxyhypusine synthase [Source:NCBI gene;Acc:103031482])

HSP 1 Score: 390.963 bits (1003), Expect = 2.099e-134
Identity = 195/351 (55.56%), Postives = 262/351 (74.64%), Query Frame = 1
Query:  130 QELILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLK-SEPLFDEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRVANV 1179
            ++ +LKES  LPE V  + +GYDFN+G+D+  +L SY + G Q ++  +    IN+M++ +       EE   +    ++  + CTIFLGYT+N+IS GVRE IRY+ +H MVDVIV +AGG+EED IKC APT++G+F     ++LR+  INRIGN+LVPN NY KF DWL PIL QM  EQ     +WTPSK+IHRLGKEINN +SVYYW YKN+IPVF P LTDGS+GD++YFHS ++PG  +D+VED+  ++ +A  AK++G+IILGGG++KHHI NANLMR GA+F+V++NTG EF+ SDSGA PDEAVSWGKI+ +AK VK+ ++AS+VFPL+VAETFA     +
Sbjct:   23 RDAVLKESAALPEDVPRI-RGYDFNQGVDHRALLHSYLTTGFQASSFGLAVQEINKMIEKRLEVVEEPEEEQQDVGDSQQGRSGCTIFLGYTSNLISSGVRETIRYLAQHKMVDVIVTTAGGVEEDFIKCLAPTYLGEFS-LPGKELRQRGINRIGNLLVPNDNYCKFEDWLMPILDQMVLEQKTEGTHWTPSKMIHRLGKEINNPDSVYYWAYKNDIPVFSPALTDGSLGDMIYFHSYKNPGLVLDIVEDIRRLNSKAVFAKSTGMIILGGGLVKHHIANANLMRNGADFAVFVNTGQEFDGSDSGARPDEAVSWGKIRMDAKPVKVYADASIVFPLLVAETFAHHAGRL 371          
BLAST of deoxyhypusine synthase vs. Ensembl Sea Lamprey
Match: dhps (deoxyhypusine synthase [Source:ZFIN;Acc:ZDB-GENE-040426-2001])

HSP 1 Score: 379.793 bits (974), Expect = 1.328e-130
Identity = 202/358 (56.42%), Postives = 254/358 (70.95%), Query Frame = 1
Query:  124 MNQELILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLFDEE----------MSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVE-DVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAK 1164
            +  E +   S DLP     V +GYDF+ G+D+  +L S  + G Q T        +N M+  + EP+ +++           S +SN  ++PL NCTIFLGYT+NMISCGVRE +R++V+H+MVDVIV +AGGIEEDLIKC A TF+GDF     + LR   INR GN+LVPN+NY  F DW+ PIL QM  EQ   +  WTPSK+I RLGKEI+N +SV YW YKNNIP+F P +TDGS+GD+LYFHS  +PG  +DV+E D+ LM+  A  AKN+G+IILGGG+IKHHI NANLMR GANFSV INT  EF+ SDSGA PDEAVSWGKI   AK VK+ ++ASLVFPL+VAETFA+
Sbjct:   11 LAHEALFVRSTDLPTHTPRV-RGYDFSGGVDHHALLGSLLTTGFQATAFGQAVLEVNRMIAKRKEPIPEDQDGDGDELVVRASESSN--EKPLKNCTIFLGYTSNMISCGVRESLRFLVQHSMVDVIVTTAGGIEEDLIKCMAHTFVGDF-ALKGKDLRLKGINRTGNLLVPNNNYCLFEDWVMPILDQMLLEQTTQSMKWTPSKMIARLGKEIDNPDSVCYWAYKNNIPIFSPAITDGSLGDMLYFHSYRNPGLILDVIEADIRLMNNHAVHAKNTGMIILGGGVIKHHICNANLMRNGANFSVNINTAQEFDGSDSGARPDEAVSWGKISITAKPVKVYADASLVFPLLVAETFAR 364          
BLAST of deoxyhypusine synthase vs. Ensembl Yeast
Match: DYS1 (Deoxyhypusine synthase; catalyzes formation of deoxyhypusine, the first step in hypusine biosynthesis; triggers posttranslational hypusination of translation elongation factor eIF-5A and regulates its intracellular levels; tetrameric; human homolog DHPS allows growth of yeast haploid dys1 null mutant after sporulation of heterozygous diploid [Source:SGD;Acc:S000001110])

HSP 1 Score: 313.153 bits (801), Expect = 1.342e-104
Identity = 177/387 (45.74%), Postives = 250/387 (64.60%), Query Frame = 1
