Unconventional myosin-X

Overview
NameUnconventional myosin-X
Smed IDSMED30021314
Length (bp)2328
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Unconventional myosin-X (SMED30021314) t-SNE clustered cells

Violin plots show distribution of expression levels for Unconventional myosin-X (SMED30021314) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Unconventional myosin-X (SMED30021314) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Unconventional myosin-X (SMED30021314) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021314

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30021314SMESG000078081.1 SmedASXL_006068SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30021314SMESG000078081.1 dd_Smed_v6_19214_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
oocyteSMED30021314SMESG000078081.1 Contig43794newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30021314SMESG000078081.1 Contig43794uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30021314SMESG000078081.1 Contig43794newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30021314SMESG000078081.1 Contig43794uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Unconventional myosin-X vs. Ensembl Human
Match: PLEKHH2 (pleckstrin homology, MyTH4 and FERM domain containing H2 [Source:HGNC Symbol;Acc:HGNC:30506])

HSP 1 Score: 99.7525 bits (247), Expect = 1.138e-20
Identity = 96/361 (26.59%), Postives = 158/361 (43.77%), Query Frame = 2
Query:  329 TTFVGNGNLSINNSHNQVN---LDMTAAIKSKFW-----THSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQ------CMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGL-KPDTSGWSLF--EQLGRFEKHC---DVKELVSDMLFRWESL---KSPRKC--NHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICAL 1336
            T   G+ N+++ +   Q+    L++     S+ W      HSK+ I   L     + +   A+K+F        C   + +  DS +     +   L QS L+  L + EL++EI  QLIKQ             + WQ+L++   +  P     +  L  H K    DS TE G+YAIYCQ+C+ RT +   R   PS  E+ + + R          + ++ ++G Y+ V   + TT  E +  +    G+ KP  SG++LF  +  GR  +HC   ++K  + D++ +WE     + P KC     V L +K R++           E  LL +Q    I      L  + A E+ AL
Sbjct:  915 TVAAGSNNVNVGSEFEQLVCKLLNIDGEPSSQIWRHPTLCHSKEGIISPLTTLPSEALQTEAIKLFKT------CQLFINAAVDSPA---IDYHISLAQSALQICLTHPELQNEICCQLIKQTRRRQPQNQPGPLQGWQLLALCVGLFLPH-HPFLWLLRLHLKR-NADSRTEFGKYAIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIYQVVGFDASTTVEEFLNTLNQDTGMRKPAQSGFALFTDDPSGRDLEHCLQGNIK--ICDIISKWEQASKEQQPGKCEGTRTVRLTYKNRLYFSVQARGETDREKLLLMYQTNDQIINGLFPLNKDLALEMAAL 1262          
BLAST of Unconventional myosin-X vs. Ensembl Human
Match: PLEKHH1 (pleckstrin homology, MyTH4 and FERM domain containing H1 [Source:HGNC Symbol;Acc:HGNC:17733])

HSP 1 Score: 93.5893 bits (231), Expect = 7.622e-19
Identity = 98/396 (24.75%), Postives = 167/396 (42.17%), Query Frame = 2
Query:  329 TTFVGNGNLSINNSHNQVN---LDMTAAIKSKFWTH-----SKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKY-----WQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQ------CMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGL-KPDTSGWSLF--EQLGRFEKHC---DVKELVSDMLFRWE-SLKS--PRKCNHK---VYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDAYVSLRILPQYLRPTINQNII 1423
            T   G  +  +  ++ Q+    +D      S  W H     SK  +  SL     + +   A+K+F     +   N  +E+ S         +   L Q+ L+  L++ EL+ EIY QL+KQ +          QKY     WQ+L++   +  PQ    + Y+    + +  D  +E G+YA YCQ+ + RT+    R   PS  EV +++ R          + ++  +G+Y  V     +T  E ++ +  ++G+ KP  SG++LF  +  GR  +HC    VK  + D + +WE ++K   P K       V L++K R++           E  LL  Q   +I   R  +    A E+ AL    E  D        P    P   Q+++
Sbjct:  792 TVAAGGSSAKVGTAYEQLIGKLMDGEGDPDSPLWRHPMLCYSKDGLYASLTTLPSEALQTEALKLFKSCQLF--INVPVEAAS-------VDYHVSLAQTALQVCLVHPELQSEIYCQLMKQTSCR------PPQKYSLMQCWQLLALCAPLFLPQ-HHFLWYVKQQLQRHA-DPRSETGQYATYCQRAVERTLRTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFTNGTYHVVGFDGSSTVDEFLQRLNQEIGMRKPSHSGFALFTDDPSGRDLEHCLQGSVK--ICDAISKWEQAMKELHPGKSEGGTRVVKLMYKNRLYFRSQVKGETDRERLLLASQTSREIVAGRFPINKELALEMAALMAQVEYGDLEKPALPGPGGTSPAKAQHLL 1168          
BLAST of Unconventional myosin-X vs. Ensembl Human
Match: MYO10 (myosin X [Source:HGNC Symbol;Acc:HGNC:7593])

HSP 1 Score: 86.6557 bits (213), Expect = 1.362e-16
Identity = 70/226 (30.97%), Postives = 114/226 (50.44%), Query Frame = 2
Query:  488 AVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKY-WQILSVVCNVIKPQSQQVICYLDAHFKMYGID-STTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKS 1159
            A+K+FN L        +LES SD            +IQ +L+       LRDE+Y QLIKQ T+     G     Y WQIL+ +     P S+ ++ YL  H K        +E  +YA++  + L +T     R F+PS  E+ A+I RQ M   +Y   G   K+ + SHTT GE+++ +   + ++   + ++LFE  G  +K  + + +V+D+L ++E L +
Sbjct: 1580 AIKIFNSLQ-------QLESMSDP---------IPIIQGILQTGHDLRPLRDELYCQLIKQ-TNKVPHPGSVGNLYSWQILTCLSCTFLP-SRGILKYLKFHLKRIREQFPGSEMEKYALFTYESLKKTK---CREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAA 1784          
BLAST of Unconventional myosin-X vs. Ensembl Human
Match: MYO10 (myosin X [Source:HGNC Symbol;Acc:HGNC:7593])

HSP 1 Score: 86.6557 bits (213), Expect = 1.372e-16
Identity = 70/226 (30.97%), Postives = 114/226 (50.44%), Query Frame = 2
Query:  488 AVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKY-WQILSVVCNVIKPQSQQVICYLDAHFKMYGID-STTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKS 1159
            A+K+FN L        +LES SD            +IQ +L+       LRDE+Y QLIKQ T+     G     Y WQIL+ +     P S+ ++ YL  H K        +E  +YA++  + L +T     R F+PS  E+ A+I RQ M   +Y   G   K+ + SHTT GE+++ +   + ++   + ++LFE  G  +K  + + +V+D+L ++E L +
Sbjct: 1569 AIKIFNSLQ-------QLESMSDP---------IPIIQGILQTGHDLRPLRDELYCQLIKQ-TNKVPHPGSVGNLYSWQILTCLSCTFLP-SRGILKYLKFHLKRIREQFPGSEMEKYALFTYESLKKTK---CREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAA 1773          
BLAST of Unconventional myosin-X vs. Ensembl Human
Match: MYO10 (myosin X [Source:HGNC Symbol;Acc:HGNC:7593])

HSP 1 Score: 86.2705 bits (212), Expect = 1.639e-16
Identity = 70/226 (30.97%), Postives = 114/226 (50.44%), Query Frame = 2
Query:  488 AVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKY-WQILSVVCNVIKPQSQQVICYLDAHFKMYGID-STTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKS 1159
            A+K+FN L        +LES SD            +IQ +L+       LRDE+Y QLIKQ T+     G     Y WQIL+ +     P S+ ++ YL  H K        +E  +YA++  + L +T     R F+PS  E+ A+I RQ M   +Y   G   K+ + SHTT GE+++ +   + ++   + ++LFE  G  +K  + + +V+D+L ++E L +
Sbjct:  908 AIKIFNSLQ-------QLESMSDP---------IPIIQGILQTGHDLRPLRDELYCQLIKQ-TNKVPHPGSVGNLYSWQILTCLSCTFLP-SRGILKYLKFHLKRIREQFPGSEMEKYALFTYESLKKTK---CREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGHVDKAIESRTVVADVLAKFEKLAA 1112          
BLAST of Unconventional myosin-X vs. Ensembl Celegans
Match: hum-6 (Unconventional myosin heavy chain 6 [Source:UniProtKB/Swiss-Prot;Acc:P91443])

