UDENN domain-containing protein

Overview
NameUDENN domain-containing protein
Smed IDSMED30021319
Length (bp)2006
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of UDENN domain-containing protein (SMED30021319) t-SNE clustered cells

Violin plots show distribution of expression levels for UDENN domain-containing protein (SMED30021319) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of UDENN domain-containing protein (SMED30021319) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for UDENN domain-containing protein (SMED30021319) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021319

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30021319SMESG000064223.1 SMESG000046940.1 dd_Smed_v4_9382_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of UDENN domain-containing protein vs. Ensembl Human
Match: DENND6B (DENN domain containing 6B [Source:HGNC Symbol;Acc:HGNC:32690])

HSP 1 Score: 476.093 bits (1224), Expect = 1.120e-160
Identity = 260/572 (45.45%), Postives = 371/572 (64.86%), Query Frame = 1
Query:  139 PVLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR-C---RNPVVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLES--LKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQP 1836
            P  P+   + W+ CVCVVTFDLELGQA+E +YP   +L D EKS++ YLSFPDS+SGC+GDT++ FR R C   R+P   +D   +   P  L+  P   +GYV FRQVKD S++RGYFQKS+V++S LPF+ LF  +  L+A  YFD     LE VC  ID+W  P  GQ +NLP+ GVV+Q +IP + D     P  +               DQ+ ++   +  ++ SVH  D F  F  V++ +Q LWEL+L  + +LV++ SP  +S +V +L S + PL+F  +FRP+FTIHD+EFKEFTT TQ PP V+LG+TNPFF+K L HWP+IL+V + K+     K  KLK P  L K  + KPGLY+ Y   L  DK+L+K L KGV+ +RP  +QS ++R+  LELTQSFI PLE Y+ASLMPL+K I  ++ PP ++ F+ DDFL++LE  GP LT  +KGDW+GLYR F+ SP+F  W  QR +E+ ++L  +H E +C  ++  W++D++EVE+VD +++++ KL   + +++P+     Q     I+T++ SL  DLQ +L  P
Sbjct:   31 PAAPWARFSAWLECVCVVTFDLELGQALELVYPNDFRLTDKEKSSICYLSFPDSHSGCLGDTQFSFRMRQCGGQRSPWHADDRHYNSRAPVALQREPAHYFGYVYFRQVKDSSVKRGYFQKSLVLVSRLPFVRLFQALLSLIAPEYFDKLAPCLEAVCSEIDQWPAPAPGQTLNLPVMGVVVQVRIPSRVDKSESSPPKQF--------------DQENLL--PAPVVLASVHELDLFRCFRPVLTHMQTLWELMLLGEPLLVLAPSPDVSSEMVLALTSCLQPLRFCCDFRPYFTIHDSEFKEFTTRTQAPPNVVLGVTNPFFIKTLQHWPHILRVGEPKMSGDLPKQVKLKKPSRL-KTLDTKPGLYTAYTAHLHRDKALLKRLLKGVQKKRPSDVQSALLRRHLLELTQSFIIPLEHYMASLMPLQKSITPWKTPPQIQPFSQDDFLRSLEHAGPQLTCILKGDWLGLYRRFFKSPHFDGWYRQRHKEMALKLEALHLEAICEANIETWMKDKSEVEVVDLVLKLREKLVRAQGHQLPVKEATLQRAQLYIETVIGSLPKDLQAVLCPP 585          
BLAST of UDENN domain-containing protein vs. Ensembl Human
Match: DENND6A (DENN domain containing 6A [Source:HGNC Symbol;Acc:HGNC:26635])

HSP 1 Score: 459.144 bits (1180), Expect = 9.814e-154
Identity = 263/569 (46.22%), Postives = 376/569 (66.08%), Query Frame = 1
Query:  142 VLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR---CRNPVVHND-NKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTK-LESLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQ 1833
            +L +D+ + W++CVCVV FDLELGQA+E IYP+H KL D EK+N+ YLSFPDSNSGC+GDT++ FRFR    R   +H   ++  +  P  LK  P + YGYV FRQV+DK+++RGYFQKS+V++S LP+I+ F+ V + +A  YF+  E  LE  C+++D+W  P+ G+ ++LP+ GVV++ +IP      TC      H      Q ++  +     +D     I+P+VH  D F  F  V    Q+LWELVL  + ++V++ SP  +S  V +LV+ ISPL++  +FRP+FTIHD+EFKE+TT TQ PP VILG+TNPFF K L HWP+I+++ D K    +  +         K  + KPG+Y++YKP+L  D+ +IK LQKGV+ +RP   QS I+R++FLELTQSFI PLERYVASLMPL+K I  +++PP L++F  ++F+KTLE  GP LTS IKGDWIGLYR F  SPNF  W   R++E+  +L  +H E +C  D+  WIQ   EVE VD ++++K+KL       +P+  +  + L  +I  I+ +L  DLQ +LL+
Sbjct:   52 LLRWDSFSAWLHCVCVVGFDLELGQAVEVIYPQHSKLTDREKTNICYLSFPDSNSGCLGDTQFCFRFRQSSGRRVSLHCLLDQFDKDLPVYLKKDPAYFYGYVYFRQVRDKTLKRGYFQKSLVLISKLPYIHFFHTVLKQIAPEYFEKNEPYLEAACNDVDRWPAPVPGKTLHLPIMGVVMKVRIP------TC------HDKPGTTQIVQLTQ----QVDTNISVILPTVHEVDIFRCFCPVFLHSQMLWELVLLGEPLVVMAPSPSESSETVLALVNCISPLKYFSDFRPYFTIHDSEFKEYTTRTQAPPSVILGVTNPFFAKTLQHWPHIIRIGDLKPTGEIPKQVKVKKLKNLKTLDSKPGVYTSYKPYLNRDEEIIKQLQKGVQQKRPSEAQSVILRRYFLELTQSFIIPLERYVASLMPLQKSISPWKSPPQLRQFLPEEFMKTLEKTGPQLTSRIKGDWIGLYRHFLKSPNFDGWFKTRRKEMTQKLEALHLEALCEEDLLLWIQKHTEVETVDLVLKLKNKLLQADREHLPVKPDTMEKLRTHIDAIILALPEDLQGILLK 604          
BLAST of UDENN domain-containing protein vs. Ensembl Human
Match: DENND6B (DENN domain containing 6B [Source:HGNC Symbol;Acc:HGNC:32690])

HSP 1 Score: 160.614 bits (405), Expect = 8.345e-44
Identity = 99/290 (34.14%), Postives = 143/290 (49.31%), Query Frame = 1
Query:  220 MECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR-C---RNPVVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQK-------------------------------------------------SVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSP 930
            ++ +YP   +L D EKS++ YLSFPDS+SGC+GDT++ FR R C   R+P   +D   +   P  L+  P   +GYV FRQVKD S++RGYFQK                                                 S+V++S LPF+ LF  +  L+A  YFD     LE VC  ID+W  P  GQ +NLP+ GVV+Q +IP + D     P  +               DQ+ ++   +  ++ SVH  D F  F  V++ +Q LWEL+L  + +LV++ SP
Sbjct:   21 LQLVYPNDFRLTDKEKSSICYLSFPDSHSGCLGDTQFSFRMRQCGGQRSPWHADDRHYNSRAPVALQREPAHYFGYVYFRQVKDSSVKRGYFQKALGSSPTGRHPGSSVLGFLLSNNSGVQVRRSWGSCPVKLVGRATLGQLQSLVLVSRLPFVRLFQALLSLIAPEYFDKLAPCLEAVCSEIDQWPAPAPGQTLNLPVMGVVVQVRIPSRVDKSESSPPKQF--------------DQENLL--PAPVVLASVHELDLFRCFRPVLTHMQTLWELMLLGEPLLVLAPSP 294          
BLAST of UDENN domain-containing protein vs. Ensembl Human
Match: DENND6A (DENN domain containing 6A [Source:HGNC Symbol;Acc:HGNC:26635])

HSP 1 Score: 133.265 bits (334), Expect = 4.612e-36
Identity = 63/107 (58.88%), Postives = 81/107 (75.70%), Query Frame = 1
Query: 1315 QSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMC 1635
            QS I+R++FLELTQSFI PLERYVASLMPL+K I  +++PP L++F  ++F+KTLE  GP LTS IKGDWIGLYR F  SPNF  W   R++E+  +L  +H E +C
Sbjct:    4 QSVILRRYFLELTQSFIIPLERYVASLMPLQKSISPWKSPPQLRQFLPEEFMKTLEKTGPQLTSRIKGDWIGLYRHFLKSPNFDGWFKTRRKEMTQKLEALHLEALC 110          
BLAST of UDENN domain-containing protein vs. Ensembl Human
Match: DENND6A (DENN domain containing 6A [Source:HGNC Symbol;Acc:HGNC:26635])

HSP 1 Score: 93.9745 bits (232), Expect = 1.060e-21
Identity = 71/180 (39.44%), Postives = 102/180 (56.67%), Query Frame = 1
Query:  610 DKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTK 1149
            D+W  P+ G+ ++LP+ GVV++                                     +D     I+P+VH  D F  F  V    Q+LWELVL  + ++V++ SP  +S  V +LV+ ISPL++  +FRP+FTIHD+EFKE+TT TQ PP VILG+TNPFF K L HWP+I+++ D K
Sbjct:    2 DRWPAPVPGKTLHLPIMGVVMK-------------------------------------VDTNISVILPTVHEVDIFRCFCPVFLHSQMLWELVLLGEPLVVMAPSPSESSETVLALVNCISPLKYFSDFRPYFTIHDSEFKEYTTRTQAPPSVILGVTNPFFAKTLQHWPHIIRIGDLK 144          
BLAST of UDENN domain-containing protein vs. Ensembl Celegans
Match: F53H1.3 (pep chromosome:WBcel235:IV:1329162:1339376:1 gene:WBGene00018777.1 transcript:F53H1.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53H1.3)

HSP 1 Score: 387.497 bits (994), Expect = 4.711e-127
Identity = 237/569 (41.65%), Postives = 351/569 (61.69%), Query Frame = 1
Query:  148 PFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFRCRNPVVHNDNKT-SEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDY-VTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLESLKNRKLKSPRYLFKQE---EIKPGLYSNYKPFLQIDKSLIKS-LQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLES-GGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTD-VSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLL 1830
            P+D    W++C+CVVTFDLELGQA+E IYP    L+++EK N+ YL+FPDSNS    DT +HFR R     V +  K+  +  P  L     + YG+V+FRQ KD +I RGY+QKS+V++S LP  +LFY V+  +A  +F+ GE  +E  CH+ID W  P AG+ I LPL G ++  ++P   D       +G V +S        +++ Q+L+  + +  I+  VH              L LLWELVL  + +L+V+ +P  TS +VQS+V  +SPL+   +FRP+FTIHD+EF+E+++++++PP+VILG+TNPFF+KAL HWP+ILKV +   E +    +K P+  +      +   GLY+ YKPFL  DKSL K  L+ G  +E    +Q  I+++ FLELT SF+ P+ERY++SLMPL+KE+  F+  P  + F+ DDFL TLE+ GGP+LT G KGDW GLYR F +  NF  WLS R +++N QL   + E +C  D  S  +  +  VEIVD +++I+ ++  C     P   E  + L   +  I+S++  DL+ +L+
Sbjct:    7 PWDRFRDWLHCICVVTFDLELGQALEVIYPGDAILSNTEKINICYLAFPDSNSSNARDTNFHFRIRRAISDVRDCQKSFVDKSPTSLPFDTHYLYGFVHFRQCKDPTIHRGYYQKSIVLMSVLPLFSLFYSVTARIAEHFFESGEAAIEAACHHIDTWQQPHAGRTIELPLLGTLISCRLPAACDLPYEFRLDGHVELS--------DDDSQRLVRPDFTTSIVQHVH-------------HLPLLWELVLLGEPLLIVAPTPSITSALVQSIVGLLSPLRIVNDFRPYFTIHDSEFREYSSKSRSPPRVILGVTNPFFIKALDHWPHILKVAEQGAE-IGGDDMKKPKKTWSSSRTLDTPAGLYTQYKPFLSKDKSLAKKLLRSGNSLE----VQHNILQRHFLELTHSFMIPMERYLSSLMPLKKEMSPFKGIPSTRPFSMDDFLATLETNGGPSLTCGTKGDWQGLYRRFITCSNFGGWLSMRSRDVNAQLKTHYVEALCSADFCSQTLATKHNVEIVDLVLRIRERIIEC-----PPDTEIRRNLVRQVVKILSNVDDDLKQLLM 544          
BLAST of UDENN domain-containing protein vs. Ensembl Celegans
Match: F53H1.3 (pep chromosome:WBcel235:IV:1338304:1339256:1 gene:WBGene00018777.1 transcript:F53H1.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53H1.3)

HSP 1 Score: 93.5893 bits (231), Expect = 2.098e-22
Identity = 51/131 (38.93%), Postives = 75/131 (57.25%), Query Frame = 1
Query: 1456 FDDFLKTLES-GGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTD-VSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQPNS 1842
             DDFL TLE+ GGP+LT G KGDW GLYR F +  NF  WLS R +++N QL   + E +C  D  S  +  +  VEIVD +++I+ ++  C     P   E  + L   +  I+S++  DL+ +L+   S
Sbjct:    1 MDDFLATLETNGGPSLTCGTKGDWQGLYRRFITCSNFGGWLSMRSRDVNAQLKTHYVEALCSADFCSQTLATKHNVEIVDLVLRIRERIIEC-----PPDTEIRRNLVRQVVKILSNVDDDLKQLLMSNCS 126          
BLAST of UDENN domain-containing protein vs. Ensembl Fly
Match: CG3309 (gene:FBgn0029756 transcript:FBtr0344827)