Query:  130 QELILKESKDLPEGVNEVVKGYDFNR----GIDYGTILKSYSSMGIQGTNLKMVFDIIN-----------EMLDLKSEPLFDEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQ-----------LANNYN-----WTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHP--GFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFA--KRVANVKN 1185
            Q+ +LK S  +P+   +V +G D+++     +    ++++  +MG Q +++    +II+           E+ D + +  FDEE    +          TIF+GYT+N+IS GVRE +RY+V+H MVD +V SAGG+EEDLIKC APT++G+F     + LR+  +NRIGN+LVPN NY KF +W+ PIL +M +EQ           L  N +     WTPSK+I R GKEIN+  SV YW +KN IP+FCP LTDGSIGD+L+FH+ +      R+D+V D+  ++  +  A  +G+IILGGG+IKHHI NA LMR GA+++VYINTG E++ SD+GA PDEAVSWGKIK+ AK VKL ++ + V PL+VA TFA  K +  VKN
Sbjct:   13 QDAVLKASVPIPDDFVKV-QGIDYSKPEATNMRATDLIEAMKTMGFQASSVGTACEIIDSMRSWRGKHIDELDDHEKKGCFDEEGYQKT----------TIFMGYTSNLISSGVRETLRYLVQHKMVDAVVTSAGGVEEDLIKCLAPTYLGEF-ALKGKSLRDQGMNRIGNLLVPNDNYCKFEEWIVPILDKMLEEQDEYVKKHGADCLEANQDVDSPIWTPSKMIDRFGKEINDESSVLYWAHKNKIPIFCPSLTDGSIGDMLFFHTFKASPKQLRVDIVGDIRKINSMSMAAYRAGMIILGGGLIKHHIANACLMRNGADYAVYINTGQEYDGSDAGARPDEAVSWGKIKAEAKSVKLFADVTTVLPLIVAATFASGKPIKKVKN 387          
BLAST of deoxyhypusine synthase vs. Ensembl Nematostella
Match: EDO34643 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNR4])

HSP 1 Score: 392.119 bits (1006), Expect = 2.275e-135
Identity = 197/344 (57.27%), Postives = 256/344 (74.42%), Query Frame = 1
Query:  139 ILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLF--DEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAK 1164
            +L +S+ +P+G +E VKGYDFN+G DY  +L+SY + G Q  +     D IN+M+  K EP     E    +  P  RP  NCTIFL YT+NMISCGVRE IRY+V++NMVDV+V + GGIEED +KC AP+++GDF     E LR+  INRIGN+LVPN NY K  D+++P+L +M +EQ     NWTPSK I RLGKEIN+ ESVYYW YKNNIPVF P +TDG+IGD +YFHS  +PG ++D+ EDV L++  A  +KN+GIIILGGG++KHH+ NAN+MR GA+++VY+NT  EF+ SDSGA PDEAVSWGKIK+ A  VK+  E+SL+FPL+VAETFA+
Sbjct:   16 VLLKSEPMPDG-SETVKGYDFNQGTDYHALLQSYKNTGFQAMHFGKAVDEINKMIAKKKEPYVPNTENPELDILPTGRPKNNCTIFLAYTSNMISCGVREVIRYLVQNNMVDVLVTTGGGIEEDFMKCLAPSYLGDFS-ISGEFLRKKGINRIGNLLVPNDNYCKLEDFIQPVLDKMLEEQQNEGINWTPSKFIARLGKEINHPESVYYWAYKNNIPVFSPAITDGAIGDAIYFHSYRNPGLKLDIAEDVRLVNNHAVFSKNTGIIILGGGLVKHHVCNANMMRNGADYAVYVNTAQEFDGSDSGARPDEAVSWGKIKATATPVKIYGESSLIFPLLVAETFAR 357          
BLAST of deoxyhypusine synthase vs. Ensembl Medaka
Match: dhps (deoxyhypusine synthase [Source:NCBI gene;Acc:101171006])

HSP 1 Score: 394.815 bits (1013), Expect = 3.415e-136
Identity = 200/344 (58.14%), Postives = 257/344 (74.71%), Query Frame = 1
Query:  133 ELILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLFDEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINR-IGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFA 1161