HSP 1 Score: 67.781 bits (164), Expect = 3.128e-11
Identity = 72/246 (29.27%), Postives = 118/246 (47.97%), Query Frame = 2
Query:  620 LLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVK---ELVSDMLFRWESL---KSPRKCNHKVYLVFKKRIFDEKWYD-KNDHIEVDLLTHQCISDIFEDRLKLTINQA-AEICA 1333
            +L  +LRDEIY QL KQ+++N   +     + W +LS+      P S++ I YL    +  G   T     Y+ Y +  L RT    +R   PS  E+ A   ++ + L +  +DGS + +   S TT  EL K +  KVGL  ++ G+SL+  L  F+K   +    + V D + + E     +  ++ N    L F+K IF   W+D ++D +  +L+  Q I  I     +   ++  A ICA
Sbjct: 1074 ILREDLRDEIYCQLCKQLSNNPSKLSAA--RGWILLSLCVGCFAP-SERFIKYLFCFIRERGPAGTG----YSKYIEDRLRRTQVNGTRHQPPSYVELQANKSQKPVVLAVTFMDGSVKTLCADSATTAAELCKQLAEKVGLT-NSFGFSLYIAL--FDKVSSLGSGTDHVMDAISQCEQYAKEQGRQERNAPWRLFFRKEIF-SPWHDPRDDPVSTNLIYQQVIRGIKYGEYRCDKDEELAAICA 1308          

HSP 2 Score: 63.5438 bits (153), Expect = 6.709e-10
Identity = 93/420 (22.14%), Postives = 177/420 (42.14%), Query Frame = 2
Query:  419 WTHSKKPIRQSLVK--STRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKL-RIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRW-ESLKSPRKCNHK-------VYLVFKKRIFDEKWYD----KNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDAY-VSLRILPQYLRPTINQNIILKYA-----ETIKN----LPDFEXXXXXXXXXXXXXXXDPFCAIHFSVSQYSVPIWPTEITVSVNKKGL 1603
            W  S++ I Q L+K  + R+D  + A+++F  +M Y             + S ++   T+L   + +  +    LRDE+Y QL+KQ+T N  ++  + ++ W++L +   +  P +   +    +HF        +     A+ CQ  + +  +  SR + P   EV A+  +      +++  D +   +EV S T   +    +  ++GLK  + G+SLF ++   +K   V E  S+  F +  SL      NH        + + ++     + WY+     +   ++    HQ          K T N   E+ AL L     D     L  +PQ L   I ++ +  Y+     +TI N    +   +     ++ L    +   F +  F VSQYS    P  + +++N+ G+
Sbjct: 1622 WRFSREHIDQPLLKKLNGREDACRGAIEIFAAIMKYM----------GDEPSKRSRLGTHLTDHIFKLPISMEALRDELYCQLVKQLTLNPSIM--SEERGWELLWMATGLFAPSA--ALAKEISHF------LKSRPHPIALDCQNRMQKLAKGGSRKYPPHLVEVEAIQHKTTQIFHKVFFPDNTDEAIEVDSATRARDFCHKIGYRLGLK-SSDGFSLFVKIK--DKVLAVPE--SEFFFDYVRSLSDWVHTNHATQKDATMIPINYQVYFMRKLWYNFVAGADPQADIIFHYHQESQKYLLGYHKTTKNDVIELAALILRSMTKDGKNAPLAQIPQLLDEIIPKDSLKMYSASEWRKTISNAYARIEHLKSDQAKIEFLNYICRWPTFGSAFFPVSQYSDLNLPDRLLLAINQTGV 2016          
BLAST of Unconventional myosin-X vs. Ensembl Celegans
Match: max-1 (Motor AXon guidance [Source:UniProtKB/TrEMBL;Acc:Q18420])

HSP 1 Score: 58.151 bits (139), Expect = 2.119e-8
Identity = 42/169 (24.85%), Postives = 83/169 (49.11%), Query Frame = 2
Query:  593 LIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMY-GIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLR------IYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPD-TSGWSLF 1075
            L Q++L   +    LR+E+Y QLIK  + +         + W++L++   +  P+   ++  L  H   +  + + ++E R AI+C+  L+R +    R   PS  EV +V+ R   + +      + L +  Y+ VE    T  G+ +  +  K+G++P   SG++L+
Sbjct:  557 LAQNILSTAVQQEYLRNEVYSQLIKMTSGSMPF----GLQGWKLLALTIPLFLPKQYSLLWLLKRHISRWVDLPNESDETRMAIFCESALDRCLRVGGRQEGPSRLEVTSVLTRDVTRTKFPHSISVKLPNSEYQIVEFDGSTEIGQCLSSLCLKLGMRPALLSGYALY 721          
BLAST of Unconventional myosin-X vs. Ensembl Celegans
Match: max-1 (Motor AXon guidance [Source:UniProtKB/TrEMBL;Acc:Q18420])

HSP 1 Score: 58.151 bits (139), Expect = 2.142e-8
Identity = 42/169 (24.85%), Postives = 83/169 (49.11%), Query Frame = 2
Query:  593 LIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMY-GIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLR------IYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPD-TSGWSLF 1075
            L Q++L   +    LR+E+Y QLIK  + +         + W++L++   +  P+   ++  L  H   +  + + ++E R AI+C+  L+R +    R   PS  EV +V+ R   + +      + L +  Y+ VE    T  G+ +  +  K+G++P   SG++L+
Sbjct:  661 LAQNILSTAVQQEYLRNEVYSQLIKMTSGSMPF----GLQGWKLLALTIPLFLPKQYSLLWLLKRHISRWVDLPNESDETRMAIFCESALDRCLRVGGRQEGPSRLEVTSVLTRDVTRTKFPHSISVKLPNSEYQIVEFDGSTEIGQCLSSLCLKLGMRPALLSGYALY 825          
BLAST of Unconventional myosin-X vs. Ensembl Fly
Match: Myo81F (gene:FBgn0267431 transcript:FBtr0392909)

HSP 1 Score: 182.185 bits (461), Expect = 5.112e-47
Identity = 153/554 (27.62%), Postives = 265/554 (47.83%), Query Frame = 2
Query:  188 TEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSGIF--RSFKRL-KRRNETTFVGNGNLSINNSHNQVNLDMTAAIKSKFWTHSKKPIRQSLVKSTRKDIDKA-AVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKSPRKCN-----------HKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDA--------YVSLRILPQYLRPTINQNIILKYAETIKNLPDFEXXXXXXXXXXXXXXXDPFCAIHFSVSQYSVPIWPTEITVSVNKKGLYFTAKLIGSILLFTKFTDIIRISVKPIGFFTMFLKHEQYSEMKMYSNVAEDISILIRDY 1780
            T+EDRLRL +++  CR+ L+  N V   + H+ G F   + +RL K R E      G      S+ Q + +        FW  SK+ I      ST  D ++A  +++F+ ++TY+     L S  +S S  +  H   +IQS+++K +    L +E+YLQLIKQ TD+ D     N K W +LSV+C+VI P  + V  YL AH K    D  +EEG+YA Y + C  RT     R + PS +E+     R+    + Y +DG Y  +E    +T  ++++I+K K+GL  +  G+S++E +G  E+    +E V D++ +WE  +   +             ++   +FKK +F + + +  D +E +LL HQ + ++  +R  +T  +A  + AL+   E  D          V+   LP    P I    +  + ++++ +   E K   L ++K         A  F V Q     WP  + +++++KG++       ++L    +  II  S             ++ S++ + +  A  I+ LIR+Y
Sbjct: 1539 TKEDRLRLYQNVVLCRRHLVDMNIVK--KPHDFGGFLRNTLRRLSKHRLEKLRSEVG------SNTQEHGETYKGFSHTFWAFSKQQI--PFCISTISDQEEALMIQVFDSILTYS----GLGSSGESISRAEDEH-IRIIQSIMDKCMKKESLLNELYLQLIKQTTDHPDANSRVNLKNWALLSVLCSVILPSMKAVRKYLIAHLKRCSSDFLSEEGKYARYAENCFFRTQGTRRRQWTPSREEILCTTNRRPCYSKFYFMDGQYYSIEFQPSSTANDVLEIIKKKIGLLDNAKGYSIYEVIGNSERSLSSEEKVCDVMAKWEKYQITSQQGFQKNTTLISQQNQYMFLFKKHLFFDNYINLEDIVEKELLYHQILHNLRSERYPITEMEAIMLTALQSQLERGDCCESITDYRAVASHCLPPRFVPNIPHEAVAMHHQSLRGMLPIEAKKAFLNLIKSWPLHR---ATIFDVMQSFTTNWPRTLWLAIDQKGIHLLEHRSRNVLCTYGYDSIISFSPNLNSLMIFTGTEKKQSKVILTTPQAYQITTLIREY 2074          