HSP 1 Score: 362.844 bits (930), Expect = 2.212e-116
Identity = 225/601 (37.44%), Postives = 333/601 (55.41%), Query Frame = 1
Query:  157 NLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFRCRNPVVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPM-AGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENN--EDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXV---ILGITNPFFVKALAHWPNILKVTDTKLESL---------KNRKLKSPRYLFKQEEI--------------------------KPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPL---SIEQEQALNENIKTIMSSLAPDLQDML 1827
            N + W++C CVVTFDL LGQA+E +YP     +D E SN+ Y++FPDSNSGCMGDT++H R RC           +E  P  L+      +G+V FRQ +D ++ RGYFQKS ++++ LPF NL+Y +   +A  YF++G   L +    I++  P +  G+ + LPL     Q  IP  +       +G          GI     E    M    +  ++ SV+  + F +   V+ QL  LWELV+T + I+VV  SP   S +VQ+L++ I+PL++  E RP+FTIHD+EF+EFT E  +   +   ILG+TNPFFVK L  WP++L++ D +               R + S        E+                            GL+S Y+P+L+ DK+LIK +  G+K +RPE +Q+ +IR+  LELTQSF+ PLERY+ASLMPL+K+I  F++ P    F  DDFL TLE+ GP LTS +KGDW GLYR F+ SPNF  W   R +E+ + L  +  + +   ++ HW  D+ EVEI+D I+++K KL         L   +   +Q +   I+ +   L PDL++++
Sbjct:   42 NFSQWMHCFCVVTFDLNLGQALEHVYPPAFMPSDQEVSNICYMAFPDSNSGCMGDTKFHMRLRCTTRRDSLPGYNAECSP-ALRQDGSHYWGFVYFRQKRDANLPRGYFQKSFIIITRLPFFNLYYDILSQLAPRYFEEGTDVLRLASEQINRQWPGLRVGKPLQLPLLDCSYQICIPRTSSSRKSTADG----------GIAGGAVESPPAMAACPAAKVLASVNEIELFRSLDFVMEQLYTLWELVITAEPIVVVGTSPADCSHMVQTLLAMIAPLEYCAEARPYFTIHDSEFREFTQECSSKTTLPACILGVTNPFFVKLLKDWPHMLRLVDNQNMQQQQHLLLGQKHARNIASATSFSSSTELGGRIALKSNTNLNGSSSSSNGSGDASSAGLHSKYRPYLKKDKALIKKVLLGMKTKRPEHVQTALIRRHLLELTQSFMIPLERYMASLMPLQKDISPFKSAPNANSFKLDDFLGTLETAGPQLTSPLKGDWKGLYRRFFRSPNFRGWYGARHRELQLTLQDLQLQALSVANLEHWAHDKQEVEIIDMILKLKQKLNLYGDKATQLEGNNGSTQQQIRAQIECMKGLLPPDLKNVV 631          
BLAST of UDENN domain-containing protein vs. Ensembl Fly
Match: CG3309 (gene:FBgn0029756 transcript:FBtr0070798)

HSP 1 Score: 362.459 bits (929), Expect = 2.612e-116
Identity = 226/602 (37.54%), Postives = 334/602 (55.48%), Query Frame = 1
Query:  157 NLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFRCRNPVVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPM-AGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENN--EDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXV---ILGITNPFFVKALAHWPNILKVTDTK------------------------------------LESLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPL---SIEQEQALNENIKTIMSSLAPDLQDML 1827
            N + W++C CVVTFDL LGQA+E +YP     +D E SN+ Y++FPDSNSGCMGDT++H R RC           +E  P  L+      +G+V FRQ +D ++ RGYFQKS ++++ LPF NL+Y +   +A  YF++G   L +    I++  P +  G+ + LPL     Q  IP  +       +G          GI     E    M    +  ++ SV+  + F +   V+ QL  LWELV+T + I+VV  SP   S +VQ+L++ I+PL++  E RP+FTIHD+EF+EFT E  +   +   ILG+TNPFFVK L  WP++L++ D +                                    L+S  N    S       +    GL+S Y+P+L+ DK+LIK +  G+K +RPE +Q+ +IR+  LELTQSF+ PLERY+ASLMPL+K+I  F++ P    F  DDFL TLE+ GP LTS +KGDW GLYR F+ SPNF  W   R +E+ + L  +  + +   ++ HW  D+ EVEI+D I+++K KL         L   +   +Q +   I+ +   L PDL++++
Sbjct:   42 NFSQWMHCFCVVTFDLNLGQALEHVYPPAFMPSDQEVSNICYMAFPDSNSGCMGDTKFHMRLRCTTRRDSLPGYNAECSP-ALRQDGSHYWGFVYFRQKRDANLPRGYFQKSFIIITRLPFFNLYYDILSQLAPRYFEEGTDVLRLASEQINRQWPGLRVGKPLQLPLLDCSYQICIPRTSSSRKSTADG----------GIAGGAVESPPAMAACPAAKVLASVNEIELFRSLDFVMEQLYTLWELVITAEPIVVVGTSPADCSHMVQTLLAMIAPLEYCAEARPYFTIHDSEFREFTQECSSKTTLPACILGVTNPFFVKLLKDWPHMLRLVDNQKNMQQQQHLLLGQKHARNIASATSFSSSTELGGRIALKSNTNLNGSSSSSNGSGDASSAGLHSKYRPYLKKDKALIKKVLLGMKTKRPEHVQTALIRRHLLELTQSFMIPLERYMASLMPLQKDISPFKSAPNANSFKLDDFLGTLETAGPQLTSPLKGDWKGLYRRFFRSPNFRGWYGARHRELQLTLQDLQLQALSVANLEHWAHDKQEVEIIDMILKLKQKLNLYGDKATQLEGNNGSTQQQIRAQIECMKGLLPPDLKNVV 632          
BLAST of UDENN domain-containing protein vs. Ensembl Zebrafish
Match: dennd6aa (DENN/MADD domain containing 6Aa [Source:ZFIN;Acc:ZDB-GENE-041010-63])

HSP 1 Score: 478.789 bits (1231), Expect = 1.058e-161
Identity = 268/577 (46.45%), Postives = 381/577 (66.03%), Query Frame = 1
Query:  142 VLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFRCRNP--------VVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKL--ESLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQPNS 1842
            +LP+D  + W++C+CVV FDLELGQA+E IYP H KL + EK+++ YLSFPDSNSGC+GDT++ FRFR            + H D       P  LK    + YGYV FRQV+DKS++RGYFQKS+V++S LP++  F+ + +L+A  YF+  E  LE  C++ID+W  P  G++++LP+ GVV++ +IP   D    +P      +  ++Q   +        D+    I+P+VH  D F  F  V   +Q+LWELVL  ++++V++ SP  +S  V +LVS ISPL++  +FRP+FTIHD+EFKE+TT TQ PP VILG+TNPFF K L HWP+I+++ D K   E  K  K+K  + L K  + KPG+Y+ YKPFL  D+ +IK LQKGV+ +RP + Q+ I+R++FLELTQSFI PLERYVASLMPL+K I  +++PP L+ FN D+F+KTLE  GP LTS +KGDWIGLYR F  SPNF  W   R++E+  +L  +H E +C  D++  IQ   EVE VD ++++K KL   + +++P+       L  +I TI+ +L  DLQ +L +P S
Sbjct:   45 LLPWDRFSSWLHCICVVGFDLELGQAVEVIYPHHSKLTEKEKTSICYLSFPDSNSGCLGDTQFCFRFRQAAGRKSSLGCFLEHFDRDA----PVSLKKDQGYYYGYVYFRQVRDKSLKRGYFQKSLVLISKLPYVTFFHSLLKLIAPEYFEKQEPCLEAACNDIDRWPTPCPGKILSLPIMGVVMKLRIPTCYD----KPG-----TSQLVQSTPS--------DSQVSIILPTVHEVDLFRCFHPVFFHIQMLWELVLLGEALVVMAPSPAESSDTVLALVSCISPLRYCSDFRPYFTIHDSEFKEYTTRTQAPPSVILGVTNPFFAKTLQHWPHIIRIGDMKTAGEMAKQMKVKKLKNL-KTLDSKPGVYTAYKPFLNKDEDIIKQLQKGVQQKRPSAAQNAILRRYFLELTQSFIIPLERYVASLMPLQKSISPWKSPPQLRPFNQDEFMKTLEKAGPQLTSRLKGDWIGLYRQFLRSPNFDGWFRNRRKEMLQKLEALHLEALCEEDLTLRIQKHTEVETVDLVLKLKEKLTQAEKDQLPVKAGTLAKLQAHIDTIILTLPEDLQGILHKPPS 599          
BLAST of UDENN domain-containing protein vs. Ensembl Zebrafish
Match: dennd6b (DENN/MADD domain containing 6B [Source:ZFIN;Acc:ZDB-GENE-030131-9382])

HSP 1 Score: 446.432 bits (1147), Expect = 1.710e-149
Identity = 243/571 (42.56%), Postives = 373/571 (65.32%), Query Frame = 1
Query:  148 PFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFRCRNPVVHNDNKTSEFY----------PDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLESLKNRKLKSPRYL-FKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDML 1827
            P+   + W+ CVCVVTFDLELGQA+E +YP  +KL + EK+++ YLSFPDS SGC+GDT++ FR R       +  ++S ++          P  L+      +GYV FRQVKD +++RGYFQKS+VV+S LPF+NLF+ + +++A  YF+  E  LE VC+ ID+W  P+ GQ +NLP+ GVV+Q +IP K +     P             ++  + + L+    +  ++PSVH  D F  F +V+  +Q+LWEL+L  + +++++ SP  +S  V +LVSSI PL +  ++RP+FTIHD+EFKE+TT TQ PP VILG+TNPFF+K    WP+I+++ + K+     +++K  +    K  + K G+Y+ YK FL  DK+LIK L KG++ +RP  +QS I+R+  LE TQSFI PLE+Y+ +LMP ++ +  ++ PP ++ FN D+F+KTLE  GP LT  +KGD+ GLYR F+ SPNF  W   R +E++ ++  +H E +C  D+  W +D++EVEIVD I++++ KL   + +++P+  E  + L ++I+TI+SSL  DLQ +L
Sbjct:   26 PWSRFSAWLECVCVVTFDLELGQAIELVYPHDVKLTEKEKTSICYLSFPDSYSGCLGDTQFSFRLR------QSVGRSSSWFGQEDVYNRDAPVTLQKEHAHLHGYVYFRQVKDATVKRGYFQKSLVVVSRLPFVNLFHSLLQVIAPEYFEKLEPCLETVCNEIDQWPAPVPGQTLNLPVMGVVMQIRIPSKVETAEGSP-------------VKQQQTENLL---PAPTVLPSVHELDLFKCFQSVLIHVQMLWELMLLGEPVVIMAPSPTVSSETVLALVSSIDPLHYFGDYRPYFTIHDSEFKEYTTRTQAPPNVILGVTNPFFIKTFQSWPHIIRLGELKMSGDLPKQVKIKKLAKLKTLDTKTGIYTAYKTFLHKDKTLIKRLLKGIQKKRPSEVQSAILRRHLLEQTQSFILPLEQYLETLMPPQRSVSPWKTPPQIRSFNQDEFMKTLEQAGPQLT--LKGDFTGLYRRFFKSPNFDGWYRFRHREMSQKVECLHLEAICAADLLTWTKDKSEVEIVDLILKLREKLMRARKHQLPVKEELLERLEQSIQTIISSLPEDLQTVL 572          
BLAST of UDENN domain-containing protein vs. Ensembl Zebrafish
Match: dennd6aa (DENN/MADD domain containing 6Aa [Source:ZFIN;Acc:ZDB-GENE-041010-63])

HSP 1 Score: 270.396 bits (690), Expect = 5.140e-84
Identity = 157/347 (45.24%), Postives = 227/347 (65.42%), Query Frame = 1
Query:  142 VLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFRCRNPVVHNDNKTSEFY----PDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLESLKNR 1170
            +LP+D  + W++C+CVV FDLELGQA+E IYP H KL + EK+++ YLSFPDSNSGC+GDT++ FRFR       +     E +    P  LK    + YGYV FRQV+DKS++RGYFQKS+V++S LP++  F+ + +L+A  YF+  E  LE  C++ID+W  P  G++++LP+ GVV++ +IP   D    +P      +  ++Q   +        D+    I+P+VH  D F  F  V   +Q+LWELVL  ++++V++ SP  +S  V +LVS ISPL++  +FRP+FTIHD+EFKE+TT TQ PP VILG+TNPFF K L HWP+I+++ D K      R
Sbjct:   45 LLPWDRFSSWLHCICVVGFDLELGQAVEVIYPHHSKLTEKEKTSICYLSFPDSNSGCLGDTQFCFRFRQAAGRKSSLGCFLEHFDRDAPVSLKKDQGYYYGYVYFRQVRDKSLKRGYFQKSLVLISKLPYVTFFHSLLKLIAPEYFEKQEPCLEAACNDIDRWPTPCPGKILSLPIMGVVMKLRIPTCYD----KPG-----TSQLVQSTPS--------DSQVSIILPTVHEVDLFRCFHPVFFHIQMLWELVLLGEALVVMAPSPAESSDTVLALVSCISPLRYCSDFRPYFTIHDSEFKEYTTRTQAPPSVILGVTNPFFAKTLQHWPHIIRIGDMKTAGASFR 374          
BLAST of UDENN domain-containing protein vs. Ensembl Zebrafish
Match: dennd6aa (DENN/MADD domain containing 6Aa [Source:ZFIN;Acc:ZDB-GENE-041010-63])

HSP 1 Score: 218.779 bits (556), Expect = 2.280e-65
Identity = 112/267 (41.95%), Postives = 169/267 (63.30%), Query Frame = 1
Query:  142 VLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFRCRNPVVHNDNKTSEFY----PDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSP 930
            +LP+D  + W++C+CVV FDLELGQA+E IYP H KL + EK+++ YLSFPDSNSGC+GDT++ FRFR       +     E +    P  LK    + YGYV FRQV+DKS++RGYFQKS+V++S LP++  F+ + +L+A  YF+  E  LE  C++ID+W  P  G++++LP+ GVV++ +IP   D    +P      +  ++Q   +        D+    I+P+VH  D F  F  V   +Q+LWELVL  ++++V++ SP
Sbjct:   45 LLPWDRFSSWLHCICVVGFDLELGQAVEVIYPHHSKLTEKEKTSICYLSFPDSNSGCLGDTQFCFRFRQAAGRKSSLGCFLEHFDRDAPVSLKKDQGYYYGYVYFRQVRDKSLKRGYFQKSLVLISKLPYVTFFHSLLKLIAPEYFEKQEPCLEAACNDIDRWPTPCPGKILSLPIMGVVMKLRIPTCYD----KPG-----TSQLVQSTPS--------DSQVSIILPTVHEVDLFRCFHPVFFHIQMLWELVLLGEALVVMAPSP 294          
BLAST of UDENN domain-containing protein vs. Ensembl Xenopus
Match: bmper (BMP binding endothelial regulator [Source:Xenbase;Acc:XB-GENE-480927])