            E +LK S DLP+ + ++ +GYDFN G+D   +LKSY + G Q ++L +    IN M++ + EP     M ++     +  + CTIFLGYT+N+IS GVRE IRY+VEH MVD IV +AGGIEEDLIKC A T++GDF     ++LR   INR IGN+LVPN NY KF DWL PIL QM  EQ      WTPSK+IHRLGKEINN +SVYYW YKNNIPVF P LTDGS+GD++YFHS ++PG  +D+VED+  ++  A  AK +G+IILGGG++KHHI NANLMR GA+++VY+NTG EF+ SDSGA PDEA+SWGKI+++A  VK+ ++ASLVFPL+VAETFA
Sbjct:   11 EAVLKPSDDLPDDMPKI-RGYDFNHGVDLQAVLKSYLTTGFQASSLSLAIQQINNMIEKRLEP-----MEADDGDELKQHSGCTIFLGYTSNLISSGVRESIRYLVEHKMVDAIVTTAGGIEEDLIKCLAHTYLGDFS-LSGKELRLKGINRLIGNLLVPNDNYCKFEDWLMPILDQMLLEQNTEGVRWTPSKMIHRLGKEINNTDSVYYWAYKNNIPVFSPALTDGSLGDMIYFHSFKNPGLVLDIVEDIRRLNGLAVFAKKTGMIILGGGLVKHHIANANLMRNGADYAVYVNTGQEFDGSDSGARPDEAISWGKIRADATPVKVYADASLVFPLIVAETFA 347          
BLAST of deoxyhypusine synthase vs. Planmine SMEST
Match: SMESG000049421.1 (SMESG000049421.1)

HSP 1 Score: 709.909 bits (1831), Expect = 0.000e+0
Identity = 354/356 (99.44%), Postives = 355/356 (99.72%), Query Frame = 1
Query:  124 MNQELILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLFDEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRVANVKNFN 1191
            MNQELILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPL DEEMSSNSNPIKRPLTNCTIFLGYT+NMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSGIIILGGGIIKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRVANVKNFN
Sbjct:    1 MNQELILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLSDEEMSSNSNPIKRPLTNCTIFLGYTSNMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSGIIILGGGIIKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRVANVKNFN 356          
BLAST of deoxyhypusine synthase vs. Planmine SMEST
Match: SMESG000049425.1 (SMESG000049425.1)

HSP 1 Score: 607.06 bits (1564), Expect = 0.000e+0
Identity = 303/310 (97.74%), Postives = 304/310 (98.06%), Query Frame = 1
Query:  124 MNQELILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLFDEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAP 1053
            MNQELILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPL DEEMSS SNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFA TFIGDFQGYD EKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQ AN+YNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSM HPGFRIDVVEDVCLMDKQATCAKNSGIIILGGGIIKHHIMNANLMRGGANFSVYINTGNEFEASDSGAP
Sbjct:    1 MNQELILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLSDEEMSSKSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFASTFIGDFQGYDGEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQSANSYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMAHPGFRIDVVEDVCLMDKQATCAKNSGIIILGGGIIKHHIMNANLMRGGANFSVYINTGNEFEASDSGAP 310          
BLAST of deoxyhypusine synthase vs. Planmine SMEST
Match: SMESG000051298.1 (SMESG000051298.1)

HSP 1 Score: 483.026 bits (1242), Expect = 5.752e-171
Identity = 238/357 (66.67%), Postives = 293/357 (82.07%), Query Frame = 1