HSP 2 Score: 76.6406 bits (187), Expect = 7.285e-14
Identity = 73/317 (23.03%), Postives = 143/317 (45.11%), Query Frame = 2
Query:  428 SKKPIRQSLVKSTRKD-IDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLN--RTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVY---------LVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIF-EDRLKLTINQAAEICALR 1339
            S K  +  +   ++ D I  + + M++       C+   E        L A  +  +IQ ++   +   ELRDEI++Q I+Q + NN  +  T+ + W IL +     +P S+ +  Y  +  K   I+    +G+   Y Q C +  ++ +  +R++ PS+ EV A+ R   +  R + LD   + ++V    T G+ ++ +  K+ L   T GW++++     E+H    + + D++  WE  ++      K            VFKKR+F        D +EV +L  Q +  +  +D   ++   A ++  L+
Sbjct: 1034 SDKTAKHEMTMFSKSDKIPTSHIHMYDPENVVLSCSMFRELCKYMRGELNAERELQIIQYIVGLGIEREELRDEIFIQCIRQ-SRNNPNIDWTD-RIWIILCLSIVAFQP-SKLLFRYFVSFIKKSMIEL---DGKLRQYSQWCFDNCKSTKVSTRMYPPSSVEVAAMRRLGTIVCRFFFLDARTKAIDVHPTDTAGDAVQKLAEKLNLTT-TDGWAIYQNRPDGEEHIKSYDYLYDVISSWEMKQATYAGTKKTTNGSSSGENQFVFKKRLFKSTHELSQDPVEVSMLYSQAVHSVVKKDEFPVSEKVALQLAGLQ 1343          
BLAST of Unconventional myosin-X vs. Ensembl Fly
Match: ck (gene:FBgn0000317 transcript:FBtr0080724)

HSP 1 Score: 72.4034 bits (176), Expect = 1.634e-12
Identity = 102/390 (26.15%), Postives = 172/390 (44.10%), Query Frame = 2
Query:  146 QQANQRLLLRMARFTEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSGIFRSFKRLKRRNETTFVGNGNLSINNSHNQVNLDMTAAIKSKFWTHSKKPIRQSLVKSTRKDIDKAAVKMFNILM--TYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEG--RYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDV---KELVSDMLFRWESL---KSPRKCNHKVYLVFKKRIFDEKWYDK-NDHIEVDLLTHQCISDI 1282
            Q A Q L + + RFT +    + E  +     +  T+ +S V    + + R+F R K   E   +G              LD  A +K K      + IR  LV  T K  +K    +   L    Y   +++    S   S+L+  H       ++   +L +ELRDEIY Q+ KQ+T+N   +  ++ + W +LS+      P S++ + YL A  +         EG   YA YC++ L RT    +R   PS  E+ A   ++ + L I  +DG+ + +   S TT  EL   +  K+ LK D  G+SL+  L  F+K   +    + V D + + E     +  ++ N    L F+K IF   W++  +D +  +L+  Q +  +
Sbjct: 1026 QLAAQALWITILRFTGD----MPEPKYHTMDRMDTTSVMSKV---TATLGRNFIRSKEFQEAQLMG--------------LDPDAFLKQK-----PRSIRHKLVSLTLKRKNKLGEDVRRRLQDDEYTADSYQSWLQSRPTSNLEKLH------FIIGHGILRAELRDEIYCQICKQLTNNP--LKSSHARGWILLSLCVGCFAP-SEKFVNYLRAFIR---------EGPPGYAPYCEERLKRTFNNGTRNQPPSWLELQATKSKKPIMLPITFMDGNTKTLLADSATTARELCNQLSDKISLK-DQFGFSLYIAL--FDKVSSLGSGGDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEIF-APWHEPTHDQVATNLIYQQVVRGV 1367          

HSP 2 Score: 52.373 bits (124), Expect = 2.186e-6
Identity = 73/377 (19.36%), Postives = 148/377 (39.26%), Query Frame = 2
Query:  605 LLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIK-PQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKL-RIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQL---------GRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDAYVSLRILPQYLRPTINQNIILKYAETIKNLPDFEXXXXXXXXXXXXXXXD--------------PFCAIHFSVSQYSVPIWPTEITVSVNKKGLYFTAKLIGSILLFTKFTDI 1660
            + +  L +  LRDEIY QL+KQ+TDN + +  + ++ W+++ +   +    Q       L    + + I   +            L +TI    R + P   EV A+  +      ++Y  D +    EV S T   +    +  ++ L+  + G+SLF ++         G F    D    ++D + +   ++          + F K+++      K+ + ++    HQ +  +     K +  +AA++ AL       +    L+ +PQ LR  I  +I+      I++  +++               +               F +  F V Q + P +P  + +++NK G+     +   IL+   FT I
Sbjct: 1753 IFDGPLKHEILRDEIYCQLMKQLTDNRNRM--SEERGWELMWLATGLFACSQGLLKELLLFLRTRRHPISQDS---------MHRLQKTIRHGQRKYPPHQVEVEAIQHKTTQIFHKVYFPDDTDEAFEVDSSTRAKDFCNNISQRLSLR-TSEGFSLFVKIADKVISVPEGDF--FFDFVRHLTDWIKKARPIRDGANPQFTYQVFFMKKLWTNTVPGKDRNADLIFHYHQELPKLLRGYHKCSREEAAKLAALVFRVRFGENKQELQAIPQMLRELIPSDIM-----KIQSTSEWKRSIVASYNQDGGMTSEDAKVAFLKIVYRWPTFGSAFFEVKQTTEPNYPEMLLIAINKHGVSLIHPVTKDILVTHPFTRI 2110          
BLAST of Unconventional myosin-X vs. Ensembl Fly
Match: ck (gene:FBgn0000317 transcript:FBtr0343687)

HSP 1 Score: 72.4034 bits (176), Expect = 1.634e-12
Identity = 102/390 (26.15%), Postives = 172/390 (44.10%), Query Frame = 2
Query:  146 QQANQRLLLRMARFTEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSGIFRSFKRLKRRNETTFVGNGNLSINNSHNQVNLDMTAAIKSKFWTHSKKPIRQSLVKSTRKDIDKAAVKMFNILM--TYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEG--RYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDV---KELVSDMLFRWESL---KSPRKCNHKVYLVFKKRIFDEKWYDK-NDHIEVDLLTHQCISDI 1282
            Q A Q L + + RFT +    + E  +     +  T+ +S V    + + R+F R K   E   +G              LD  A +K K      + IR  LV  T K  +K    +   L    Y   +++    S   S+L+  H       ++   +L +ELRDEIY Q+ KQ+T+N   +  ++ + W +LS+      P S++ + YL A  +         EG   YA YC++ L RT    +R   PS  E+ A   ++ + L I  +DG+ + +   S TT  EL   +  K+ LK D  G+SL+  L  F+K   +    + V D + + E     +  ++ N    L F+K IF   W++  +D +  +L+  Q +  +
Sbjct: 1026 QLAAQALWITILRFTGD----MPEPKYHTMDRMDTTSVMSKV---TATLGRNFIRSKEFQEAQLMG--------------LDPDAFLKQK-----PRSIRHKLVSLTLKRKNKLGEDVRRRLQDDEYTADSYQSWLQSRPTSNLEKLH------FIIGHGILRAELRDEIYCQICKQLTNNP--LKSSHARGWILLSLCVGCFAP-SEKFVNYLRAFIR---------EGPPGYAPYCEERLKRTFNNGTRNQPPSWLELQATKSKKPIMLPITFMDGNTKTLLADSATTARELCNQLSDKISLK-DQFGFSLYIAL--FDKVSSLGSGGDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEIF-APWHEPTHDQVATNLIYQQVVRGV 1367          