HSP 1 Score: 395.201 bits (1014), Expect = 9.454e-130
Identity = 236/570 (41.40%), Postives = 344/570 (60.35%), Query Frame = 1
Query:  142 VLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR---CRNPVVHNDNK-TSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLESLK--NRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQ 1833
             LP+D  + W++ +CVV FDLELGQ +E             K+++ YLSFPDSNSGC+GDT++ FRFR    R   +H  N  T    P  LK  P   YGYV FRQV+DK+++RGYFQKS+V++S LP+IN F+ V + +A  YF+  E  LE  C +ID+W  P+ G+ + LP+ GVV++ +IP + D         +  +  ++  +         +    +C + +V    CF+    V+  +Q++WELVL  + ++V++ SP  +S  V +LV  ISPL++  +FRP+FTIHDTEFKE+TT TQ PP VI G+TNPFF K L HWP+I+++ D KL   +  ++         K  + KPG+YS+YKP+L  D+ +IK LQKGV+  RP   Q+ I+R+ FLELTQSFI PLERYVA LMPL K + A+++PP LK F+ ++F+K+LE  GP LTS +KGDWIGLYR                    I +  +     C +D+  W+Q   EVE VD ++++K+KL   +   +P+  E  + L  ++  I+  L  DLQ +LL+
Sbjct:   15 ALPWDRFSAWLHAICVVGFDLELGQTVEV-----------SKTSICYLSFPDSNSGCLGDTQFCFRFRQSTGRRASLHCANDLTDRESPVYLKKDPACFYGYVYFRQVRDKTLKRGYFQKSLVLISKLPYINFFHTVLKQLAPEYFERSEPCLEAACSDIDRWPSPVPGKTLTLPIMGVVIKVRIPTRYDKPGTTQMSLIQTTAWLLGKVRPP------MRFYHMCNV-NVSFPRCFSP---VLFHIQMVWELVLLGEPLVVMAPSPSQSSETVLALVGCISPLKYCSDFRPYFTIHDTEFKEYTTRTQAPPSVIFGVTNPFFAKTLQHWPHIIRIGDVKLAGTEAFSQVKVKKLKNLKTLDSKPGVYSSYKPYLNRDEEIIKQLQKGVQQRRPTEAQNAILRRHFLELTQSFIIPLERYVAGLMPLLKSVCAWKSPPQLKPFSQEEFMKSLERAGPQLTSALKGDWIGLYRCLI-----------------IYIYSMPLIGPCASDLLMWVQKHTEVEAVDLVLKLKNKLAQAQREELPVKAETLEKLRNHVCAIIDELPEDLQGILLK 546          
BLAST of UDENN domain-containing protein vs. Ensembl Xenopus
Match: bmper (BMP binding endothelial regulator [Source:Xenbase;Acc:XB-GENE-480927])

HSP 1 Score: 366.696 bits (940), Expect = 1.775e-119
Identity = 212/470 (45.11%), Postives = 295/470 (62.77%), Query Frame = 1
Query:  145 LPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR---CRNPVVHNDNK-TSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLES-LKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYR 1539
            LP+D  + W++ +CVV FDLELGQ +E      +    + K+++ YLSFPDSNSGC+GDT++ FRFR    R   +H  N  T    P  LK  P   YGYV FRQV+DK+++RGYFQKS+V++S LP+IN F+ V + +A  YF+  E  LE  C +ID+W  P+ G+ + LP+ GVV++                                   L++       +P++H  D F  F  V+  +Q++WELVL  + ++V++ SP  +S  V +LV  ISPL++  +FRP+FTIHDTEFKE+TT TQ PP VI G+TNPFF K L HWP+I+++ D KL   +  +         K  + KPG+YS+YKP+L  D+ +IK LQKGV+  RP   Q+ I+R+ FLELTQSFI PLERYVA LMPL K + A+++PP LK F+ ++F+K+LE  GP LTS +KGDWIGLYR
Sbjct:   26 LPWDRFSAWLHAICVVGFDLELGQTVEV----SVWGGSNGKTSICYLSFPDSNSGCLGDTQFCFRFRQSTGRRASLHCANDLTDRESPVYLKKDPACFYGYVYFRQVRDKTLKRGYFQKSLVLISKLPYINFFHTVLKQLAPEYFERSEPCLEAACSDIDRWPSPVPGKTLTLPIMGVVIKVM--------------------------------GLVLQAQISVTLPTIHEVDLFRCFSPVLFHIQMVWELVLLGEPLVVMAPSPSQSSETVLALVGCISPLKYCSDFRPYFTIHDTEFKEYTTRTQAPPSVIFGVTNPFFAKTLQHWPHIIRIGDVKLAGDVPKQVKVKKLKNLKTLDSKPGVYSSYKPYLNRDEEIIKQLQKGVQQRRPTEAQNAILRRHFLELTQSFIIPLERYVAGLMPLLKSVCAWKSPPQLKPFSQEEFMKSLERAGPQLTSALKGDWIGLYR 459          
BLAST of UDENN domain-containing protein vs. Ensembl Xenopus
Match: bmper (BMP binding endothelial regulator [Source:Xenbase;Acc:XB-GENE-480927])

HSP 1 Score: 350.903 bits (899), Expect = 1.596e-112
Identity = 215/569 (37.79%), Postives = 321/569 (56.41%), Query Frame = 1
Query:  142 VLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR---CRNPVVHNDNK-TSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLES-LKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQ 1833
             LP+D  + W++ +CVV FDLELGQ +E             K+++ YLSFPDSNSGC+GDT++ FRFR    R   +H  N  T    P  LK  P   YGYV FRQV+DK+++RGYFQKS+V++S LP+IN F+ V + +A  YF+  E  LE  C +ID+W  P+ G+ + LP+ GVV++ +IP + D                 Q +E ++         ++    +V    CF+    V+  +Q++WELVL  + ++V++ SP  +S  V +LV  ISPL++  +FRP+FTIHD   +     T+    ++ G+   F    L H+   + +    L   +  +         K  + KPG+YS+YKP+L  D+ +IK LQKGV+  RP   Q+ I+R+ FLELTQSFI PLERYVA LMPL K + A+++PP LK F+ ++F+K+LE  GP LTS +KGDWIGLYR                    I +  +     C +D+  W+Q   EVE VD ++++K+KL   +   +P+  E  + L  ++  I+  L  DLQ +LL+
Sbjct:   34 ALPWDRFSAWLHAICVVGFDLELGQTVEV-----------SKTSICYLSFPDSNSGCLGDTQFCFRFRQSTGRRASLHCANDLTDRESPVYLKKDPACFYGYVYFRQVRDKTLKRGYFQKSLVLISKLPYINFFHTVLKQLAPEYFERSEPCLEAACSDIDRWPSPVPGKTLTLPIMGVVIKVRIPTRYD------------KPGTTQMVELSQPPMRFYHMCNV----NVSFPRCFS---PVLFHIQMVWELVLLGEPLVVMAPSPSQSSETVLALVGCISPLKYCSDFRPYFTIHD--TEFKEYTTRPQIILLCGVWQGFMAPHL-HFVVCMTLGLLALAGDVPKQVKVKKLKNLKTLDSKPGVYSSYKPYLNRDEEIIKQLQKGVQQRRPTEAQNAILRRHFLELTQSFIIPLERYVAGLMPLLKSVCAWKSPPQLKPFSQEEFMKSLERAGPQLTSALKGDWIGLYRCLI-----------------IYIYSMPLIGPCASDLLMWVQKHTEVEAVDLVLKLKNKLAQAQREELPVKAETLEKLRNHVCAIIDELPEDLQGILLK 552          
BLAST of UDENN domain-containing protein vs. Ensembl Xenopus
Match: bmper (BMP binding endothelial regulator [Source:Xenbase;Acc:XB-GENE-480927])

HSP 1 Score: 348.977 bits (894), Expect = 6.127e-112
Identity = 226/582 (38.83%), Postives = 332/582 (57.04%), Query Frame = 1
Query:  103 RMSILSKKDDIKPVLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR---CRNPVVHNDNK-TSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLES-LKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQ 1833
            R+ IL    +    LP+D  + W++ +CVV FDLELGQ +E             K+++ YLSFPDSNSGC+GDT++ FRFR    R   +H  N  T    P  LK  P   YGYV FRQV+DK+++RGYFQKS+V++S LP+IN F+ V + +A  YF+  E  LE  C +ID+W  P+ G+ + LP+ GVV++ +IP + D                 Q +E        +    +C + +V    CF+    V+  +Q++WELVL  + ++V++ SP  +S  V +LV  ISPL++  +FRP+FTIHDTEFKE+TT  Q    ++ G+   F    L H+   + +    L   +  +         K  + KPG+YS+YKP+L  D+ +IK LQKGV+  RP   Q+ I+R+ FLELTQSFI PLERYVA LMPL K + A+++PP LK F+ ++F+K+LE  GP LTS +KGDWIGLYR                    I +  +     C +D+  W+Q   EVE VD ++++K+KL   +   +P+  E  + L  ++  I+  L  DLQ +LL+
Sbjct:    9 RVFILDVGAENPLALPWDRFSAWLHAICVVGFDLELGQTVEV-----------SKTSICYLSFPDSNSGCLGDTQFCFRFRQSTGRRASLHCANDLTDRESPVYLKKDPACFYGYVYFRQVRDKTLKRGYFQKSLVLISKLPYINFFHTVLKQLAPEYFERSEPCLEAACSDIDRWPSPVPGKTLTLPIMGVVIKVRIPTRYD------------KPGTTQMVEPP------MRFYHMCNV-NVSFPRCFSP---VLFHIQMVWELVLLGEPLVVMAPSPSQSSETVLALVGCISPLKYCSDFRPYFTIHDTEFKEYTTRPQII--LLCGVWQGFMAPHL-HFVVCMTLGLLALAGDVPKQVKVKKLKNLKTLDSKPGVYSSYKPYLNRDEEIIKQLQKGVQQRRPTEAQNAILRRHFLELTQSFIIPLERYVAGLMPLLKSVCAWKSPPQLKPFSQEEFMKSLERAGPQLTSALKGDWIGLYRCLI-----------------IYIYSMPLIGPCASDLLMWVQKHTEVEAVDLVLKLKNKLAQAQREELPVKAETLEKLRNHVCAIIDELPEDLQGILLK 537          
BLAST of UDENN domain-containing protein vs. Ensembl Xenopus
Match: bcl11b (BCL11B, BAF complex component [Source:Xenbase;Acc:XB-GENE-993642])

HSP 1 Score: 339.347 bits (869), Expect = 1.977e-108
Identity = 216/569 (37.96%), Postives = 325/569 (57.12%), Query Frame = 1
Query:  145 LPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR----CRNPVVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCF----TAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLESLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDML 1827
            LP++  + W+  +CVVTFDLEL      ++   I                   +GC+GDT++ FR R     R+     + K +   P  L+      YGYV FRQV+D S++RGYFQKS+V+LS LP+ NLF+ + +L+A  YF+  +  LE VC+ ID+W  P  G L++LP+ G+VLQ +IP ++D                           LM  N   C         CF     A  +V+  LQ+LWELVL  + +++++ SP  +S +V +L+S ISPL+F+ +FRP+FTIHD E+KE+TT TQ PP ++LG+TNPFF+K L HWP+IL+V + ++             L KQ ++K            I  +L+  LQ G++ + P S  S I+RK   ELTQSFI PLERY+ SLMP    I A++NPP ++ F  ++ +K LE  GP L S IKGDW+GLYR F  SP+F  W   +Q+E+  +L   H +++C  ++S WI++++EVEIVD +++++ KL+     ++P+S      L ++I  ++ SL  DLQ +L
Sbjct:   27 LPWEGFSAWLDGICVVTFDLELAL---LVFSAPILFI----------------AGCLGDTQFTFRMRRSAGQRSCPFQENEKYNRETPVTLQRDGAHFYGYVYFRQVRDSSVKRGYFQKSLVLLSSLPYTNLFHTILQLIAPEYFNKLDPCLEAVCNQIDRWPLPEPGVLLSLPIMGLVLQVRIPSRSD---------------------------LMETNCIFC---------CFLYVTRALQSVLMNLQMLWELVLLGEPLVIMAPSPTISSEIVLALISCISPLKFSSDFRPYFTIHDNEYKEYTTRTQAPPSLLLGVTNPFFIKTLQHWPHILRVGEPRMSG----------DLPKQVKLKKTAKLKTLDTKHILFTLLAFLQ-GLQKKFPSSTLSSILRKHLFELTQSFILPLERYMGSLMPHHSSITAWKNPPQVRPFQQEELMKMLEHTGPQLNSPIKGDWMGLYRRFLKSPHFDGWYRLKQREMRERLETAHLKVICEANISAWIKNKSEVEIVDLVLKLRDKLQRAYRQQLPVSAASLARLKDHIDAVICSLPEDLQSIL 529          
BLAST of UDENN domain-containing protein vs. Ensembl Mouse
Match: Dennd6a (DENN/MADD domain containing 6A [Source:MGI Symbol;Acc:MGI:2442980])

HSP 1 Score: 461.84 bits (1187), Expect = 5.002e-155
Identity = 263/576 (45.66%), Postives = 379/576 (65.80%), Query Frame = 1
Query:  121 KKDDIKPVLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR---CRNPVVHND-NKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTK-LESLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQ 1833
            + D  + +L +D  + W++CVCVV FDLELGQA+E IYP+H KL D EK+N+ YLSFPDSNSGC+GDT++ FRFR    R   +H   ++  +  P  LK  P + YGYV FRQV+DK+++RGYFQKS+V++S LP+I+ F+ V + +A  YF+  E  LE  C+++D+W  P+ G+ ++LP+ G+V++ +IP      TC      H      Q ++  +      D  +  I+P+VH  D F  F  V    Q+LWELVL  + ++V++ SP  +S  V +LV+ ISPL++  +FRP+FTIHD+EFKE+TT TQ PP VILG+TNPFF K L HWP+I+++ D K    +  +         K  + KPG+Y++YKP+L  D+ +IK LQKG++ +RP   QS I+R++FLELTQSFI PLERYVASLMPL+K I  +++PP L++F  ++F+KTLE  GP LTSGIKGDWIGLYR F  SPNF  W   R++E+  +L  +H E +C  D+  WIQ   EVE VD ++++K+KL       +P+  +  + L  +I  I+ +L  DLQ +LL+
Sbjct:   42 EDDGRRGLLRWDGFSAWLHCVCVVGFDLELGQAVEVIYPQHSKLTDKEKTNICYLSFPDSNSGCLGDTQFCFRFRQSSGRRVSLHCLLDEFDKDLPVYLKKDPAYFYGYVYFRQVRDKTLKRGYFQKSLVLISKLPYIHFFHTVLKQIAPEYFEKNEPYLEAACNDVDRWPAPVPGKTLHLPIMGLVMKVRIP------TC------HDKPGTTQMVQLTQ----QADTHTSIILPTVHEVDLFRCFCPVFLHSQMLWELVLLGEPLVVMAPSPSESSETVLALVNCISPLKYFSDFRPYFTIHDSEFKEYTTRTQAPPSVILGVTNPFFAKTLQHWPHIIRIGDLKPAGEIPKQVKVKKLKNLKTLDSKPGVYTSYKPYLNRDEEIIKQLQKGIQQKRPSEAQSVILRRYFLELTQSFIIPLERYVASLMPLQKSISPWKSPPQLRQFLPEEFMKTLEKTGPQLTSGIKGDWIGLYRQFLKSPNFDGWFKTRRKEMTQKLEALHLEALCEEDLLLWIQKHTEVETVDLVLKLKNKLLQAGRESLPVKPDTVEKLRTHIDAIILALPDDLQGILLK 601          
BLAST of UDENN domain-containing protein vs. Ensembl Mouse
Match: Dennd6a (DENN/MADD domain containing 6A [Source:MGI Symbol;Acc:MGI:2442980])