Query:  121 VMNQELILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLKMVFDIINEMLDLKSEPLFDEEMSSNSNPIKRPLTNCTIFLGYTANMISCGVREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRENVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRLGKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVVEDVCLMDKQATCAKNSXXXXXXXXXXKHHIMNANLMRGGANFSVYINTGNEFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRVANVKNFN 1191
            ++NQ+  L  S  LPEGV+ VVKGYDFN+GI++ ++ +SY SMGIQ TN     ++INEM+++K+ PL  EE  S  NPI R  TNCTIFLGYT+N+IS G+REQIRY+ +HN+VDVIV+SAGGIEED IKC  P++IGDF+ +DD  LR+  INRIGN+LVPN+NYV F  WL PIL +MH+EQ   N NWTPSK+IHRLGKEINN ESVYYWCYKNNIPVFCP LTDGSIGD++YF+S+ +PGFRID+VED+ L+++QAT A +SG+IILGGG+IKHHI NANLMR G++FSVYINTGNEFEASDSGAPP+EA+SWGKIKS ++ VKL +E SLVFP++VA TFAK V   K  N
Sbjct:    1 MINQDCALVASDSLPEGVDTVVKGYDFNQGINFESLFQSYGSMGIQATNFGKAVEVINEMINMKNIPL-SEEDESVFNPINRKRTNCTIFLGYTSNVISSGLREQIRYIAQHNLVDVIVSSAGGIEEDFIKCIRPSYIGDFRQFDDSVLRQKGINRIGNILVPNANYVDFESWLTPILHKMHEEQDKFNINWTPSKLIHRLGKEINNEESVYYWCYKNNIPVFCPSLTDGSIGDMIYFYSIANPGFRIDIVEDIVLINRQATTAIHSGMIILGGGVIKHHIANANLMRNGSDFSVYINTGNEFEASDSGAPPEEAISWGKIKSISRPVKLHAEISLVFPIIVALTFAKHVEAKKLMN 356          
The following BLAST results are available for this feature:
BLAST of deoxyhypusine synthase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DHPS8.222e-14359.13deoxyhypusine synthase [Source:HGNC Symbol;Acc:HGN... [more]
DHPS2.415e-13958.50deoxyhypusine synthase [Source:HGNC Symbol;Acc:HGN... [more]
DHPS1.020e-12663.36deoxyhypusine synthase [Source:HGNC Symbol;Acc:HGN... [more]
DHPS5.476e-11850.43deoxyhypusine synthase [Source:HGNC Symbol;Acc:HGN... [more]
DHPS8.555e-10057.09deoxyhypusine synthase [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of deoxyhypusine synthase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dhps-11.144e-11952.68Deoxyhypusine synthase [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of deoxyhypusine synthase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG80051.183e-13254.18gene:FBgn0035854 transcript:FBtr0076695[more]
CG80058.237e-842.11gene:FBgn0035854 transcript:FBtr0332137[more]
back to top
BLAST of deoxyhypusine synthase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
dhps5.655e-13856.48deoxyhypusine synthase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
dhps5.655e-13856.48deoxyhypusine synthase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
dhps1.089e-7553.81deoxyhypusine synthase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of deoxyhypusine synthase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dhps6.999e-13156.61deoxyhypusine synthase [Source:NCBI gene;Acc:39450... [more]
dhps7.946e-13156.61deoxyhypusine synthase [Source:NCBI gene;Acc:39450... [more]
dhps8.908e-13156.61deoxyhypusine synthase [Source:NCBI gene;Acc:39450... [more]
dhps1.225e-13056.61deoxyhypusine synthase [Source:NCBI gene;Acc:39450... [more]
back to top
BLAST of deoxyhypusine synthase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Dhps1.814e-14259.13deoxyhypusine synthase [Source:MGI Symbol;Acc:MGI:... [more]