HSP 2 Score: 52.373 bits (124), Expect = 2.186e-6
Identity = 73/377 (19.36%), Postives = 148/377 (39.26%), Query Frame = 2
Query:  605 LLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIK-PQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKL-RIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQL---------GRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDAYVSLRILPQYLRPTINQNIILKYAETIKNLPDFEXXXXXXXXXXXXXXXD--------------PFCAIHFSVSQYSVPIWPTEITVSVNKKGLYFTAKLIGSILLFTKFTDI 1660
            + +  L +  LRDEIY QL+KQ+TDN + +  + ++ W+++ +   +    Q       L    + + I   +            L +TI    R + P   EV A+  +      ++Y  D +    EV S T   +    +  ++ L+  + G+SLF ++         G F    D    ++D + +   ++          + F K+++      K+ + ++    HQ +  +     K +  +AA++ AL       +    L+ +PQ LR  I  +I+      I++  +++               +               F +  F V Q + P +P  + +++NK G+     +   IL+   FT I
Sbjct: 1753 IFDGPLKHEILRDEIYCQLMKQLTDNRNRM--SEERGWELMWLATGLFACSQGLLKELLLFLRTRRHPISQDS---------MHRLQKTIRHGQRKYPPHQVEVEAIQHKTTQIFHKVYFPDDTDEAFEVDSSTRAKDFCNNISQRLSLR-TSEGFSLFVKIADKVISVPEGDF--FFDFVRHLTDWIKKARPIRDGANPQFTYQVFFMKKLWTNTVPGKDRNADLIFHYHQELPKLLRGYHKCSREEAAKLAALVFRVRFGENKQELQAIPQMLRELIPSDIM-----KIQSTSEWKRSIVASYNQDGGMTSEDAKVAFLKIVYRWPTFGSAFFEVKQTTEPNYPEMLLIAINKHGVSLIHPVTKDILVTHPFTRI 2110          
BLAST of Unconventional myosin-X vs. Ensembl Fly
Match: ck (gene:FBgn0000317 transcript:FBtr0343686)

HSP 1 Score: 72.4034 bits (176), Expect = 1.634e-12
Identity = 102/390 (26.15%), Postives = 172/390 (44.10%), Query Frame = 2
Query:  146 QQANQRLLLRMARFTEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSGIFRSFKRLKRRNETTFVGNGNLSINNSHNQVNLDMTAAIKSKFWTHSKKPIRQSLVKSTRKDIDKAAVKMFNILM--TYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEG--RYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDV---KELVSDMLFRWESL---KSPRKCNHKVYLVFKKRIFDEKWYDK-NDHIEVDLLTHQCISDI 1282
            Q A Q L + + RFT +    + E  +     +  T+ +S V    + + R+F R K   E   +G              LD  A +K K      + IR  LV  T K  +K    +   L    Y   +++    S   S+L+  H       ++   +L +ELRDEIY Q+ KQ+T+N   +  ++ + W +LS+      P S++ + YL A  +         EG   YA YC++ L RT    +R   PS  E+ A   ++ + L I  +DG+ + +   S TT  EL   +  K+ LK D  G+SL+  L  F+K   +    + V D + + E     +  ++ N    L F+K IF   W++  +D +  +L+  Q +  +
Sbjct: 1026 QLAAQALWITILRFTGD----MPEPKYHTMDRMDTTSVMSKV---TATLGRNFIRSKEFQEAQLMG--------------LDPDAFLKQK-----PRSIRHKLVSLTLKRKNKLGEDVRRRLQDDEYTADSYQSWLQSRPTSNLEKLH------FIIGHGILRAELRDEIYCQICKQLTNNP--LKSSHARGWILLSLCVGCFAP-SEKFVNYLRAFIR---------EGPPGYAPYCEERLKRTFNNGTRNQPPSWLELQATKSKKPIMLPITFMDGNTKTLLADSATTARELCNQLSDKISLK-DQFGFSLYIAL--FDKVSSLGSGGDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEIF-APWHEPTHDQVATNLIYQQVVRGV 1367          

HSP 2 Score: 52.373 bits (124), Expect = 2.186e-6
Identity = 73/377 (19.36%), Postives = 148/377 (39.26%), Query Frame = 2
Query:  605 LLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIK-PQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKL-RIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQL---------GRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDAYVSLRILPQYLRPTINQNIILKYAETIKNLPDFEXXXXXXXXXXXXXXXD--------------PFCAIHFSVSQYSVPIWPTEITVSVNKKGLYFTAKLIGSILLFTKFTDI 1660
            + +  L +  LRDEIY QL+KQ+TDN + +  + ++ W+++ +   +    Q       L    + + I   +            L +TI    R + P   EV A+  +      ++Y  D +    EV S T   +    +  ++ L+  + G+SLF ++         G F    D    ++D + +   ++          + F K+++      K+ + ++    HQ +  +     K +  +AA++ AL       +    L+ +PQ LR  I  +I+      I++  +++               +               F +  F V Q + P +P  + +++NK G+     +   IL+   FT I
Sbjct: 1753 IFDGPLKHEILRDEIYCQLMKQLTDNRNRM--SEERGWELMWLATGLFACSQGLLKELLLFLRTRRHPISQDS---------MHRLQKTIRHGQRKYPPHQVEVEAIQHKTTQIFHKVYFPDDTDEAFEVDSSTRAKDFCNNISQRLSLR-TSEGFSLFVKIADKVISVPEGDF--FFDFVRHLTDWIKKARPIRDGANPQFTYQVFFMKKLWTNTVPGKDRNADLIFHYHQELPKLLRGYHKCSREEAAKLAALVFRVRFGENKQELQAIPQMLRELIPSDIM-----KIQSTSEWKRSIVASYNQDGGMTSEDAKVAFLKIVYRWPTFGSAFFEVKQTTEPNYPEMLLIAINKHGVSLIHPVTKDILVTHPFTRI 2110          
BLAST of Unconventional myosin-X vs. Ensembl Fly
Match: ck (gene:FBgn0000317 transcript:FBtr0080723)

HSP 1 Score: 72.4034 bits (176), Expect = 1.634e-12
Identity = 102/390 (26.15%), Postives = 172/390 (44.10%), Query Frame = 2
Query:  146 QQANQRLLLRMARFTEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSGIFRSFKRLKRRNETTFVGNGNLSINNSHNQVNLDMTAAIKSKFWTHSKKPIRQSLVKSTRKDIDKAAVKMFNILM--TYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEG--RYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDV---KELVSDMLFRWESL---KSPRKCNHKVYLVFKKRIFDEKWYDK-NDHIEVDLLTHQCISDI 1282
            Q A Q L + + RFT +    + E  +     +  T+ +S V    + + R+F R K   E   +G              LD  A +K K      + IR  LV  T K  +K    +   L    Y   +++    S   S+L+  H       ++   +L +ELRDEIY Q+ KQ+T+N   +  ++ + W +LS+      P S++ + YL A  +         EG   YA YC++ L RT    +R   PS  E+ A   ++ + L I  +DG+ + +   S TT  EL   +  K+ LK D  G+SL+  L  F+K   +    + V D + + E     +  ++ N    L F+K IF   W++  +D +  +L+  Q +  +
Sbjct: 1026 QLAAQALWITILRFTGD----MPEPKYHTMDRMDTTSVMSKV---TATLGRNFIRSKEFQEAQLMG--------------LDPDAFLKQK-----PRSIRHKLVSLTLKRKNKLGEDVRRRLQDDEYTADSYQSWLQSRPTSNLEKLH------FIIGHGILRAELRDEIYCQICKQLTNNP--LKSSHARGWILLSLCVGCFAP-SEKFVNYLRAFIR---------EGPPGYAPYCEERLKRTFNNGTRNQPPSWLELQATKSKKPIMLPITFMDGNTKTLLADSATTARELCNQLSDKISLK-DQFGFSLYIAL--FDKVSSLGSGGDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEIF-APWHEPTHDQVATNLIYQQVVRGV 1367          