HSP 1 Score: 461.84 bits (1187), Expect = 5.002e-155
Identity = 263/576 (45.66%), Postives = 379/576 (65.80%), Query Frame = 1
Query:  121 KKDDIKPVLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR---CRNPVVHND-NKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTK-LESLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQ 1833
            + D  + +L +D  + W++CVCVV FDLELGQA+E IYP+H KL D EK+N+ YLSFPDSNSGC+GDT++ FRFR    R   +H   ++  +  P  LK  P + YGYV FRQV+DK+++RGYFQKS+V++S LP+I+ F+ V + +A  YF+  E  LE  C+++D+W  P+ G+ ++LP+ G+V++ +IP      TC      H      Q ++  +      D  +  I+P+VH  D F  F  V    Q+LWELVL  + ++V++ SP  +S  V +LV+ ISPL++  +FRP+FTIHD+EFKE+TT TQ PP VILG+TNPFF K L HWP+I+++ D K    +  +         K  + KPG+Y++YKP+L  D+ +IK LQKG++ +RP   QS I+R++FLELTQSFI PLERYVASLMPL+K I  +++PP L++F  ++F+KTLE  GP LTSGIKGDWIGLYR F  SPNF  W   R++E+  +L  +H E +C  D+  WIQ   EVE VD ++++K+KL       +P+  +  + L  +I  I+ +L  DLQ +LL+
Sbjct:   42 EDDGRRGLLRWDGFSAWLHCVCVVGFDLELGQAVEVIYPQHSKLTDKEKTNICYLSFPDSNSGCLGDTQFCFRFRQSSGRRVSLHCLLDEFDKDLPVYLKKDPAYFYGYVYFRQVRDKTLKRGYFQKSLVLISKLPYIHFFHTVLKQIAPEYFEKNEPYLEAACNDVDRWPAPVPGKTLHLPIMGLVMKVRIP------TC------HDKPGTTQMVQLTQ----QADTHTSIILPTVHEVDLFRCFCPVFLHSQMLWELVLLGEPLVVMAPSPSESSETVLALVNCISPLKYFSDFRPYFTIHDSEFKEYTTRTQAPPSVILGVTNPFFAKTLQHWPHIIRIGDLKPAGEIPKQVKVKKLKNLKTLDSKPGVYTSYKPYLNRDEEIIKQLQKGIQQKRPSEAQSVILRRYFLELTQSFIIPLERYVASLMPLQKSISPWKSPPQLRQFLPEEFMKTLEKTGPQLTSGIKGDWIGLYRQFLKSPNFDGWFKTRRKEMTQKLEALHLEALCEEDLLLWIQKHTEVETVDLVLKLKNKLLQAGRESLPVKPDTVEKLRTHIDAIILALPDDLQGILLK 601          
BLAST of UDENN domain-containing protein vs. Ensembl Mouse
Match: Dennd6b (DENN/MADD domain containing 6B [Source:MGI Symbol;Acc:MGI:1916690])

HSP 1 Score: 458.759 bits (1179), Expect = 3.946e-154
Identity = 252/570 (44.21%), Postives = 369/570 (64.74%), Query Frame = 1
Query:  145 LPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR-C---RNPVVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLES--LKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQP 1836
            +P+   + W+ CVCVVTFDLELGQA+E +YP   +L D EKS++ YL+FPDS+SGC+GDT++ FR R C   R+    +D   +   P  L+  P    GYV FRQVKD S++RGYFQKS+V++S LPF+ LF  +  L+A  YF+     LE VC+ ID+W  P+ GQ +NLP+ GVV+Q +IP + D +   P  +               DQ+ ++   +  ++ SVH  D F  F  V++ +Q LWEL+L  + ++V++ SP  +S +V +L S + PL+F  +FRP+FTIHD+EFKE TT TQ PP V+LG+TNPFF+K L HWP++L++ + K+     K  KLK P  L K  + KPGLY++Y   L  DK+L+K L KGV+ +RP  +QS ++R+  LELTQSFI PLE Y+ASLMPL+K I  +++PP +  F  DDFL++LE  GP LT  +KGDW+GLYR F+ SP+F  W  QR +E+  +L  +H E +C  ++  W++D++EVE+VD +++++ KL   + +++P+     Q     I T++ SL  DLQ +L  P
Sbjct:   33 MPWARFSAWLECVCVVTFDLELGQALELVYPSDFRLTDKEKSSICYLAFPDSHSGCLGDTQFSFRMRQCGGQRSLWQVDDRSYNNKAPLALQREPAHYLGYVYFRQVKDSSVKRGYFQKSLVLVSRLPFVRLFQSLLSLIAPEYFEKLAPCLEAVCNEIDQWPAPVPGQTLNLPIMGVVIQVRIPSRVDKLESSPPKQC--------------DQENLL--PAPVVLTSVHELDLFRCFRPVLTHVQTLWELMLLGEPLVVLAPSPDVSSELVLALTSCLQPLKFCCDFRPYFTIHDSEFKELTTRTQAPPNVVLGVTNPFFIKTLQHWPHVLRIGEPKMSGDLPKQVKLKKPSRL-KTLDTKPGLYTSYTAHLHRDKALLKRLLKGVQKKRPWDVQSALLRRHLLELTQSFIIPLEHYMASLMPLQKNITPWKSPPQICPFRQDDFLRSLEHAGPQLTCILKGDWLGLYRRFFKSPHFDGWYRQRHKEMAQKLEALHLEAICEANIEAWMKDKSEVEVVDLVLKLREKLVRAQGHQLPVKEVTLQRAQLYIDTVIGSLPKDLQAVLCPP 585          
BLAST of UDENN domain-containing protein vs. Ensembl Mouse
Match: Dennd6a (DENN/MADD domain containing 6A [Source:MGI Symbol;Acc:MGI:2442980])

HSP 1 Score: 432.18 bits (1110), Expect = 4.346e-144
Identity = 241/508 (47.44%), Postives = 341/508 (67.13%), Query Frame = 1
Query:  127 DDIKPVLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR---CRNPVVHND-NKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTK-LESLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMC 1635
            D  + +L +D  + W++CVCVV FDLELGQA+E IYP+H KL D EK+N+ YLSFPDSNSGC+GDT++ FRFR    R   +H   ++  +  P  LK  P + YGYV FRQV+DK+++RGYFQKS+V++S LP+I+ F+ V + +A  YF+  E  LE  C+++D+W  P+ G+ ++LP+ G+V++ +IP      TC      H      Q ++  +      D  +  I+P+VH  D F  F  V    Q+LWELVL  + ++V++ SP  +S  V +LV+ ISPL++  +FRP+FTIHD+EFKE+TT TQ PP VILG+TNPFF K L HWP+I+++ D K    +  +         K  + KPG+Y++YKP+L  D+ +IK LQKG++ +RP   QS I+R++FLELTQSFI PLERYVASLMPL+K I  +++PP L++F  ++F+KTLE  GP LTSGIKGDWIGLYR F  SPNF  W   R++E+  +L  +H E +C
Sbjct:   44 DGRRGLLRWDGFSAWLHCVCVVGFDLELGQAVEVIYPQHSKLTDKEKTNICYLSFPDSNSGCLGDTQFCFRFRQSSGRRVSLHCLLDEFDKDLPVYLKKDPAYFYGYVYFRQVRDKTLKRGYFQKSLVLISKLPYIHFFHTVLKQIAPEYFEKNEPYLEAACNDVDRWPAPVPGKTLHLPIMGLVMKVRIP------TC------HDKPGTTQMVQLTQQ----ADTHTSIILPTVHEVDLFRCFCPVFLHSQMLWELVLLGEPLVVMAPSPSESSETVLALVNCISPLKYFSDFRPYFTIHDSEFKEYTTRTQAPPSVILGVTNPFFAKTLQHWPHIIRIGDLKPAGEIPKQVKVKKLKNLKTLDSKPGVYTSYKPYLNRDEEIIKQLQKGIQQKRPSEAQSVILRRYFLELTQSFIIPLERYVASLMPLQKSISPWKSPPQLRQFLPEEFMKTLEKTGPQLTSGIKGDWIGLYRQFLKSPNFDGWFKTRRKEMTQKLEALHLEALC 535          
BLAST of UDENN domain-containing protein vs. Ensembl Mouse
Match: Dennd6a (DENN/MADD domain containing 6A [Source:MGI Symbol;Acc:MGI:2442980])

HSP 1 Score: 432.18 bits (1110), Expect = 4.346e-144
Identity = 241/508 (47.44%), Postives = 341/508 (67.13%), Query Frame = 1
Query:  127 DDIKPVLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR---CRNPVVHND-NKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTK-LESLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMC 1635
            D  + +L +D  + W++CVCVV FDLELGQA+E IYP+H KL D EK+N+ YLSFPDSNSGC+GDT++ FRFR    R   +H   ++  +  P  LK  P + YGYV FRQV+DK+++RGYFQKS+V++S LP+I+ F+ V + +A  YF+  E  LE  C+++D+W  P+ G+ ++LP+ G+V++ +IP      TC      H      Q ++  +      D  +  I+P+VH  D F  F  V    Q+LWELVL  + ++V++ SP  +S  V +LV+ ISPL++  +FRP+FTIHD+EFKE+TT TQ PP VILG+TNPFF K L HWP+I+++ D K    +  +         K  + KPG+Y++YKP+L  D+ +IK LQKG++ +RP   QS I+R++FLELTQSFI PLERYVASLMPL+K I  +++PP L++F  ++F+KTLE  GP LTSGIKGDWIGLYR F  SPNF  W   R++E+  +L  +H E +C
Sbjct:   44 DGRRGLLRWDGFSAWLHCVCVVGFDLELGQAVEVIYPQHSKLTDKEKTNICYLSFPDSNSGCLGDTQFCFRFRQSSGRRVSLHCLLDEFDKDLPVYLKKDPAYFYGYVYFRQVRDKTLKRGYFQKSLVLISKLPYIHFFHTVLKQIAPEYFEKNEPYLEAACNDVDRWPAPVPGKTLHLPIMGLVMKVRIP------TC------HDKPGTTQMVQLTQQ----ADTHTSIILPTVHEVDLFRCFCPVFLHSQMLWELVLLGEPLVVMAPSPSESSETVLALVNCISPLKYFSDFRPYFTIHDSEFKEYTTRTQAPPSVILGVTNPFFAKTLQHWPHIIRIGDLKPAGEIPKQVKVKKLKNLKTLDSKPGVYTSYKPYLNRDEEIIKQLQKGIQQKRPSEAQSVILRRYFLELTQSFIIPLERYVASLMPLQKSISPWKSPPQLRQFLPEEFMKTLEKTGPQLTSGIKGDWIGLYRQFLKSPNFDGWFKTRRKEMTQKLEALHLEALC 535          
BLAST of UDENN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5F3L4|DEN6A_CHICK (Protein DENND6A OS=Gallus gallus OX=9031 GN=DENND6A PE=2 SV=1)

HSP 1 Score: 481.1 bits (1237), Expect = 5.594e-162
Identity = 270/578 (46.71%), Postives = 379/578 (65.57%), Query Frame = 1
Query:  139 PVLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFRCRNP--------VVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLES-LKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQPNSG 1845
            P+LP+D  + W++CVCVV FDLELGQA+E IYP H KL D EK+N+ YLSFPDSNSGC+GDT++ FRFR  +         + H D       P  LK  P + YGYV FRQV+DKS++RGYFQKS+V++S LP+I+LF  V + +A  YF+  E  LE VC ++D+W PP+ G++++LP+ GVV++ +IP   D     P         ++Q +   + Q  M        +P+VH  D F  F  V   +Q+LWELVL  + ++V++ SP  +S  V +LVS ISPL++  +FRP+FTIHD+EFKE+TT TQ PP VILG+TNPFF K L HWP+I+++ D KL   +  +         K  + KPG+Y++YKP+L  D+ ++K LQKGV+ +RP   QS I+R++FLELT+SFI PLERYVASLMPL+K I  +++PP L+ F+ DDF+KTLE  GP LTSG+KGDWIGLYR F  SPNF  W   RQ+E+   L  +H E +C  ++  W Q   EVE VD ++++K+KL       +P+  +  + L  +I+ I+ +L  DLQD+LL+  + 
Sbjct:   27 PLLPWDRFSAWLHCVCVVGFDLELGQAVEVIYPPHSKLTDKEKTNICYLSFPDSNSGCLGDTQFCFRFRRSSGRKASLCCFLDHLDRD----LPVYLKKDPAYYYGYVYFRQVRDKSLKRGYFQKSLVLISKLPYIHLFRTVLKQIAPEYFEKSEAFLEAVCSDVDRWPPPVPGEVLHLPIMGVVMKLRIPTYRDKPGTTP---------VVQNMHQADAQISMT-------LPTVHEVDLFRCFCPVFFHIQMLWELVLLGEPLVVMAPSPAESSETVLALVSCISPLKYCSDFRPYFTIHDSEFKEYTTRTQAPPSVILGVTNPFFAKTLQHWPHIIRIGDMKLPGDVPKQVKVKKLKNLKTLDSKPGVYTSYKPYLDKDEEIVKQLQKGVQQKRPTEAQSAILRRYFLELTESFIIPLERYVASLMPLQKCISPWKSPPQLRHFSQDDFMKTLEKAGPQLTSGLKGDWIGLYRHFLKSPNFDGWFRSRQKEMTQNLEALHLEALCNENLVFWSQKHTEVETVDLVLKLKNKLLQADREHLPVKTDTLKKLQTHIRDIILALPDDLQDILLKTGTA 584          
BLAST of UDENN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8NEG7|DEN6B_HUMAN (Protein DENND6B OS=Homo sapiens OX=9606 GN=DENND6B PE=2 SV=1)