Dhps3.257e-3049.54deoxyhypusine synthase [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of deoxyhypusine synthase vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6AY53|DHYS_RAT4.915e-14359.42Deoxyhypusine synthase OS=Rattus norvegicus OX=101... [more]
sp|P49366|DHYS_HUMAN3.948e-14259.13Deoxyhypusine synthase OS=Homo sapiens OX=9606 GN=... [more]
sp|Q6EWQ6|DHYS_BOVIN4.550e-14259.42Deoxyhypusine synthase OS=Bos taurus OX=9913 GN=DH... [more]
sp|Q3TXU5|DHYS_MOUSE1.269e-14159.13Deoxyhypusine synthase OS=Mus musculus OX=10090 GN... [more]
sp|Q9VSF4|DHYS_DROME1.186e-13154.18Probable deoxyhypusine synthase OS=Drosophila mela... [more]
back to top
BLAST of deoxyhypusine synthase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|170062072.533e-14561.81tr|A0A1S3I4A4|A0A1S3I4A4_LINUN deoxyhypusine synth... [more]
gnl|BL_ORD_ID|1762338904.698e-14460.64tr|A0A4W3H1R7|A0A4W3H1R7_CALMI Uncharacterized pro... [more]
gnl|BL_ORD_ID|1762437531.425e-14360.64tr|V9KQS3|V9KQS3_CALMI Deoxyhypusine synthase OS=C... [more]
gnl|BL_ORD_ID|270391372.098e-14259.54tr|F6PGR5|F6PGR5_MONDO Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|275386985.059e-14260.00tr|A0A0D9R2Q6|A0A0D9R2Q6_CHLSB Uncharacterized pro... [more]
back to top
BLAST of deoxyhypusine synthase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dhps1.264e-13455.56deoxyhypusine synthase [Source:NCBI gene;Acc:10303... [more]
dhps2.099e-13455.56deoxyhypusine synthase [Source:NCBI gene;Acc:10303... [more]
back to top
BLAST of deoxyhypusine synthase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dhps1.328e-13056.42deoxyhypusine synthase [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of deoxyhypusine synthase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYS11.342e-10445.74Deoxyhypusine synthase; catalyzes formation of deo... [more]
back to top
BLAST of deoxyhypusine synthase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO346432.275e-13557.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of deoxyhypusine synthase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dhps3.415e-13658.14deoxyhypusine synthase [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of deoxyhypusine synthase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000049421.10.000e+099.44SMESG000049421.1[more]
SMESG000049425.10.000e+097.74SMESG000049425.1[more]
SMESG000051298.15.752e-17166.67SMESG000051298.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021321 ID=SMED30021321|Name=deoxyhypusine synthase|organism=Schmidtea mediterranea sexual|type=transcript|length=1238bp
TGACAGAATGAGTAAATTTTAGTATAATTTAAAAAAATAACTGATTCATT
TGAAGTTTTTGAAGTTTGCACCAAAGTTGTATAAATTAATATCCATCAAA
GGTGAAAATTAGTCTGTCAAGTAATGAATCAAGAACTTATCTTAAAGGAA
TCAAAAGATTTACCAGAGGGGGTAAATGAAGTCGTAAAGGGCTACGATTT