HSP 2 Score: 52.373 bits (124), Expect = 2.186e-6
Identity = 73/377 (19.36%), Postives = 148/377 (39.26%), Query Frame = 2
Query:  605 LLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIK-PQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKL-RIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQL---------GRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDAYVSLRILPQYLRPTINQNIILKYAETIKNLPDFEXXXXXXXXXXXXXXXD--------------PFCAIHFSVSQYSVPIWPTEITVSVNKKGLYFTAKLIGSILLFTKFTDI 1660
            + +  L +  LRDEIY QL+KQ+TDN + +  + ++ W+++ +   +    Q       L    + + I   +            L +TI    R + P   EV A+  +      ++Y  D +    EV S T   +    +  ++ L+  + G+SLF ++         G F    D    ++D + +   ++          + F K+++      K+ + ++    HQ +  +     K +  +AA++ AL       +    L+ +PQ LR  I  +I+      I++  +++               +               F +  F V Q + P +P  + +++NK G+     +   IL+   FT I
Sbjct: 1753 IFDGPLKHEILRDEIYCQLMKQLTDNRNRM--SEERGWELMWLATGLFACSQGLLKELLLFLRTRRHPISQDS---------MHRLQKTIRHGQRKYPPHQVEVEAIQHKTTQIFHKVYFPDDTDEAFEVDSSTRAKDFCNNISQRLSLR-TSEGFSLFVKIADKVISVPEGDF--FFDFVRHLTDWIKKARPIRDGANPQFTYQVFFMKKLWTNTVPGKDRNADLIFHYHQELPKLLRGYHKCSREEAAKLAALVFRVRFGENKQELQAIPQMLRELIPSDIM-----KIQSTSEWKRSIVASYNQDGGMTSEDAKVAFLKIVYRWPTFGSAFFEVKQTTEPNYPEMLLIAINKHGVSLIHPVTKDILVTHPFTRI 2110          
BLAST of Unconventional myosin-X vs. Ensembl Zebrafish
Match: myo10 (myosin X [Source:ZFIN;Acc:ZDB-GENE-070912-277])

HSP 1 Score: 100.523 bits (249), Expect = 3.140e-21
Identity = 68/250 (27.20%), Postives = 118/250 (47.20%), Query Frame = 2
Query:  596 IQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFK-MYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRL 1342
            IQ+LL+       LRDE++ QLIKQ + +    G  +   W+I++ +C    P S+ ++ YL  HFK    +   TE  RYA + Q  L        R ++PS +E+ A++ RQ M   +Y   G   K+ + SHTT GE+++ +   + ++   + ++LFE     ++  + + +V+D+L ++E L +  +        FK   F E      D +E   +  Q    +   R          + ALRL
Sbjct:  532 IQTLLQTTHDLRPLRDELFCQLIKQTSHHPKPGGPAHINSWRIIACLCCTFSPASRSILKYLKFHFKRTRELYPGTEMERYAAFSQDALRHVR---GREYVPSQEELRAILSRQEMTATVYCHGGGSCKITINSHTTAGEVVEKLLKGLSMEDCRNMFALFEHNDNTDRAIESRTVVADILAKFEKLANKEQDGESWKFYFKLFCFSEPENVPADSVEFAFMFEQAHEAVIRGRYPAPEETLQFLAALRL 778          
BLAST of Unconventional myosin-X vs. Ensembl Zebrafish
Match: CR392032.2 (myosin X [Source:NCBI gene;Acc:569779])

HSP 1 Score: 100.908 bits (250), Expect = 3.621e-21
Identity = 68/250 (27.20%), Postives = 118/250 (47.20%), Query Frame = 2
Query:  596 IQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFK-MYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRL 1342
            IQ+LL+       LRDE++ QLIKQ + +    G  +   W+I++ +C    P S+ ++ YL  HFK    +   TE  RYA + Q  L        R ++PS +E+ A++ RQ M   +Y   G   K+ + SHTT GE+++ +   + ++   + ++LFE     ++  + + +V+D+L ++E L +  +        FK   F E      D +E   +  Q    +   R          + ALRL
Sbjct: 1541 IQTLLQTTHDLRPLRDELFCQLIKQTSHHPKPGGPAHINSWRIIACLCCTFSPASRSILKYLKFHFKRTRELYPGTEMERYAAFSQDALRHVR---GREYVPSQEELRAILSRQEMTATVYCHGGGSCKITINSHTTAGEVVEKLLKGLSMEDCRNMFALFEHNDNTDRAIESRTVVADILAKFEKLANKEQDGESWKFYFKLFCFSEPENVPADSVEFAFMFEQAHEAVIRGRYPAPEETLQFLAALRL 1787          
BLAST of Unconventional myosin-X vs. Ensembl Zebrafish
Match: myo10 (myosin X [Source:ZFIN;Acc:ZDB-GENE-070912-277])

HSP 1 Score: 100.908 bits (250), Expect = 3.710e-21
Identity = 68/250 (27.20%), Postives = 118/250 (47.20%), Query Frame = 2
Query:  596 IQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFK-MYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRL 1342
            IQ+LL+       LRDE++ QLIKQ + +    G  +   W+I++ +C    P S+ ++ YL  HFK    +   TE  RYA + Q  L        R ++PS +E+ A++ RQ M   +Y   G   K+ + SHTT GE+++ +   + ++   + ++LFE     ++  + + +V+D+L ++E L +  +        FK   F E      D +E   +  Q    +   R          + ALRL
Sbjct: 1599 IQTLLQTTHDLRPLRDELFCQLIKQTSHHPKPGGPAHINSWRIIACLCCTFSPASRSILKYLKFHFKRTRELYPGTEMERYAAFSQDALRHVR---GREYVPSQEELRAILSRQEMTATVYCHGGGSCKITINSHTTAGEVVEKLLKGLSMEDCRNMFALFEHNDNTDRAIESRTVVADILAKFEKLANKEQDGESWKFYFKLFCFSEPENVPADSVEFAFMFEQAHEAVIRGRYPAPEETLQFLAALRL 1845          
BLAST of Unconventional myosin-X vs. Ensembl Zebrafish
Match: CR392032.2 (myosin X [Source:NCBI gene;Acc:569779])

HSP 1 Score: 100.523 bits (249), Expect = 3.843e-21
Identity = 68/250 (27.20%), Postives = 118/250 (47.20%), Query Frame = 2
Query:  596 IQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFK-MYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRL 1342
            IQ+LL+       LRDE++ QLIKQ + +    G  +   W+I++ +C    P S+ ++ YL  HFK    +   TE  RYA + Q  L        R ++PS +E+ A++ RQ M   +Y   G   K+ + SHTT GE+++ +   + ++   + ++LFE     ++  + + +V+D+L ++E L +  +        FK   F E      D +E   +  Q    +   R          + ALRL
Sbjct: 1539 IQTLLQTTHDLRPLRDELFCQLIKQTSHHPKPGGPAHINSWRIIACLCCTFSPASRSILKYLKFHFKRTRELYPGTEMERYAAFSQDALRHVR---GREYVPSQEELRAILSRQEMTATVYCHGGGSCKITINSHTTAGEVVEKLLKGLSMEDCRNMFALFEHNDNTDRAIESRTVVADILAKFEKLANKEQDGESWKFYFKLFCFSEPENVPADSVEFAFMFEQAHEAVIRGRYPAPEETLQFLAALRL 1785          
BLAST of Unconventional myosin-X vs. Ensembl Zebrafish
Match: CR392032.2 (myosin X [Source:NCBI gene;Acc:569779])

HSP 1 Score: 100.523 bits (249), Expect = 3.960e-21
Identity = 68/250 (27.20%), Postives = 118/250 (47.20%), Query Frame = 2
Query:  596 IQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFK-MYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRL 1342
            IQ+LL+       LRDE++ QLIKQ + +    G  +   W+I++ +C    P S+ ++ YL  HFK    +   TE  RYA + Q  L        R ++PS +E+ A++ RQ M   +Y   G   K+ + SHTT GE+++ +   + ++   + ++LFE     ++  + + +V+D+L ++E L +  +        FK   F E      D +E   +  Q    +   R          + ALRL
Sbjct: 1507 IQTLLQTTHDLRPLRDELFCQLIKQTSHHPKPGGPAHINSWRIIACLCCTFSPASRSILKYLKFHFKRTRELYPGTEMERYAAFSQDALRHVR---GREYVPSQEELRAILSRQEMTATVYCHGGGSCKITINSHTTAGEVVEKLLKGLSMEDCRNMFALFEHNDNTDRAIESRTVVADILAKFEKLANKEQDGESWKFYFKLFCFSEPENVPADSVEFAFMFEQAHEAVIRGRYPAPEETLQFLAALRL 1753          
BLAST of Unconventional myosin-X vs. Ensembl Xenopus
Match: PLEKHH2 (pleckstrin homology, MyTH4 and FERM domain containing H2 [Source:NCBI gene;Acc:100485060])