HSP 1 Score: 476.093 bits (1224), Expect = 5.381e-160
Identity = 260/572 (45.45%), Postives = 371/572 (64.86%), Query Frame = 1
Query:  139 PVLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR-C---RNPVVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLES--LKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQP 1836
            P  P+   + W+ CVCVVTFDLELGQA+E +YP   +L D EKS++ YLSFPDS+SGC+GDT++ FR R C   R+P   +D   +   P  L+  P   +GYV FRQVKD S++RGYFQKS+V++S LPF+ LF  +  L+A  YFD     LE VC  ID+W  P  GQ +NLP+ GVV+Q +IP + D     P  +               DQ+ ++   +  ++ SVH  D F  F  V++ +Q LWEL+L  + +LV++ SP  +S +V +L S + PL+F  +FRP+FTIHD+EFKEFTT TQ PP V+LG+TNPFF+K L HWP+IL+V + K+     K  KLK P  L K  + KPGLY+ Y   L  DK+L+K L KGV+ +RP  +QS ++R+  LELTQSFI PLE Y+ASLMPL+K I  ++ PP ++ F+ DDFL++LE  GP LT  +KGDW+GLYR F+ SP+F  W  QR +E+ ++L  +H E +C  ++  W++D++EVE+VD +++++ KL   + +++P+     Q     I+T++ SL  DLQ +L  P
Sbjct:   31 PAAPWARFSAWLECVCVVTFDLELGQALELVYPNDFRLTDKEKSSICYLSFPDSHSGCLGDTQFSFRMRQCGGQRSPWHADDRHYNSRAPVALQREPAHYFGYVYFRQVKDSSVKRGYFQKSLVLVSRLPFVRLFQALLSLIAPEYFDKLAPCLEAVCSEIDQWPAPAPGQTLNLPVMGVVVQVRIPSRVDKSESSPPKQF--------------DQENLL--PAPVVLASVHELDLFRCFRPVLTHMQTLWELMLLGEPLLVLAPSPDVSSEMVLALTSCLQPLRFCCDFRPYFTIHDSEFKEFTTRTQAPPNVVLGVTNPFFIKTLQHWPHILRVGEPKMSGDLPKQVKLKKPSRL-KTLDTKPGLYTAYTAHLHRDKALLKRLLKGVQKKRPSDVQSALLRRHLLELTQSFIIPLEHYMASLMPLQKSITPWKTPPQIQPFSQDDFLRSLEHAGPQLTCILKGDWLGLYRRFFKSPHFDGWYRQRHKEMALKLEALHLEAICEANIETWMKDKSEVEVVDLVLKLREKLVRAQGHQLPVKEATLQRAQLYIETVIGSLPKDLQAVLCPP 585          
BLAST of UDENN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BH65|DEN6A_MOUSE (Protein DENND6A OS=Mus musculus OX=10090 GN=Dennd6a PE=1 SV=1)

HSP 1 Score: 461.84 bits (1187), Expect = 3.499e-154
Identity = 263/576 (45.66%), Postives = 379/576 (65.80%), Query Frame = 1
Query:  121 KKDDIKPVLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR---CRNPVVHND-NKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTK-LESLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQ 1833
            + D  + +L +D  + W++CVCVV FDLELGQA+E IYP+H KL D EK+N+ YLSFPDSNSGC+GDT++ FRFR    R   +H   ++  +  P  LK  P + YGYV FRQV+DK+++RGYFQKS+V++S LP+I+ F+ V + +A  YF+  E  LE  C+++D+W  P+ G+ ++LP+ G+V++ +IP      TC      H      Q ++  +      D  +  I+P+VH  D F  F  V    Q+LWELVL  + ++V++ SP  +S  V +LV+ ISPL++  +FRP+FTIHD+EFKE+TT TQ PP VILG+TNPFF K L HWP+I+++ D K    +  +         K  + KPG+Y++YKP+L  D+ +IK LQKG++ +RP   QS I+R++FLELTQSFI PLERYVASLMPL+K I  +++PP L++F  ++F+KTLE  GP LTSGIKGDWIGLYR F  SPNF  W   R++E+  +L  +H E +C  D+  WIQ   EVE VD ++++K+KL       +P+  +  + L  +I  I+ +L  DLQ +LL+
Sbjct:   42 EDDGRRGLLRWDGFSAWLHCVCVVGFDLELGQAVEVIYPQHSKLTDKEKTNICYLSFPDSNSGCLGDTQFCFRFRQSSGRRVSLHCLLDEFDKDLPVYLKKDPAYFYGYVYFRQVRDKTLKRGYFQKSLVLISKLPYIHFFHTVLKQIAPEYFEKNEPYLEAACNDVDRWPAPVPGKTLHLPIMGLVMKVRIP------TC------HDKPGTTQMVQLTQ----QADTHTSIILPTVHEVDLFRCFCPVFLHSQMLWELVLLGEPLVVMAPSPSESSETVLALVNCISPLKYFSDFRPYFTIHDSEFKEYTTRTQAPPSVILGVTNPFFAKTLQHWPHIIRIGDLKPAGEIPKQVKVKKLKNLKTLDSKPGVYTSYKPYLNRDEEIIKQLQKGIQQKRPSEAQSVILRRYFLELTQSFIIPLERYVASLMPLQKSISPWKSPPQLRQFLPEEFMKTLEKTGPQLTSGIKGDWIGLYRQFLKSPNFDGWFKTRRKEMTQKLEALHLEALCEEDLLLWIQKHTEVETVDLVLKLKNKLLQAGRESLPVKPDTVEKLRTHIDAIILALPDDLQGILLK 601          
BLAST of UDENN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9D9V7|DEN6B_MOUSE (Protein DENND6B OS=Mus musculus OX=10090 GN=Dennd6b PE=2 SV=3)

HSP 1 Score: 458.759 bits (1179), Expect = 2.760e-153
Identity = 252/570 (44.21%), Postives = 369/570 (64.74%), Query Frame = 1
Query:  145 LPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR-C---RNPVVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLES--LKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQP 1836
            +P+   + W+ CVCVVTFDLELGQA+E +YP   +L D EKS++ YL+FPDS+SGC+GDT++ FR R C   R+    +D   +   P  L+  P    GYV FRQVKD S++RGYFQKS+V++S LPF+ LF  +  L+A  YF+     LE VC+ ID+W  P+ GQ +NLP+ GVV+Q +IP + D +   P  +               DQ+ ++   +  ++ SVH  D F  F  V++ +Q LWEL+L  + ++V++ SP  +S +V +L S + PL+F  +FRP+FTIHD+EFKE TT TQ PP V+LG+TNPFF+K L HWP++L++ + K+     K  KLK P  L K  + KPGLY++Y   L  DK+L+K L KGV+ +RP  +QS ++R+  LELTQSFI PLE Y+ASLMPL+K I  +++PP +  F  DDFL++LE  GP LT  +KGDW+GLYR F+ SP+F  W  QR +E+  +L  +H E +C  ++  W++D++EVE+VD +++++ KL   + +++P+     Q     I T++ SL  DLQ +L  P
Sbjct:   33 MPWARFSAWLECVCVVTFDLELGQALELVYPSDFRLTDKEKSSICYLAFPDSHSGCLGDTQFSFRMRQCGGQRSLWQVDDRSYNNKAPLALQREPAHYLGYVYFRQVKDSSVKRGYFQKSLVLVSRLPFVRLFQSLLSLIAPEYFEKLAPCLEAVCNEIDQWPAPVPGQTLNLPIMGVVIQVRIPSRVDKLESSPPKQC--------------DQENLL--PAPVVLTSVHELDLFRCFRPVLTHVQTLWELMLLGEPLVVLAPSPDVSSELVLALTSCLQPLKFCCDFRPYFTIHDSEFKELTTRTQAPPNVVLGVTNPFFIKTLQHWPHVLRIGEPKMSGDLPKQVKLKKPSRL-KTLDTKPGLYTSYTAHLHRDKALLKRLLKGVQKKRPWDVQSALLRRHLLELTQSFIIPLEHYMASLMPLQKNITPWKSPPQICPFRQDDFLRSLEHAGPQLTCILKGDWLGLYRRFFKSPHFDGWYRQRHKEMAQKLEALHLEAICEANIEAWMKDKSEVEVVDLVLKLREKLVRAQGHQLPVKEVTLQRAQLYIDTVIGSLPKDLQAVLCPP 585          
BLAST of UDENN domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8IWF6|DEN6A_HUMAN (Protein DENND6A OS=Homo sapiens OX=9606 GN=DENND6A PE=1 SV=1)

HSP 1 Score: 459.144 bits (1180), Expect = 4.713e-153
Identity = 263/569 (46.22%), Postives = 376/569 (66.08%), Query Frame = 1
Query:  142 VLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR---CRNPVVHND-NKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTK-LESLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQ 1833
            +L +D+ + W++CVCVV FDLELGQA+E IYP+H KL D EK+N+ YLSFPDSNSGC+GDT++ FRFR    R   +H   ++  +  P  LK  P + YGYV FRQV+DK+++RGYFQKS+V++S LP+I+ F+ V + +A  YF+  E  LE  C+++D+W  P+ G+ ++LP+ GVV++ +IP      TC      H      Q ++  +     +D     I+P+VH  D F  F  V    Q+LWELVL  + ++V++ SP  +S  V +LV+ ISPL++  +FRP+FTIHD+EFKE+TT TQ PP VILG+TNPFF K L HWP+I+++ D K    +  +         K  + KPG+Y++YKP+L  D+ +IK LQKGV+ +RP   QS I+R++FLELTQSFI PLERYVASLMPL+K I  +++PP L++F  ++F+KTLE  GP LTS IKGDWIGLYR F  SPNF  W   R++E+  +L  +H E +C  D+  WIQ   EVE VD ++++K+KL       +P+  +  + L  +I  I+ +L  DLQ +LL+
Sbjct:   52 LLRWDSFSAWLHCVCVVGFDLELGQAVEVIYPQHSKLTDREKTNICYLSFPDSNSGCLGDTQFCFRFRQSSGRRVSLHCLLDQFDKDLPVYLKKDPAYFYGYVYFRQVRDKTLKRGYFQKSLVLISKLPYIHFFHTVLKQIAPEYFEKNEPYLEAACNDVDRWPAPVPGKTLHLPIMGVVMKVRIP------TC------HDKPGTTQIVQLTQ----QVDTNISVILPTVHEVDIFRCFCPVFLHSQMLWELVLLGEPLVVMAPSPSESSETVLALVNCISPLKYFSDFRPYFTIHDSEFKEYTTRTQAPPSVILGVTNPFFAKTLQHWPHIIRIGDLKPTGEIPKQVKVKKLKNLKTLDSKPGVYTSYKPYLNRDEEIIKQLQKGVQQKRPSEAQSVILRRYFLELTQSFIIPLERYVASLMPLQKSISPWKSPPQLRQFLPEEFMKTLEKTGPQLTSRIKGDWIGLYRHFLKSPNFDGWFKTRRKEMTQKLEALHLEALCEEDLLLWIQKHTEVETVDLVLKLKNKLLQADREHLPVKPDTMEKLRTHIDAIILALPEDLQGILLK 604          
BLAST of UDENN domain-containing protein vs. TrEMBL
Match: A0A1S3J2X2 (protein DENND6A isoform X1 OS=Lingula unguis OX=7574 GN=LOC106169720 PE=4 SV=1)

HSP 1 Score: 521.546 bits (1342), Expect = 2.662e-175
Identity = 278/574 (48.43%), Postives = 394/574 (68.64%), Query Frame = 1
Query:  142 VLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR-C---RNPVVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLESLKNRKLKSPRYLFKQE--------EIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDML 1827
            VLP+D  ++W++C CVVTFDLELGQAME +YP H+KL + EK N+ YLSFPDSNSGCMGDT++HFR R C   +N ++ +D+   E  P  L+    + YGYV FRQ KDKSIRRGYFQKS+V++S LPFI L   + E++A  YFD+GE  LE  CH+ID+W  P  G+ +NLPL G V+Q +IP ++D V     G V      +  I  N             ++ S+H  D F+AF  V+  LQL+WELVLT + ++V+++SP   +  VQ+LVS I PL++  ++RP+FTIHD+EFKE+TT+TQ PP VILG+TNPFF K L HWPNI+++ +T  ++       SPR + K +        + KPG+Y+ YKP+L  DK+++K L KG++++RP  +QS ++R+F LELTQSF+ PLERY+ASLMPL++ I   + PP LK FN ++FLKTL+  GP LTSG+KGDWIGLYR F+  PNF  W   RQ+E+N +L  +H E +C+ D+ +W++D+ EVEIVD ++++K K+   + N IP+S++  + L  ++ +I+SSL  DLQ +L
Sbjct:   27 VLPWDRFSNWLHCACVVTFDLELGQAMELVYPGHVKLTEREKINICYLSFPDSNSGCMGDTKFHFRIRQCPGRKNHILAHDDFNREC-PASLQIDNAYYYGYVYFRQTKDKSIRRGYFQKSLVLVSKLPFIPLLEHMVEIMAPEYFDNGEPSLEAACHDIDQWPEPTPGETLNLPLMGSVVQVRIPSRSDKVI----GAVQTKTHTVPQIPVNH------------VLQSIHETDLFSAFQPVLQHLQLMWELVLTGEPVVVMASSPTLCANAVQALVSIIWPLKYCSDYRPYFTIHDSEFKEYTTKTQAPPAVILGVTNPFFAKTLQHWPNIVRIGETSGDA-------SPRAVLKLKKSSSLKTLDSKPGVYTRYKPYLSKDKTILKRLSKGIQLKRPVEVQSAMLRRFLLELTQSFMIPLERYMASLMPLQRNISPHKGPPVLKPFNVEEFLKTLDHSGPQLTSGLKGDWIGLYRKFFKCPNFDGWYHFRQKEVNQKLQALHLEALCKEDLVNWVRDKQEVEIVDLVLRLKDKMISAQNNDIPVSMDIVKKLKCHLHSIISSLPEDLQSVL 576          
BLAST of UDENN domain-containing protein vs. TrEMBL
Match: A0A1S3J3D7 (protein DENND6A isoform X2 OS=Lingula unguis OX=7574 GN=LOC106169720 PE=4 SV=1)