CAATAGAGGTATCGACTATGGAACAATTCTCAAATCCTATTCATCGATGG
GGATCCAGGGAACAAATTTGAAAATGGTTTTCGACATCATCAATGAAATG
CTTGATTTGAAGTCGGAACCTTTATTCGATGAAGAAATGTCATCCAACTC
GAATCCAATCAAAAGACCATTGACGAATTGCACAATCTTTTTAGGATACA
CTGCCAACATGATATCTTGTGGGGTGCGAGAACAGATTCGATATGTTGTC
GAGCACAATATGGTTGATGTCATTGTAGCATCTGCTGGAGGAATTGAAGA
AGACCTTATCAAATGTTTTGCACCAACATTTATTGGTGATTTCCAAGGTT
ACGACGATGAAAAACTTCGTGAAAACGTCATCAACCGAATCGGAAACATG
TTGGTGCCGAATTCGAACTATGTTAAATTTGCTGACTGGCTCAAGCCGAT
TTTGTTACAAATGCACAAAGAACAATTAGCAAACAATTACAACTGGACCC
CTTCAAAGGTTATTCATAGACTGGGAAAAGAAATAAATAATCGAGAAAGT
GTTTACTACTGGTGTTATAAAAATAACATTCCGGTGTTTTGTCCGGGCCT
GACCGATGGATCAATTGGAGATCTTCTTTATTTTCATTCAATGGAACATC
CTGGTTTTCGAATAGATGTTGTGGAAGACGTCTGCTTGATGGACAAGCAG
GCGACTTGCGCAAAGAATTCAGGAATAATTATCCTTGGAGGTGGAATTAT
TAAGCATCATATAATGAACGCCAATCTCATGAGAGGCGGTGCGAATTTTA
GTGTTTACATCAATACTGGAAATGAATTCGAGGCCAGTGATTCTGGAGCC
CCTCCTGACGAAGCTGTAAGTTGGGGGAAAATCAAAAGTAATGCAAAGAG
AGTCAAACTGATTTCGGAAGCGTCTCTGGTGTTTCCATTAGTTGTTGCAG
AAACATTCGCAAAACGGGTAGCAAATGTAAAGAACTTCAATTAGTAAAAA
TAATTAGTTTTTAGGATGTTTTATTAAATTTCTTTTAC
back to top

protein sequence of SMED30021321-orf-1

>SMED30021321-orf-1 ID=SMED30021321-orf-1|Name=SMED30021321-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=357bp
MNQELILKESKDLPEGVNEVVKGYDFNRGIDYGTILKSYSSMGIQGTNLK
MVFDIINEMLDLKSEPLFDEEMSSNSNPIKRPLTNCTIFLGYTANMISCG
VREQIRYVVEHNMVDVIVASAGGIEEDLIKCFAPTFIGDFQGYDDEKLRE
NVINRIGNMLVPNSNYVKFADWLKPILLQMHKEQLANNYNWTPSKVIHRL
GKEINNRESVYYWCYKNNIPVFCPGLTDGSIGDLLYFHSMEHPGFRIDVV
EDVCLMDKQATCAKNSGIIILGGGIIKHHIMNANLMRGGANFSVYINTGN
EFEASDSGAPPDEAVSWGKIKSNAKRVKLISEASLVFPLVVAETFAKRVA
NVKNFN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
Vocabulary: INTERPRO
TermDefinition
IPR036982Deoxyhypusine_synthase_sf
IPR002773Deoxyhypusine_synthase
IPR029035DHS-like_NAD/FAD-binding_dom
Vocabulary: biological process
TermDefinition
GO:0008612peptidyl-lysine modification to peptidyl-hypusine
GO:0008216spermidine metabolic process
GO:0042102positive regulation of T cell proliferation
GO:0042593glucose homeostasis
GO:0046203spermidine catabolic process
GO:0051289protein homotetramerization
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
GO:0034038deoxyhypusine synthase activity
GO:0042802identical protein binding
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002773Deoxyhypusine synthaseTIGRFAMTIGR00321TIGR00321coord: 21..345
e-value: 1.4E-95
score: 318.1
IPR002773Deoxyhypusine synthasePFAMPF01916DScoord: 35..344
e-value: 8.0E-115
score: 383.0
IPR002773Deoxyhypusine synthasePANTHERPTHR11703DEOXYHYPUSINE SYNTHASEcoord: 3..350
IPR036982Deoxyhypusine synthase superfamilyGENE3DG3DSA:3.40.910.10coord: 18..356
e-value: 9.4E-141
score: 470.6
NoneNo IPR availablePANTHERPTHR11703:SF0DEOXYHYPUSINE SYNTHASEcoord: 3..350
IPR029035DHS-like NAD/FAD-binding domain superfamilySUPERFAMILYSSF52467DHS-like NAD/FAD-binding domaincoord: 12..349