HSP 1 Score: 102.834 bits (255), Expect = 8.680e-22
Identity = 77/276 (27.90%), Postives = 134/276 (48.55%), Query Frame = 2
Query:  425 HSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQ------CMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGL-KPDTSGWSLF--EQLGRFEKHCDVKEL-VSDMLFRWESL---KSPRKCN--HKVYLVFKKRI 1207
            HSK+ I  +L     + +   A+K+F        C   L +  DS +     +   L QS L+  L + EL++E+Y QLIKQ          +  + WQ+L++   +  PQ   +  +L   +     D+ TE G+YAIYCQ+C+ RT +   R   PS  E+ +++ R          + ++ ++G+Y+ V   + TT  E +  +   +G+ KP  SG++LF  +  G+  +HC    L + D++ +WE     + P KC+    V L +K R+
Sbjct:  605 HSKEAITSALTTLPSEALQTEAIKLFKT------CQLFLNAAVDSPA---IDYHVSLAQSALQVCLTHPELQNEMYCQLIKQTRHRQPNNQASPIQGWQLLALCTGLFLPQHPYI--WLLKLYLSKNADNRTEAGKYAIYCQRCVERTQQNGDRQAKPSRMEILSILLRNPYHHSLPFSIPVHFMNGTYQVVGFDASTTVEEFLCTLNQDIGMRKPGLSGFALFTDDPSGKHFEHCLQGNLKICDIISKWEQASKEQHPGKCDGSRTVRLTYKNRL 869          
BLAST of Unconventional myosin-X vs. Ensembl Xenopus
Match: PLEKHH2 (pleckstrin homology, MyTH4 and FERM domain containing H2 [Source:NCBI gene;Acc:100485060])

HSP 1 Score: 102.449 bits (254), Expect = 1.150e-21
Identity = 78/283 (27.56%), Postives = 136/283 (48.06%), Query Frame = 2
Query:  404 IKSKFWTHSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQ------CMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGL-KPDTSGWSLF--EQLGRFEKHCDVKEL-VSDMLFRWESL---KSPRKCN--HKVYLVFKKRI 1207
            +K     HSK+ I  +L     + +   A+K+F        C   L +  DS +     +   L QS L+  L + EL++E+Y QLIKQ          +  + WQ+L++   +  PQ   +  +L   +     D+ TE G+YAIYCQ+C+ RT +   R   PS  E+ +++ R          + ++ ++G+Y+ V   + TT  E +  +   +G+ KP  SG++LF  +  G+  +HC    L + D++ +WE     + P KC+    V L +K R+
Sbjct:  385 LKHPVLCHSKEAITSALTTLPSEALQTEAIKLFKT------CQLFLNAAVDSPA---IDYHVSLAQSALQVCLTHPELQNEMYCQLIKQTRHRQPNNQASPIQGWQLLALCTGLFLPQHPYI--WLLKLYLSKNADNRTEAGKYAIYCQRCVERTQQNGDRQAKPSRMEILSILLRNPYHHSLPFSIPVHFMNGTYQVVGFDASTTVEEFLCTLNQDIGMRKPGLSGFALFTDDPSGKHFEHCLQGNLKICDIISKWEQASKEQHPGKCDGSRTVRLTYKNRL 656          
BLAST of Unconventional myosin-X vs. Ensembl Xenopus
Match: PLEKHH2 (pleckstrin homology, MyTH4 and FERM domain containing H2 [Source:NCBI gene;Acc:100485060])

HSP 1 Score: 102.064 bits (253), Expect = 1.710e-21
Identity = 78/283 (27.56%), Postives = 136/283 (48.06%), Query Frame = 2
Query:  404 IKSKFWTHSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQ------CMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGL-KPDTSGWSLF--EQLGRFEKHCDVKEL-VSDMLFRWESL---KSPRKCN--HKVYLVFKKRI 1207
            +K     HSK+ I  +L     + +   A+K+F        C   L +  DS +     +   L QS L+  L + EL++E+Y QLIKQ          +  + WQ+L++   +  PQ   +  +L   +     D+ TE G+YAIYCQ+C+ RT +   R   PS  E+ +++ R          + ++ ++G+Y+ V   + TT  E +  +   +G+ KP  SG++LF  +  G+  +HC    L + D++ +WE     + P KC+    V L +K R+
Sbjct:  708 LKHPVLCHSKEAITSALTTLPSEALQTEAIKLFKT------CQLFLNAAVDSPA---IDYHVSLAQSALQVCLTHPELQNEMYCQLIKQTRHRQPNNQASPIQGWQLLALCTGLFLPQHPYI--WLLKLYLSKNADNRTEAGKYAIYCQRCVERTQQNGDRQAKPSRMEILSILLRNPYHHSLPFSIPVHFMNGTYQVVGFDASTTVEEFLCTLNQDIGMRKPGLSGFALFTDDPSGKHFEHCLQGNLKICDIISKWEQASKEQHPGKCDGSRTVRLTYKNRL 979          
BLAST of Unconventional myosin-X vs. Ensembl Xenopus
Match: PLEKHH2 (pleckstrin homology, MyTH4 and FERM domain containing H2 [Source:NCBI gene;Acc:100485060])

HSP 1 Score: 102.064 bits (253), Expect = 1.992e-21
Identity = 77/276 (27.90%), Postives = 134/276 (48.55%), Query Frame = 2
Query:  425 HSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQ------CMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGL-KPDTSGWSLF--EQLGRFEKHCDVKEL-VSDMLFRWESL---KSPRKCN--HKVYLVFKKRI 1207
            HSK+ I  +L     + +   A+K+F        C   L +  DS +     +   L QS L+  L + EL++E+Y QLIKQ          +  + WQ+L++   +  PQ   +  +L   +     D+ TE G+YAIYCQ+C+ RT +   R   PS  E+ +++ R          + ++ ++G+Y+ V   + TT  E +  +   +G+ KP  SG++LF  +  G+  +HC    L + D++ +WE     + P KC+    V L +K R+
Sbjct:  871 HSKEAITSALTTLPSEALQTEAIKLFKT------CQLFLNAAVDSPA---IDYHVSLAQSALQVCLTHPELQNEMYCQLIKQTRHRQPNNQASPIQGWQLLALCTGLFLPQHPYI--WLLKLYLSKNADNRTEAGKYAIYCQRCVERTQQNGDRQAKPSRMEILSILLRNPYHHSLPFSIPVHFMNGTYQVVGFDASTTVEEFLCTLNQDIGMRKPGLSGFALFTDDPSGKHFEHCLQGNLKICDIISKWEQASKEQHPGKCDGSRTVRLTYKNRL 1135          
BLAST of Unconventional myosin-X vs. Ensembl Xenopus
Match: PLEKHH2 (pleckstrin homology, MyTH4 and FERM domain containing H2 [Source:NCBI gene;Acc:100485060])

HSP 1 Score: 101.679 bits (252), Expect = 2.146e-21
Identity = 77/276 (27.90%), Postives = 134/276 (48.55%), Query Frame = 2
Query:  425 HSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQ------CMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGL-KPDTSGWSLF--EQLGRFEKHCDVKEL-VSDMLFRWESL---KSPRKCN--HKVYLVFKKRI 1207
            HSK+ I  +L     + +   A+K+F        C   L +  DS +     +   L QS L+  L + EL++E+Y QLIKQ          +  + WQ+L++   +  PQ   +  +L   +     D+ TE G+YAIYCQ+C+ RT +   R   PS  E+ +++ R          + ++ ++G+Y+ V   + TT  E +  +   +G+ KP  SG++LF  +  G+  +HC    L + D++ +WE     + P KC+    V L +K R+
Sbjct:  921 HSKEAITSALTTLPSEALQTEAIKLFKT------CQLFLNAAVDSPA---IDYHVSLAQSALQVCLTHPELQNEMYCQLIKQTRHRQPNNQASPIQGWQLLALCTGLFLPQHPYI--WLLKLYLSKNADNRTEAGKYAIYCQRCVERTQQNGDRQAKPSRMEILSILLRNPYHHSLPFSIPVHFMNGTYQVVGFDASTTVEEFLCTLNQDIGMRKPGLSGFALFTDDPSGKHFEHCLQGNLKICDIISKWEQASKEQHPGKCDGSRTVRLTYKNRL 1185          
BLAST of Unconventional myosin-X vs. Ensembl Mouse
Match: Plekhh1 (pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 [Source:MGI Symbol;Acc:MGI:2144989])