HSP 1 Score: 513.842 bits (1322), Expect = 1.053e-172
Identity = 272/566 (48.06%), Postives = 384/566 (67.84%), Query Frame = 1
Query:  142 VLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR-C---RNPVVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLESLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDML 1827
            VLP+D  ++W++C CVVTFDLELGQAME +YP H+KL + EK N+ YLSFPDSNSGCMGDT++HFR R C   +N ++ +D+   E  P  L+    + YGYV FRQ KDKSIRRGYFQKS+V++S LPFI L   + E++A  YFD+GE  LE  CH+ID+W  P  G+ +NLPL G V+Q +IP ++D V     G V      +  I  N             ++ S+H  D F+AF  V+  LQL+WELVLT + ++V+++SP   +  VQ+LVS I PL++  ++RP+FTIHD+EFKE+TT+TQ PP VILG+TNPFF K L HWPNI+++ +T  +                     G+Y+ YKP+L  DK+++K L KG++++RP  +QS ++R+F LELTQSF+ PLERY+ASLMPL++ I   + PP LK FN ++FLKTL+  GP LTSG+KGDWIGLYR F+  PNF  W   RQ+E+N +L  +H E +C+ D+ +W++D+ EVEIVD ++++K K+   + N IP+S++  + L  ++ +I+SSL  DLQ +L
Sbjct:   27 VLPWDRFSNWLHCACVVTFDLELGQAMELVYPGHVKLTEREKINICYLSFPDSNSGCMGDTKFHFRIRQCPGRKNHILAHDDFNREC-PASLQIDNAYYYGYVYFRQTKDKSIRRGYFQKSLVLVSKLPFIPLLEHMVEIMAPEYFDNGEPSLEAACHDIDQWPEPTPGETLNLPLMGSVVQVRIPSRSDKVI----GAVQTKTHTVPQIPVNH------------VLQSIHETDLFSAFQPVLQHLQLMWELVLTGEPVVVMASSPTLCANAVQALVSIIWPLKYCSDYRPYFTIHDSEFKEYTTKTQAPPAVILGVTNPFFAKTLQHWPNIVRIGETSGD---------------------GVYTRYKPYLSKDKTILKRLSKGIQLKRPVEVQSAMLRRFLLELTQSFMIPLERYMASLMPLQRNISPHKGPPVLKPFNVEEFLKTLDHSGPQLTSGLKGDWIGLYRKFFKCPNFDGWYHFRQKEVNQKLQALHLEALCKEDLVNWVRDKQEVEIVDLVLRLKDKMISAQNNDIPVSMDIVKKLKCHLHSIISSLPEDLQSVL 554          
BLAST of UDENN domain-containing protein vs. TrEMBL
Match: K1QS76 (UDENN domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10016707 PE=4 SV=1)

HSP 1 Score: 508.834 bits (1309), Expect = 1.946e-170
Identity = 274/579 (47.32%), Postives = 390/579 (67.36%), Query Frame = 1
Query:  103 RMSILSKKDDIKP-VLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFRCRNPVVHNDNKTS--EFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLESLKN-RKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDML 1827
            R+S+  ++    P VLP+D  ++WI+C CVVTFDLELGQAME IYP H+KL D EK+N+ YLSFPDSNSGCMGDT++HFR R ++P   +  K++  + YP  L+    + YG+V FRQ KDKSI+RGYFQKSVV++S LPFI LF ++  ++A  YFD+GE  LE  CH+ID+W  P+ G  ++LP+ G VLQ +IP ++D +      K   S  +                 +  I+PS++  D F++F  ++  +Q+LWELVLT + ++V++ SP  TS  VQ+L+S I P ++  ++RP+FTIHD+EFKE+TT+TQ PP VILG+TNPFF K L HWP+I+++ +   +  K   KLK    + K  + KPG+Y+ YK FL  DK ++K + KG++ +RP   Q+ I+R++FLELTQSF+ PLERY+ SLMPL++ I   + PP L+ F+ D+FL TLE  GP LTSGIKGDW GLYR F+ SPNF  W   RQ E+N +L  +H E +C  D++ WIQD+ EVE+VD I++I+ KL +   N I ++ E    L +++  I++SL  DLQ +L
Sbjct:   12 RVSVPQEETPTSPTVLPWDRFSNWIHCACVVTFDLELGQAMELIYPGHVKLTDVEKTNICYLSFPDSNSGCMGDTQFHFRIR-QSPGRRHFPKSAIQKDYPHQLQADNGYLYGFVYFRQTKDKSIKRGYFQKSVVLVSRLPFIALFNQLVSIIAPEYFDNGEPSLEAACHDIDQWQCPLGGDTVSLPIFGTVLQVRIPSRSDKLLDRVPIKTTPSPVL----------------PAPSILPSLYEIDIFSSFQTILPHIQMLWELVLTGEPLVVMAASPSVTSAAVQALISLIGPQKYCSDYRPYFTIHDSEFKEYTTKTQAPPSVILGVTNPFFAKTLQHWPHIIRIGEMMTQVPKGFNKLKKVSSM-KTLDAKPGVYTRYKQFLAKDKGILKRIIKGMQAKRPVEAQNAILRRYFLELTQSFMIPLERYMGSLMPLQRNISPHKCPPSLRPFDTDEFLSTLERSGPQLTSGIKGDWEGLYRRFFRSPNFEGWYQHRQSEVNQKLQVLHLEALCNADLADWIQDKEEVEVVDLILRIREKLAFAVNNDIAINEESVHKLKKHLDVIVTSLPDDLQSVL 572          
BLAST of UDENN domain-containing protein vs. TrEMBL
Match: A0A210QAF4 (Protein DENND6B OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11603 PE=4 SV=1)

HSP 1 Score: 506.138 bits (1302), Expect = 2.233e-169
Identity = 269/569 (47.28%), Postives = 387/569 (68.01%), Query Frame = 1
Query:  142 VLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR---CRNPVVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASI---CIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLESLKN-RKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDML 1827
            +LP+D  ++W++C CVVTFDLELGQAME IYP H+KL D+EK+N+ YLSFPDSNSGCMGDT++HFR R    R       ++ ++ YP  ++    + YG+V FRQ KD+SIRRGYFQKS+V++S LPF+ LF ++  ++A  YF++GE  LE  CH++D+W  P+ G+ +NLP+ G VLQ+++P ++D V                       Q + +   ++    I+PS++  D ++AF  ++  +Q+LWELVL  + ++V++ SP  TS  VQ+L+S I PL+F  ++RP+FTIHD+EFKE+TT+TQ PP VILG+TNPFF K L HWPNI+++ +    S K   KLK    L K  + KPG+Y+ YK FL  DK ++K L KG++ +RP   Q+ I+R+ FLELT SF+ PLERY+ASLMPL++ I   + PP L+ F+ ++FL++LE  GP LTSG+KGDW GLYR F+ S NF  W   RQ E+N +L  +H E +C +D+  WIQD+ EVEIVD I++I+ KL +  +N+I +S E  Q LN+++  I+SSL  DLQ +L
Sbjct:   25 LLPWDRFSNWLHCACVVTFDLELGQAMELIYPGHVKLTDTEKANICYLSFPDSNSGCMGDTQFHFRIRQSPGRKTTSKCQHQFNKDYPVSIQSDGAYYYGFVFFRQTKDRSIRRGYFQKSLVLISKLPFVALFQQLVSIIAPEYFENGEPSLEAACHDMDQWPDPVPGETVNLPIFGSVLQSRVPSRSDKVL-------------------GRGQNIRVGAPTVPAHSILPSLYEVDIYSAFLPILPHIQMLWELVLAGEPLVVMAPSPSITSSTVQALISLIGPLKFYGDYRPYFTIHDSEFKEYTTKTQAPPPVILGVTNPFFAKTLQHWPNIIRIGEMTHGSSKIFNKLKKASSL-KTLDSKPGVYTRYKAFLTKDKIILKRLIKGIQSKRPPEAQNAILRRHFLELTHSFMIPLERYMASLMPLQRNISPHKGPPRLRPFDPEEFLRSLEHSGPQLTSGVKGDWEGLYRKFFKSQNFEGWYYHRQYEVNQKLQVLHMEALCDSDLVAWIQDKEEVEIVDLILRIREKLAFAASNQIAVSDESLQKLNKHMDNIISSLPEDLQTVL 573          
BLAST of UDENN domain-containing protein vs. TrEMBL
Match: W4YH44 (UDENN domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 505.753 bits (1301), Expect = 5.349e-169
Identity = 265/576 (46.01%), Postives = 384/576 (66.67%), Query Frame = 1
Query:  124 KDDIKPVLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR-C---RNPVVHNDNKTSEFYPDCLKP---SPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLESLKNRKLKSPR-YLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDML 1827
            +D  + +LP+D  + W +C CVVTFDLELGQA+E IYP HIKL + EK N+ YLSFPDSNSGCMGDT++ FR R C   RN +  N  +++E++ +CL          YG+V FRQVKDK+ RRGYFQKS+V++S LPF +LF +++ LVA  YFD+GE  +E  CH+ID+W  P  G+ ++LP+ G VLQ +IP + D  +     + H+              +LM   + + ++PS+   + F     V+  +QLLWELVLT ++++V++  P   +  V +LVS ISPL+F  +FRP+FTIHD+EFKE+TT TQ PP VILG+TNPFF K L HWP+I+++ +       ++ LK  +    K  E KPG+Y+ YKPFL  DK++IK L KG++  RP  +Q  ++R+  LELTQSF+ PLERYVASLMPL++ I  +++PP LK F+ D+F+KTLE  GP LTSG+KGDW+GLY+ F+ S NF  W  QRQ+E+N +L  +H E +C  +++ W +D+ EVE+VD +++++ K+   + NRI +  E  + L  ++  I+ +L  DLQ +L
Sbjct:   29 RDGSRKILPWDGFSEWFHCFCVVTFDLELGQALEFIYPSHIKLTEKEKMNICYLSFPDSNSGCMGDTQFSFRIRRCPDKRNLI--NSKESTEYHKNCLPTLQIDAAHLYGFVYFRQVKDKTSRRGYFQKSLVLVSQLPFTSLFTQLASLVAPEYFDNGEPSIEAACHDIDQWPSPCPGKTLHLPIMGCVLQVRIPSRQDKPSAAAGARGHV--------------ELM--GSPLTVVPSISEPEMFRCLHPVIPHMQLLWELVLTGETLVVMAPGPGMCADTVHALVSMISPLRFMSDFRPYFTIHDSEFKEYTTRTQAPPSVILGVTNPFFAKTLQHWPHIVRIGEPSYGDKNSKALKPKKPGSIKTLESKPGVYTQYKPFLNKDKNIIKRLSKGIQTRRPTEVQDAMLRRHLLELTQSFMIPLERYVASLMPLQRNISPWKHPPRLKPFDADEFIKTLEHSGPQLTSGLKGDWVGLYKKFFRSKNFEGWFQQRQEEVNCKLSALHLEALCEANIAEWAKDKQEVEVVDLLLKLREKMESVRNNRILVKPELIKQLGMHMDAIIMNLPEDLQSVL 586          
BLAST of UDENN domain-containing protein vs. Ensembl Cavefish
Match: dennd6aa (DENN domain containing 6A [Source:NCBI gene;Acc:103036980])

HSP 1 Score: 473.396 bits (1217), Expect = 1.125e-159
Identity = 260/574 (45.30%), Postives = 380/574 (66.20%), Query Frame = 1
Query:  142 VLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR----CRNPVVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTK-----LESLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQP 1836
            +LP+D  + W++C+CVV FDLELGQA+E IYP H KL + EK+++ YLSFPDSNSGC+GDT++ FRFR     ++ +    +      P CLK      YGYV FRQV+DK+++RGYFQKS+V++S LP++  F+ + +L+A  YF+  E  LE  C++ID+W  P  G+++ LP+ GVV++ +IP  +D    +P      +  ++Q            D+    ++P++H  D F  F  V   +Q+LWELVL  ++++V++ SP  +S  V +LVS I+PL++  +FRP+FTIHD+EFKE+TT TQ PP VILG+TNPFF K L HWP+I+++ D K      + +K +KLK+ + L    + KPG+YS YKPFL  D+ ++K LQKGV+ +RP S Q+ I+R++FLELTQSFI PLERYVASLMPL+K I  +++PP LK F  ++F+KTLE  GP LTS +KGDWIGLYR F  SPNF  W   R++E+  +L  +H E +C  D+   IQ   EVE VD ++++K KL   +  ++P+ +     L  +I +++ SL  DLQ +L +P
Sbjct:   49 LLPWDRFSAWLHCICVVGFDLELGQAVEVIYPHHSKLTEKEKTSICYLSFPDSNSGCLGDTQFCFRFRQAAGSKSSLGCFLDHFDRDAPVCLKKDQGHFYGYVYFRQVRDKTLKRGYFQKSLVLISKLPYVTFFHSLLKLIAPEYFEKQEPCLEAACNDIDRWPTPCPGKILTLPIMGVVMKLRIPTCSD----KPG-----TSQLVQSTPT--------DSLVSIVLPTIHEVDLFRCFYPVFFHIQMLWELVLLGEALVVMAPSPAESSETVLALVSCIAPLRYCSDFRPYFTIHDSEFKEYTTRTQAPPSVILGVTNPFFAKTLQHWPHIIRIGDMKQTGEMAKQMKVKKLKNLKTL----DSKPGVYSAYKPFLNKDEEILKQLQKGVQQKRPSSAQNAILRRYFLELTQSFIIPLERYVASLMPLQKSICPWKSPPQLKPFVQEEFMKTLEKAGPQLTSRLKGDWIGLYRQFLKSPNFDGWFRNRRKEMTQKLEALHLEALCDEDLQLRIQKHTEVETVDLVLKLKEKLTQAEREQLPVRMGTLAKLQAHIDSVILSLPEDLQCILHKP 601          
BLAST of UDENN domain-containing protein vs. Ensembl Cavefish
Match: dennd6b (DENN domain containing 6B [Source:NCBI gene;Acc:103041249])

HSP 1 Score: 461.84 bits (1187), Expect = 1.734e-155
Identity = 253/570 (44.39%), Postives = 377/570 (66.14%), Query Frame = 1
Query:  136 KPVLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFRCRNPVVHN-----DNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLES-LKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDML 1827
            +P +P+   + W+ CVCVVTFDLELGQA+E +YP  +KL + EK+++ YLSFPDS SGC+GDT++ FR R     V       ++K +   P  L+      YGYV FRQVKD S++RGYFQKS+V++S LP++ LF  + +++A  YF+  E  LE VC+ ID+W PP+ GQ +NLP+ G+V+Q +IP K D    +P G         QG + N    L+    +  ++P++H  D F  F +++  LQ+LWEL+L  + ++V++ SP  +S  V +LVSSISPL++  +FRP+FTIHD+EFKE+TT TQ PP VILG+TNPFF+K    WP+IL++ + K+   L  +         K  + KPG+Y+ YK FL  DK+LIK L KG++ +RP  +QS I+R++ LELTQSFI PLERY+ASLMPL++ +  ++ PP ++ F+ D+F+ TL+  GP LTS +KGDW+GLY+ F+ SPNF  W   R +E+  ++  +H E +C  D+  W +D++EVEIVD +++++ KL   + + +P+  E  + L   I+T++SSL  DLQ +L
Sbjct:   23 EPCVPWARFSDWLECVCVVTFDLELGQAIELVYPHDVKLTEKEKTSICYLSFPDSYSGCLGDTQFSFRLRQSVGRVSGSWFGEEDKYNRDAPLILQKELAHFYGYVYFRQVKDVSVKRGYFQKSLVLVSRLPYVQLFQSLLQIIAPEYFEKLEPCLEAVCNEIDQWPPPVPGQTLNLPVMGIVMQVRIPSKDD----KPGGS-----PTRQGQKEN----LL---PAPTVLPTIHELDLFKCFQSILIHLQMLWELMLLGEPLVVMAPSPTMSSETVLALVSSISPLKYCCDFRPYFTIHDSEFKEYTTRTQAPPNVILGVTNPFFIKTFQCWPHILRLGELKMSGDLPKQVKVKKLAKLKTLDTKPGIYTAYKTFLHKDKALIKRLLKGIQRKRPSEVQSAILRRYLLELTQSFIIPLERYLASLMPLQRSVTPWKTPPQIRPFSQDEFMATLDHAGPQLTSVLKGDWMGLYKRFFRSPNFDGWYRLRHREMTQKVECLHLEAICDADLLSWTKDKSEVEIVDLVLKLREKLMRARKHHLPVKEELHEKLENYIQTVISSLPEDLQTVL 576          
BLAST of UDENN domain-containing protein vs. Ensembl Cavefish
Match: dennd6b (DENN domain containing 6B [Source:NCBI gene;Acc:103041249])

HSP 1 Score: 453.366 bits (1165), Expect = 1.724e-152
Identity = 249/569 (43.76%), Postives = 371/569 (65.20%), Query Frame = 1
Query:  136 KPVLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFRCRNPVVHN-----DNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLESLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDML 1827
            +P +P+   + W+ CVCVVTFDLELGQA+E +YP  +KL + EK+++ YLSFPDS SGC+GDT++ FR R     V       ++K +   P  L+      YGYV FRQVKD S++RGYFQKS+V++S LP++ LF  + +++A  YF+  E  LE VC+ ID+W PP+ GQ +NLP+ G+V+Q +IP K D    +P G         QG + N    L+    +  ++P++H  D F  F +++  LQ+LWEL+L  + ++V++ SP  +S  V +LVSSISPL++  +FRP+FTIHD+EFKE+TT TQ PP VILG+TNPFF+K    WP+IL++ + K+                      G+Y+ YK FL  DK+LIK L KG++ +RP  +QS I+R++ LELTQSFI PLERY+ASLMPL++ +  ++ PP ++ F+ D+F+ TL+  GP LTS +KGDW+GLY+ F+ SPNF  W   R +E+  ++  +H E +C  D+  W +D++EVEIVD +++++ KL   + + +P+  E  + L   I+T++SSL  DLQ +L
Sbjct:   23 EPCVPWARFSDWLECVCVVTFDLELGQAIELVYPHDVKLTEKEKTSICYLSFPDSYSGCLGDTQFSFRLRQSVGRVSGSWFGEEDKYNRDAPLILQKELAHFYGYVYFRQVKDVSVKRGYFQKSLVLVSRLPYVQLFQSLLQIIAPEYFEKLEPCLEAVCNEIDQWPPPVPGQTLNLPVMGIVMQVRIPSKDD----KPGGS-----PTRQGQKEN----LL---PAPTVLPTIHELDLFKCFQSILIHLQMLWELMLLGEPLVVMAPSPTMSSETVLALVSSISPLKYCCDFRPYFTIHDSEFKEYTTRTQAPPNVILGVTNPFFIKTFQCWPHILRLGELKMS---------------------GIYTAYKTFLHKDKALIKRLLKGIQRKRPSEVQSAILRRYLLELTQSFIIPLERYLASLMPLQRSVTPWKTPPQIRPFSQDEFMATLDHAGPQLTSVLKGDWMGLYKRFFRSPNFDGWYRLRHREMTQKVECLHLEAICDADLLSWTKDKSEVEIVDLVLKLREKLMRARKHHLPVKEELHEKLENYIQTVISSLPEDLQTVL 554          
BLAST of UDENN domain-containing protein vs. Ensembl Cavefish
Match: dennd6aa (DENN domain containing 6A [Source:NCBI gene;Acc:103036980])

HSP 1 Score: 422.55 bits (1085), Expect = 6.166e-140
Identity = 247/574 (43.03%), Postives = 367/574 (63.94%), Query Frame = 1
Query:  142 VLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFR----CRNPVVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTK-----LESLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQP 1836
            +LP+D  + W++C+CVV FDLELGQA+E I    I L    K+++ YLSFPDSNSGC+GDT++ FRFR     ++ +    +      P CLK      YGYV FRQV+DK+++RGYFQKS+V++S LP++  F+ + +L+A  YF+  E  LE  C++ID+W  P  G+++ LP+ GVV++ +IP  +D    +P      +  ++Q            D+    ++P++H  D F  F  V   +Q+LWELVL  ++++V++ SP  +S  V +LVS I+PL++  +FRP+FTIHD+EFKE+TT TQ PP VILG+TNPFF K L HWP+I+++ D K      + +K +KLK+ + L    + KPG+YS YKPFL  D+ ++K LQKGV+ +RP S Q+ I+R++FLELTQSFI PL R+ +S     K +++   PP LK F  ++F+KTLE  GP LTS +KGDWIGLYR F  SPNF  W   R++E+  +L  +H E +C  D+   IQ   EVE VD ++++K KL   +  ++P+ +     L  +I +++ SL  DLQ +L +P
Sbjct:   49 LLPWDRFSAWLHCICVVGFDLELGQAVEVII--FILLC---KTSICYLSFPDSNSGCLGDTQFCFRFRQAAGSKSSLGCFLDHFDRDAPVCLKKDQGHFYGYVYFRQVRDKTLKRGYFQKSLVLISKLPYVTFFHSLLKLIAPEYFEKQEPCLEAACNDIDRWPTPCPGKILTLPIMGVVMKLRIPTCSD----KPG-----TSQLVQSTPT--------DSLVSIVLPTIHEVDLFRCFYPVFFHIQMLWELVLLGEALVVMAPSPAESSETVLALVSCIAPLRYCSDFRPYFTIHDSEFKEYTTRTQAPPSVILGVTNPFFAKTLQHWPHIIRIGDMKQTGEMAKQMKVKKLKNLKTL----DSKPGVYSAYKPFLNKDEEILKQLQKGVQQKRPSSAQNAILRRYFLELTQSFIIPLVRF-SSFTSQMKPVIS---PPQLKPFVQEEFMKTLEKAGPQLTSRLKGDWIGLYRQFLKSPNFDGWFRNRRKEMTQKLEALHLEALCDEDLQLRIQKHTEVETVDLVLKLKEKLTQAEREQLPVRMGTLAKLQAHIDSVILSLPEDLQCILHKP 592          
BLAST of UDENN domain-containing protein vs. Ensembl Nematostella
Match: EDO46962 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNP1])

HSP 1 Score: 486.878 bits (1252), Expect = 9.269e-166
Identity = 263/568 (46.30%), Postives = 370/568 (65.14%), Query Frame = 1
Query:  145 LPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFRCRNPVVHNDNKTSEF----YPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDY--VTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLESLKNRKLKSPRYLFKQE-EIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDML 1827
            LP+D    WI C CVVTFD+E+GQAME +YPK + L++ EK N+ YLSFPDSNSGCMGDT +HFR RC +P     + + E      P   +  P   YG V FRQVKD S++RGYFQKS+V++S LP+INLF +V +++A  +F++GE  LE  CHNID+W  P AG  + LPL G VLQ ++P + D       P+  ++I+              +M    S  +IP++   D F    +V+  + LLWELVLTN+ ++V++ SP   S  VQSL + I+PL +  +FRPFFTIHD+EFKE+TT TQ PP VILG+TNPFF K L HWP+++++ +     + +RK  +     K+    KPG+Y+ YKPFL  DK++++ L KG   +RP  +Q+ I+R+  +ELTQSF+ PLERYVASLMPL++ I  +++PP +K F+ ++FL TLE  GP LTS +KG+WI LYR F+ SPNF  WL  RQQEI  ++  +H E +   DV  W++D+ EVE+VD  +QIK KL  C T   P++ E  Q L++++  I ++L  DLQ +L
Sbjct:   21 LPWDRFKKWITCFCVVTFDIEVGQAMELVYPKFVHLSEKEKMNICYLSFPDSNSGCMGDTTFHFRIRC-SPRSSGKSPSCEMREAEVPLGFRSDPAHLYGSVLFRQVKDPSLQRGYFQKSLVLVSRLPYINLFSEVVKIMAPGFFENGEPSLEAACHNIDQWPSPQAGYTLQLPLMGTVLQVRVPSRKDRPGAVSSPDSPMNIN--------------IMEPIPSPRVIPTLKEPDSFKYLQSVLGHIHLLWELVLTNEPLVVMAPSPTVCSETVQSLTTLIAPLHYCSDFRPFFTIHDSEFKEYTTRTQAPPSVILGVTNPFFAKTLQHWPHVVRIGEMSNLVISSRKTPTAGQSGKRTLSSKPGIYTKYKPFLSRDKTVLRKLSKGNHPKRPPEVQNAILRRHMVELTQSFMIPLERYVASLMPLQRSISPWKHPPRIKPFDAEEFLTTLEHSGPQLTSRLKGNWIQLYRRFFRSPNFEGWLRHRQQEITQKIELLHLETLGNADVLGWVKDKQEVEVVDLYLQIKEKLTSCSTFYPPIAHETRQQLSKHLSAITTTLPSDLQFVL 573          
BLAST of UDENN domain-containing protein vs. Ensembl Medaka
Match: dennd6aa (DENN domain containing 6A [Source:NCBI gene;Acc:101161395])

HSP 1 Score: 455.677 bits (1171), Expect = 1.085e-152
Identity = 259/583 (44.43%), Postives = 375/583 (64.32%), Query Frame = 1
Query:  139 PVLPFDNLNHWIYCVCVVTFDLELGQAMECI-YPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFRCRNPVVHNDNKTSEF---------YPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLES-----LKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQPNS 1842
            P+LP+D  + W++C+CVV FDLELGQA+E    PK   L    KS + YLSFPDSNSGC+GDT++ FRFR       ++ K+S+           P CLK      YGYV FRQV+DKS++RGYFQKS+V++S LP++  F+ + +++A  YF+  E  LE  C+++D+W  P  G+++ LP+ GVV++ +IP   D    +P      +  ++Q  +         D+    ++P++H  D F  F  V   +Q+LWELVL  ++++V++ SP  +S  V +LVS ISPL++  +FRP+FTIHD+EFKE+TT TQ PP VILG+TNPFF K L HWP+I+++ D K        +K +KLK+     K  + KPG+Y+ YKP+L  D+ +IK LQKGV+ +RP + Q+ I+R++FLELTQSFI PLERYVASLMPL+K I  +++PP L+ FN  DF+KTLE  GP LTS +KGDWIGLYR F  SPNF  W   R++E+  +L  +H E +C  D+   IQ   EVE VD ++++K KL   +  ++PL       L  +I+ ++ +L  DLQ +L +P +
Sbjct:   49 PLLPWDRFSAWLHCICVVGFDLELGQAVEVSGVPK--TLWSDMKSYICYLSFPDSNSGCLGDTQFCFRFR-----QGSNRKSSQGCFLETADRDAPPCLKREQGHYYGYVYFRQVRDKSLKRGYFQKSLVLISKLPYVTFFHCLLKIMAPEYFEKQEPCLEAACNDMDRWPAPHPGRILTLPIMGVVIKVRIPTCYD----KPG-----TSQLVQSAQG--------DSLVSIVLPTIHEVDLFRCFHPVFFHIQMLWELVLLGEALVVMAPSPAESSDTVLALVSCISPLRYCSDFRPYFTIHDSEFKEYTTRTQAPPSVILGVTNPFFAKTLQHWPHIIRIGDMKQTGERPAQMKVKKLKN----LKTLDSKPGVYTAYKPYLSKDEEIIKQLQKGVQQKRPSAAQNAILRRYFLELTQSFIIPLERYVASLMPLQKSICPWKSPPQLRPFNQQDFMKTLEKAGPQLTSRLKGDWIGLYRCFLKSPNFDGWFRSRRKEMTQKLEALHLEALCEEDLQQRIQKHTEVEAVDLVLKLKDKLTQAEREQLPLQPGTLTKLRSHIEALIRTLPEDLQGILHKPPT 603          
BLAST of UDENN domain-containing protein vs. Ensembl Medaka
Match: dennd6b (DENN domain containing 6B [Source:NCBI gene;Acc:101171967])

HSP 1 Score: 393.66 bits (1010), Expect = 5.760e-129
Identity = 223/562 (39.68%), Postives = 328/562 (58.36%), Query Frame = 1
Query:  157 NLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFRCRNPVVHNDNKTSEFY----PDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLES-LKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDML 1827
              + W+ C CVVTFDLELGQA+E ++P   +L + EK+++ YLSFPDS SGC GDT++ FRFR    V    +   + Y    P  L+      +GY  FRQVKD S++RGYFQKS+V++S LP+  LF+ + +++A  +F+  +  LE VC+ ID+W  P  G  +NLP+ G++ Q +IP K D +   P             +     + L+       ++PSVH  D F                          S SP+                +F  +FRP+FTIHD+EFKE+TT TQ PP V+LG+TNPFF+K    WP+I+++ D K+++ L  +         K  + KPG+Y+ YK FL  DK LIK L KG++  RP   QS I+R+  LELTQSFI PLERY+ASLMPL++ +  ++ PP ++ F  +DFL TLE  GP LTS ++GDW+GLYR F+ SPNF  W  QR +E+  +L  +H E++C  D+  W +D++EVEIVD I++++ KL   +  ++P+     Q L+  I+T++ SL  +L ++ 
Sbjct:   70 RFSRWLECACVVTFDLELGQALELLHPPDARLTEKEKTSICYLSFPDSYSGCHGDTQFTFRFR--QSVGRRGSSAIDAYNRDAPASLQLEAAHFFGYAYFRQVKDTSVKRGYFQKSLVLVSRLPYSILFHSILQILAPEFFEKLQPCLETVCNEIDQWPAPTPGVTLNLPVMGMIFQVRIPAKADKLGGSP-------------LRQTAAENLI---PVPTLLPSVHELDFFR-------------------------SISPL----------------KFCCDFRPYFTIHDSEFKEYTTRTQAPPNVVLGVTNPFFIKTFQSWPHIVRLGDVKMDADLPKQVKVKKSSKLKTLDTKPGIYTAYKTFLHKDKILIKRLLKGIQRRRPSEAQSAILRRHLLELTQSFIIPLERYMASLMPLQRSVTPWKTPPQIRPFVQEDFLSTLEHAGPQLTSPLRGDWVGLYRKFFRSPNFDGWYRQRHKEMMQKLESLHLEVICDADLLGWTRDKSEVEIVDLILKLREKLIKARRQQLPVQDGVLQNLDTFIRTLIGSLRDNLHEVF 572          
BLAST of UDENN domain-containing protein vs. Planmine SMEST
Match: SMESG000064223.1 (SMESG000064223.1)