HSP 1 Score: 107.842 bits (268), Expect = 2.468e-23
Identity = 131/536 (24.44%), Postives = 220/536 (41.04%), Query Frame = 2
Query:  329 TTFVGNGNLSINNSHNQVN---LDMTAAIKSKFWTH-----SKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKY-----WQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQ------CMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGL-KPDTSGWSLF--EQLGRFEKHC-DVKELVSDMLFRWE-SLKS--PRKCNHK---VYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDAYVSLRILPQYLRPTINQNIILK-----YAETIKNLPDFEXXXXXXXXXXXXXXXDPFCAIHFSVSQYSVPIWPTEITVSVNKKGLYFTAKLIGS--ILLFTKFTDIIRISVKPIGFFTMFLKHEQ------YSEMKMYSNVAEDISILIRDYLVDQSILKTR 1810
            T   G  N  +   + Q+    +D      S  W H     S++ +  SL     + +   A+K+F     +   N  +E+ S         +   L Q+ L+  L++ EL+ EIY QL+KQI+          QKY     WQ+L++   +  PQ    + Y+    + +  D  +E G+YAIYCQ+ + RT++   R   PS  EV +++ R          + ++  +G+Y+ V     +T  E ++ +  + G+ KP  SG++LF  +  GR  +HC   +  + D + +WE +LK   P K       V L++K R++           E  LL  Q   +I   R  +T   A E+ AL    E  D        P    PT  Q+++ +     Y    +N    E                   A  ++  Q   P     I ++V +K   F AKL  +    L  K   ++ I+V   G   +  +  Q      YS +  +    +D  ++IR  + DQS  KTR
Sbjct:  786 TVAAGGSNAKVGTVYEQLIGKLMDGEGNPDSPLWRHPMLCYSQEGLCASLTTLPSEALQTEALKLFKSCQLF--INVPVEAAS-------VDYHVSLAQTALQVCLVHPELQSEIYCQLMKQISCRPP------QKYSLMQCWQLLALCAPLFLPQ-HHFLWYVKQQLQRHA-DPRSETGQYAIYCQRAVERTLQTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFANGTYQVVGFDGSSTVDEFLQRLNQETGMRKPSQSGFALFTDDPSGRDLEHCLQGRVKICDAISKWEQTLKELHPGKSEGGTRVVKLMYKNRLYFRSQVKGETERERLLLAFQASGEIVAGRFPVTKELALEMAALMAQVEYGDLEKPTLPGPGGTPPTKAQHLLQQVLDRFYPRRYRNGAPPEQLRHLAD----------MMATKWAALQGCSPPECIRIYLTVARKWPLFGAKLFAAQPAQLSPKENTVVWIAVNEDGVSILDHRTMQVNITYPYSSVTTFGGCRDDFMLVIRS-IPDQSSGKTR 1293          
BLAST of Unconventional myosin-X vs. Ensembl Mouse
Match: Plekhh1 (pleckstrin homology domain containing, family H (with MyTH4 domain) member 1 [Source:MGI Symbol;Acc:MGI:2144989])

HSP 1 Score: 107.842 bits (268), Expect = 2.468e-23
Identity = 131/536 (24.44%), Postives = 220/536 (41.04%), Query Frame = 2
Query:  329 TTFVGNGNLSINNSHNQVN---LDMTAAIKSKFWTH-----SKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKY-----WQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQ------CMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGL-KPDTSGWSLF--EQLGRFEKHC-DVKELVSDMLFRWE-SLKS--PRKCNHK---VYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDAYVSLRILPQYLRPTINQNIILK-----YAETIKNLPDFEXXXXXXXXXXXXXXXDPFCAIHFSVSQYSVPIWPTEITVSVNKKGLYFTAKLIGS--ILLFTKFTDIIRISVKPIGFFTMFLKHEQ------YSEMKMYSNVAEDISILIRDYLVDQSILKTR 1810
            T   G  N  +   + Q+    +D      S  W H     S++ +  SL     + +   A+K+F     +   N  +E+ S         +   L Q+ L+  L++ EL+ EIY QL+KQI+          QKY     WQ+L++   +  PQ    + Y+    + +  D  +E G+YAIYCQ+ + RT++   R   PS  EV +++ R          + ++  +G+Y+ V     +T  E ++ +  + G+ KP  SG++LF  +  GR  +HC   +  + D + +WE +LK   P K       V L++K R++           E  LL  Q   +I   R  +T   A E+ AL    E  D        P    PT  Q+++ +     Y    +N    E                   A  ++  Q   P     I ++V +K   F AKL  +    L  K   ++ I+V   G   +  +  Q      YS +  +    +D  ++IR  + DQS  KTR
Sbjct:  786 TVAAGGSNAKVGTVYEQLIGKLMDGEGNPDSPLWRHPMLCYSQEGLCASLTTLPSEALQTEALKLFKSCQLF--INVPVEAAS-------VDYHVSLAQTALQVCLVHPELQSEIYCQLMKQISCRPP------QKYSLMQCWQLLALCAPLFLPQ-HHFLWYVKQQLQRHA-DPRSETGQYAIYCQRAVERTLQTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFANGTYQVVGFDGSSTVDEFLQRLNQETGMRKPSQSGFALFTDDPSGRDLEHCLQGRVKICDAISKWEQTLKELHPGKSEGGTRVVKLMYKNRLYFRSQVKGETERERLLLAFQASGEIVAGRFPVTKELALEMAALMAQVEYGDLEKPTLPGPGGTPPTKAQHLLQQVLDRFYPRRYRNGAPPEQLRHLAD----------MMATKWAALQGCSPPECIRIYLTVARKWPLFGAKLFAAQPAQLSPKENTVVWIAVNEDGVSILDHRTMQVNITYPYSSVTTFGGCRDDFMLVIRS-IPDQSSGKTR 1293          
BLAST of Unconventional myosin-X vs. Ensembl Mouse
Match: Plekhh2 (pleckstrin homology domain containing, family H (with MyTH4 domain) member 2 [Source:MGI Symbol;Acc:MGI:2146813])

HSP 1 Score: 97.0561 bits (240), Expect = 5.412e-20
Identity = 85/319 (26.65%), Postives = 147/319 (46.08%), Query Frame = 2
Query:  329 TTFVGNGNLSINNSHNQVN---LDMTAAIKSKFW-----THSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRR------QCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGL-KPDTSGWSLF--EQLGRFEKHC---DVKELVSDMLFRWESL---KSPRKC--NHKVYLVFKKRIF 1210
            T   G+ N+++ +   Q+    L++     S+ W      HSK+ I   L     + +   A+K+F        C   + +  DS +     +   L QS L+  L + EL++EI  QLIKQ             + WQ+L++   +  P     +  L  H +    DS TE G+YAIYCQ+C+ RT +   R   PS  E+ + + R      +   + ++ ++G Y+ V   + TT  E +  +    G+ KP  SG++LF  +  GR  +HC   ++K  + D++ +WE     + P KC  +  V L +K R++
Sbjct:  914 TVAAGSNNINVGSEFEQLVCKLLNIEGEPSSQIWRHPMLCHSKEGILSPLTTLPSEALQTEAIKLFKT------CQLFINAAVDSPA---IDYHISLAQSALQVCLTHPELQNEICCQLIKQTRRRQLQNQPGPLQGWQLLALCVGLFLPH-HPFLWLLQLHLQR-NADSRTEFGKYAIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSRPFSIPVHFMNGLYQVVGFDASTTVEEFLNTLNQDTGMRKPAQSGFALFTDDPSGRDLEHCLQGNIK--ICDIISKWEQASKEQQPGKCEGSRTVRLTYKNRLY 1219          
BLAST of Unconventional myosin-X vs. Ensembl Mouse
Match: Myo10 (myosin X [Source:MGI Symbol;Acc:MGI:107716])

HSP 1 Score: 89.3521 bits (220), Expect = 1.076e-17
Identity = 89/320 (27.81%), Postives = 146/320 (45.62%), Query Frame = 2
Query:  488 AVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKY-WQILSVVCNVIKPQSQQVICYLDAHFKMYGID-STTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVY-LVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRL--IQENCDAYVSLRILP-----QYLRPTINQN 1417
            A+K+FN L        +LES SD            +IQ +L+       LRDE+Y QLIKQ T+     G     Y WQIL+ +     P S+ ++ YL  H K        TE  +YA++  + L +T     R F+PS  E+ A+I RQ M   +Y   G   K+ + SHTT GE+++ +   + ++   + ++LFE  G+ +K  + + +V+D+L ++E L +  +     +   FK   F +      D +E   +  Q    +              + ALRL  +Q +   + S+  L      Q LR  I+Q+
Sbjct:  827 AIKIFNSLQ-------QLESMSDP---------IPIIQGILQTGHDLRPLRDELYCQLIKQ-TNKVPHPGSVGNLYSWQILTCLSCTFLP-SRGILKYLKFHLKRIREQFPGTEMEKYALFIYESLKKTK---CREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGQVDKAIESRTIVADVLAKFEKLAATSEAGDAPWKFYFKLYCFLDTDSMPKDSVEFAFMFEQAHEAVIHGHHPAPEESLQVLAALRLQYLQGDYTPHTSIPPLEEVYSVQRLRARISQS 1125          
BLAST of Unconventional myosin-X vs. Ensembl Mouse
Match: Myo10 (myosin X [Source:MGI Symbol;Acc:MGI:107716])