HSP 1 Score: 1132.47 bits (2928), Expect = 0.000e+0
Identity = 584/584 (100.00%), Postives = 584/584 (100.00%), Query Frame = 1
Query:  106 MSILSKKDDIKPVLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFRCRNPVVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLESLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQPNSGNGSL 1857
            MSILSKKDDIKPVLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFRCRNPVVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTSLVVQSLVSSISPLQFAQEFRPFFTIHDTEFKEFTTETQTPPQVILGITNPFFVKALAHWPNILKVTDTKLESLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQPNSGNGSL
Sbjct:    1 MSILSKKDDIKPVLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFRCRNPVVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTSLVVQSLVSSISPLQFAQEFRPFFTIHDTEFKEFTTETQTPPQVILGITNPFFVKALAHWPNILKVTDTKLESLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQPNSGNGSL 584          
BLAST of UDENN domain-containing protein vs. Planmine SMEST
Match: SMESG000064223.1 (SMESG000064223.1)

HSP 1 Score: 1096.65 bits (2835), Expect = 0.000e+0
Identity = 571/584 (97.77%), Postives = 571/584 (97.77%), Query Frame = 1
Query:  106 MSILSKKDDIKPVLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFRCRNPVVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTXXXXXXXXXXXXXXQFAQEFRPFFTIHDXXXXXXXXXXXXXXXVILGITNPFFVKALAHWPNILKVTDTKLESLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQPNSGNGSL 1857
            MSILSKKDDIKPVLPFDNLNHWIYCVCVVTFDLELGQAME             KSNVNYLSFPDSNSGCMGDTRYHFRFRCRNPVVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTSLVVQSLVSSISPLQFAQEFRPFFTIHDTEFKEFTTETQTPPQVILGITNPFFVKALAHWPNILKVTDTKLESLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQPNSGNGSL
Sbjct:    1 MSILSKKDDIKPVLPFDNLNHWIYCVCVVTFDLELGQAME-------------KSNVNYLSFPDSNSGCMGDTRYHFRFRCRNPVVHNDNKTSEFYPDCLKPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVALAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYVTCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGAVVSQLQLLWELVLTNQSILVVSNSPIFTSLVVQSLVSSISPLQFAQEFRPFFTIHDTEFKEFTTETQTPPQVILGITNPFFVKALAHWPNILKVTDTKLESLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERPESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFNFDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQLLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIEQEQALNENIKTIMSSLAPDLQDMLLQPNSGNGSL 571          
BLAST of UDENN domain-containing protein vs. Planmine SMEST
Match: SMESG000046940.1 (SMESG000046940.1)

HSP 1 Score: 223.402 bits (568), Expect = 8.057e-70
Identity = 104/105 (99.05%), Postives = 105/105 (100.00%), Query Frame = 1
Query:  106 MSILSKKDDIKPVLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCMGDTRYHFRFRCRNPVVHNDNKTSEFYPDCLKPSPD 420
            MSILSKKDDIKPVLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGC+GDTRYHFRFRCRNPVVHNDNKTSEFYPDCLKPSPD
Sbjct:    1 MSILSKKDDIKPVLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLADSEKSNVNYLSFPDSNSGCLGDTRYHFRFRCRNPVVHNDNKTSEFYPDCLKPSPD 105          
The following BLAST results are available for this feature:
BLAST of UDENN domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DENND6B1.120e-16045.45DENN domain containing 6B [Source:HGNC Symbol;Acc:... [more]
DENND6A9.814e-15446.22DENN domain containing 6A [Source:HGNC Symbol;Acc:... [more]
DENND6B8.345e-4434.14DENN domain containing 6B [Source:HGNC Symbol;Acc:... [more]
DENND6A4.612e-3658.88DENN domain containing 6A [Source:HGNC Symbol;Acc:... [more]
DENND6A1.060e-2139.44DENN domain containing 6A [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of UDENN domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
F53H1.34.711e-12741.65pep chromosome:WBcel235:IV:1329162:1339376:1 gene:... [more]
F53H1.32.098e-2238.93pep chromosome:WBcel235:IV:1338304:1339256:1 gene:... [more]
back to top
BLAST of UDENN domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG33092.212e-11637.44gene:FBgn0029756 transcript:FBtr0344827[more]
CG33092.612e-11637.54gene:FBgn0029756 transcript:FBtr0070798[more]
back to top
BLAST of UDENN domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dennd6aa1.058e-16146.45DENN/MADD domain containing 6Aa [Source:ZFIN;Acc:Z... [more]
dennd6b1.710e-14942.56DENN/MADD domain containing 6B [Source:ZFIN;Acc:ZD... [more]
dennd6aa5.140e-8445.24DENN/MADD domain containing 6Aa [Source:ZFIN;Acc:Z... [more]
dennd6aa2.280e-6541.95DENN/MADD domain containing 6Aa [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of UDENN domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bmper9.454e-13041.40BMP binding endothelial regulator [Source:Xenbase;... [more]
bmper1.775e-11945.11BMP binding endothelial regulator [Source:Xenbase;... [more]
bmper1.596e-11237.79BMP binding endothelial regulator [Source:Xenbase;... [more]
bmper6.127e-11238.83BMP binding endothelial regulator [Source:Xenbase;... [more]
bcl11b1.977e-10837.96BCL11B, BAF complex component [Source:Xenbase;Acc:... [more]
back to top
BLAST of UDENN domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dennd6a5.002e-15545.66DENN/MADD domain containing 6A [Source:MGI Symbol;... [more]
Dennd6a5.002e-15545.66DENN/MADD domain containing 6A [Source:MGI Symbol;... [more]
Dennd6b3.946e-15444.21DENN/MADD domain containing 6B [Source:MGI Symbol;... [more]
Dennd6a4.346e-14447.44DENN/MADD domain containing 6A [Source:MGI Symbol;... [more]
Dennd6a4.346e-14447.44DENN/MADD domain containing 6A [Source:MGI Symbol;... [more]
back to top
BLAST of UDENN domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5F3L4|DEN6A_CHICK5.594e-16246.71Protein DENND6A OS=Gallus gallus OX=9031 GN=DENND6... [more]
sp|Q8NEG7|DEN6B_HUMAN5.381e-16045.45Protein DENND6B OS=Homo sapiens OX=9606 GN=DENND6B... [more]
sp|Q8BH65|DEN6A_MOUSE3.499e-15445.66Protein DENND6A OS=Mus musculus OX=10090 GN=Dennd6... [more]
sp|Q9D9V7|DEN6B_MOUSE2.760e-15344.21Protein DENND6B OS=Mus musculus OX=10090 GN=Dennd6... [more]
sp|Q8IWF6|DEN6A_HUMAN4.713e-15346.22Protein DENND6A OS=Homo sapiens OX=9606 GN=DENND6A... [more]
back to top
BLAST of UDENN domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3J2X22.662e-17548.43protein DENND6A isoform X1 OS=Lingula unguis OX=75... [more]
A0A1S3J3D71.053e-17248.06protein DENND6A isoform X2 OS=Lingula unguis OX=75... [more]
K1QS761.946e-17047.32UDENN domain-containing protein OS=Crassostrea gig... [more]
A0A210QAF42.233e-16947.28Protein DENND6B OS=Mizuhopecten yessoensis OX=6573... [more]
W4YH445.349e-16946.01UDENN domain-containing protein OS=Strongylocentro... [more]
back to top
BLAST of UDENN domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dennd6aa1.125e-15945.30DENN domain containing 6A [Source:NCBI gene;Acc:10... [more]
dennd6b1.734e-15544.39DENN domain containing 6B [Source:NCBI gene;Acc:10... [more]
dennd6b1.724e-15243.76DENN domain containing 6B [Source:NCBI gene;Acc:10... [more]
dennd6aa6.166e-14043.03DENN domain containing 6A [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of UDENN domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDENN domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of UDENN domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO469629.269e-16646.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of UDENN domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dennd6aa1.085e-15244.43DENN domain containing 6A [Source:NCBI gene;Acc:10... [more]
dennd6b5.760e-12939.68DENN domain containing 6B [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of UDENN domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000064223.10.000e+0100.00SMESG000064223.1[more]
SMESG000064223.10.000e+097.77SMESG000064223.1[more]
SMESG000046940.18.057e-7099.05SMESG000046940.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021319 ID=SMED30021319|Name=UDENN domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2006bp
ACAGATTAAACTTTGAATTTTTTTATTTATTATTTAATAATTAAATTATT
AACATTTATTAGCGGTTGGGAAATAATTACAATATATTAATAATAATTCT
ATCGAATGTCTATATTAAGTAAAAAAGACGATATTAAGCCCGTTTTGCCA
TTTGACAATTTAAATCATTGGATTTATTGTGTATGTGTTGTCACTTTCGA
CTTAGAATTAGGTCAAGCAATGGAGTGCATTTATCCTAAACACATAAAGC
TTGCAGATTCTGAAAAATCCAATGTTAATTATTTATCATTTCCAGATTCT
AATTCAGGTTGCATGGGAGATACAAGATATCATTTTAGATTTCGATGCAG
GAATCCGGTTGTCCATAACGATAACAAAACAAGTGAATTTTATCCAGATT
GTTTAAAACCATCTCCTGATTTCTGCTACGGCTATGTTAATTTCCGCCAA
GTCAAAGATAAGTCTATCCGACGAGGATATTTTCAAAAATCCGTAGTTGT
TTTAAGCCCATTGCCTTTTATTAATTTATTTTATAAAGTATCGGAATTAG
TAGCGCTAGCATATTTCGACGACGGAGAAATCGGCCTGGAAGTTGTTTGT
CACAATATTGATAAATGGGGACCGCCAATGGCAGGTCAGTTGATTAATCT
TCCGTTGAGAGGAGTTGTTCTGCAAACGCAAATTCCCGTTAAAACTGATT
ACGTAACATGTGAACCAAATGGAAAAGTGCACATTTCGAAATCTATTATT
CAAGGCATAGAAAACAATGAAGATCAGAAATTGATGATAGATAATGCATC
AATTTGTATAATTCCGTCTGTACATAGTCAGGACTGTTTTACCGCTTTTG
GAGCTGTAGTTAGCCAATTGCAATTGCTCTGGGAGCTCGTTTTAACCAAT
CAATCAATACTCGTTGTATCGAATAGTCCGATATTCACATCTCTCGTTGT
GCAGTCACTTGTCAGTAGTATTTCACCACTTCAATTCGCTCAAGAATTCA
GGCCATTTTTCACTATTCACGACACGGAGTTCAAGGAATTTACCACTGAA
ACTCAAACACCACCTCAGGTCATCCTCGGAATCACCAATCCATTTTTTGT
GAAAGCTTTGGCACATTGGCCTAATATTCTCAAAGTCACTGATACCAAAT
TAGAATCTCTAAAGAATAGAAAATTAAAAAGTCCCCGTTATTTATTCAAA
CAAGAAGAAATTAAACCAGGTTTATATTCCAATTATAAACCGTTTTTACA
AATTGACAAATCTTTGATTAAATCTTTACAAAAGGGTGTCAAAATCGAAC
GACCTGAATCAATTCAATCCGAGATTATCCGGAAATTTTTTCTTGAACTA
ACTCAGAGTTTTATTTTTCCATTGGAACGTTATGTTGCCAGCTTAATGCC
TTTGAGAAAAGAAATTGTAGCATTTAGAAATCCACCATGTTTGAAAAAGT
TTAATTTTGATGATTTCTTAAAAACTTTGGAAAGTGGGGGTCCTAATTTG
ACTAGCGGTATAAAAGGGGATTGGATTGGTCTTTATCGACTTTTCTATTC
CAGCCCAAATTTTGTTGTATGGCTTTCCCAGAGGCAGCAGGAAATAAACA
TTCAACTGCTGCAAATTCATACGGAAATCATGTGTCGCACCGATGTGTCT
CATTGGATTCAAGACCGGGCGGAAGTTGAAATCGTAGATTTTATCATCCA
AATTAAGTCCAAACTGCGCTATTGCAAAACAAATCGGATTCCTCTATCTA
TTGAGCAGGAACAGGCATTAAATGAAAATATTAAAACAATTATGTCATCT
CTTGCACCGGACCTCCAGGATATGCTTCTGCAACCGAATAGCGGAAATGG
TTCTTTATAGATTTTCTAGATATCACTATTTTTTATATATTTTTTCCAAT
TCGTGTATAAATATATACTACTACATTTCTGTTGCTTTTCTATTAGATAT
TTTGCATATTTTATCTCATTACGCTGGAAGTTTTATTGCCTGTTGCAGCA
ATGGCG
back to top

protein sequence of SMED30021319-orf-1

>SMED30021319-orf-1 ID=SMED30021319-orf-1|Name=SMED30021319-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=585bp
MSILSKKDDIKPVLPFDNLNHWIYCVCVVTFDLELGQAMECIYPKHIKLA
DSEKSNVNYLSFPDSNSGCMGDTRYHFRFRCRNPVVHNDNKTSEFYPDCL
KPSPDFCYGYVNFRQVKDKSIRRGYFQKSVVVLSPLPFINLFYKVSELVA
LAYFDDGEIGLEVVCHNIDKWGPPMAGQLINLPLRGVVLQTQIPVKTDYV
TCEPNGKVHISKSIIQGIENNEDQKLMIDNASICIIPSVHSQDCFTAFGA
VVSQLQLLWELVLTNQSILVVSNSPIFTSLVVQSLVSSISPLQFAQEFRP
FFTIHDTEFKEFTTETQTPPQVILGITNPFFVKALAHWPNILKVTDTKLE
SLKNRKLKSPRYLFKQEEIKPGLYSNYKPFLQIDKSLIKSLQKGVKIERP
ESIQSEIIRKFFLELTQSFIFPLERYVASLMPLRKEIVAFRNPPCLKKFN
FDDFLKTLESGGPNLTSGIKGDWIGLYRLFYSSPNFVVWLSQRQQEINIQ
LLQIHTEIMCRTDVSHWIQDRAEVEIVDFIIQIKSKLRYCKTNRIPLSIE
QEQALNENIKTIMSSLAPDLQDMLLQPNSGNGSL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR024224DENND6
IPR037516Tripartite_DENN
IPR018307ABL9/DENND6_dom
Vocabulary: molecular function
TermDefinition
GO:0005085guanyl-nucleotide exchange factor activity
GO:0017112Rab guanyl-nucleotide exchange factor activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005768endosome
GO:0055037recycling endosome
Vocabulary: biological process
TermDefinition
GO:0043547positive regulation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018307AVL9/DENND6 domainPFAMPF09794Avl9coord: 23..159
e-value: 1.0E-6
score: 27.7
NoneNo IPR availablePFAMPF08616SPAcoord: 244..349
e-value: 1.0E-8
score: 35.1
NoneNo IPR availablePANTHERPTHR13677:SF1PROTEIN DENND6Acoord: 10..577
IPR024224DENND6PANTHERPTHR13677UNCHARACTERIZEDcoord: 10..577
IPR037516Tripartite DENN domainPROSITEPS50211DENNcoord: 24..495
score: 39.363