HSP 1 Score: 89.3521 bits (220), Expect = 1.167e-17
Identity = 89/320 (27.81%), Postives = 146/320 (45.62%), Query Frame = 2
Query:  488 AVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKY-WQILSVVCNVIKPQSQQVICYLDAHFKMYGID-STTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVY-LVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRL--IQENCDAYVSLRILP-----QYLRPTINQN 1417
            A+K+FN L        +LES SD            +IQ +L+       LRDE+Y QLIKQ T+     G     Y WQIL+ +     P S+ ++ YL  H K        TE  +YA++  + L +T     R F+PS  E+ A+I RQ M   +Y   G   K+ + SHTT GE+++ +   + ++   + ++LFE  G+ +K  + + +V+D+L ++E L +  +     +   FK   F +      D +E   +  Q    +              + ALRL  +Q +   + S+  L      Q LR  I+Q+
Sbjct: 1573 AIKIFNSLQ-------QLESMSDP---------IPIIQGILQTGHDLRPLRDELYCQLIKQ-TNKVPHPGSVGNLYSWQILTCLSCTFLP-SRGILKYLKFHLKRIREQFPGTEMEKYALFIYESLKKTK---CREFVPSRDEIEALIHRQEMTSTVYCHGGGSCKITINSHTTAGEVVEKLIRGLAMEDSRNMFALFEYNGQVDKAIESRTIVADVLAKFEKLAATSEAGDAPWKFYFKLYCFLDTDSMPKDSVEFAFMFEQAHEAVIHGHHPAPEESLQVLAALRLQYLQGDYTPHTSIPPLEEVYSVQRLRARISQS 1871          
BLAST of Unconventional myosin-X vs. UniProt/SwissProt
Match: sp|Q80TI1|PKHH1_MOUSE (Pleckstrin homology domain-containing family H member 1 OS=Mus musculus OX=10090 GN=Plekhh1 PE=1 SV=2)

HSP 1 Score: 107.842 bits (268), Expect = 1.727e-22
Identity = 131/536 (24.44%), Postives = 220/536 (41.04%), Query Frame = 2
Query:  329 TTFVGNGNLSINNSHNQVN---LDMTAAIKSKFWTH-----SKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKY-----WQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQ------CMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGL-KPDTSGWSLF--EQLGRFEKHC-DVKELVSDMLFRWE-SLKS--PRKCNHK---VYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDAYVSLRILPQYLRPTINQNIILK-----YAETIKNLPDFEXXXXXXXXXXXXXXXDPFCAIHFSVSQYSVPIWPTEITVSVNKKGLYFTAKLIGS--ILLFTKFTDIIRISVKPIGFFTMFLKHEQ------YSEMKMYSNVAEDISILIRDYLVDQSILKTR 1810
            T   G  N  +   + Q+    +D      S  W H     S++ +  SL     + +   A+K+F     +   N  +E+ S         +   L Q+ L+  L++ EL+ EIY QL+KQI+          QKY     WQ+L++   +  PQ    + Y+    + +  D  +E G+YAIYCQ+ + RT++   R   PS  EV +++ R          + ++  +G+Y+ V     +T  E ++ +  + G+ KP  SG++LF  +  GR  +HC   +  + D + +WE +LK   P K       V L++K R++           E  LL  Q   +I   R  +T   A E+ AL    E  D        P    PT  Q+++ +     Y    +N    E                   A  ++  Q   P     I ++V +K   F AKL  +    L  K   ++ I+V   G   +  +  Q      YS +  +    +D  ++IR  + DQS  KTR
Sbjct:  786 TVAAGGSNAKVGTVYEQLIGKLMDGEGNPDSPLWRHPMLCYSQEGLCASLTTLPSEALQTEALKLFKSCQLF--INVPVEAAS-------VDYHVSLAQTALQVCLVHPELQSEIYCQLMKQISCRPP------QKYSLMQCWQLLALCAPLFLPQ-HHFLWYVKQQLQRHA-DPRSETGQYAIYCQRAVERTLQTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFANGTYQVVGFDGSSTVDEFLQRLNQETGMRKPSQSGFALFTDDPSGRDLEHCLQGRVKICDAISKWEQTLKELHPGKSEGGTRVVKLMYKNRLYFRSQVKGETERERLLLAFQASGEIVAGRFPVTKELALEMAALMAQVEYGDLEKPTLPGPGGTPPTKAQHLLQQVLDRFYPRRYRNGAPPEQLRHLAD----------MMATKWAALQGCSPPECIRIYLTVARKWPLFGAKLFAAQPAQLSPKENTVVWIAVNEDGVSILDHRTMQVNITYPYSSVTTFGGCRDDFMLVIRS-IPDQSSGKTR 1293          
BLAST of Unconventional myosin-X vs. UniProt/SwissProt
Match: sp|Q8IVE3|PKHH2_HUMAN (Pleckstrin homology domain-containing family H member 2 OS=Homo sapiens OX=9606 GN=PLEKHH2 PE=1 SV=2)

HSP 1 Score: 99.7525 bits (247), Expect = 5.467e-20
Identity = 96/361 (26.59%), Postives = 158/361 (43.77%), Query Frame = 2
Query:  329 TTFVGNGNLSINNSHNQVN---LDMTAAIKSKFW-----THSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQ------CMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGL-KPDTSGWSLF--EQLGRFEKHC---DVKELVSDMLFRWESL---KSPRKC--NHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICAL 1336
            T   G+ N+++ +   Q+    L++     S+ W      HSK+ I   L     + +   A+K+F        C   + +  DS +     +   L QS L+  L + EL++EI  QLIKQ             + WQ+L++   +  P     +  L  H K    DS TE G+YAIYCQ+C+ RT +   R   PS  E+ + + R          + ++ ++G Y+ V   + TT  E +  +    G+ KP  SG++LF  +  GR  +HC   ++K  + D++ +WE     + P KC     V L +K R++           E  LL +Q    I      L  + A E+ AL
Sbjct:  915 TVAAGSNNVNVGSEFEQLVCKLLNIDGEPSSQIWRHPTLCHSKEGIISPLTTLPSEALQTEAIKLFKT------CQLFINAAVDSPA---IDYHISLAQSALQICLTHPELQNEICCQLIKQTRRRQPQNQPGPLQGWQLLALCVGLFLPH-HPFLWLLRLHLKR-NADSRTEFGKYAIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSLPFSIPVHFMNGIYQVVGFDASTTVEEFLNTLNQDTGMRKPAQSGFALFTDDPSGRDLEHCLQGNIK--ICDIISKWEQASKEQQPGKCEGTRTVRLTYKNRLYFSVQARGETDREKLLLMYQTNDQIINGLFPLNKDLALEMAAL 1262          
BLAST of Unconventional myosin-X vs. UniProt/SwissProt
Match: sp|Q8C115|PKHH2_MOUSE (Pleckstrin homology domain-containing family H member 2 OS=Mus musculus OX=10090 GN=Plekhh2 PE=1 SV=3)

HSP 1 Score: 97.0561 bits (240), Expect = 3.786e-19
Identity = 85/319 (26.65%), Postives = 147/319 (46.08%), Query Frame = 2
Query:  329 TTFVGNGNLSINNSHNQVN---LDMTAAIKSKFW-----THSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRR------QCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGL-KPDTSGWSLF--EQLGRFEKHC---DVKELVSDMLFRWESL---KSPRKC--NHKVYLVFKKRIF 1210
            T   G+ N+++ +   Q+    L++     S+ W      HSK+ I   L     + +   A+K+F        C   + +  DS +     +   L QS L+  L + EL++EI  QLIKQ             + WQ+L++   +  P     +  L  H +    DS TE G+YAIYCQ+C+ RT +   R   PS  E+ + + R      +   + ++ ++G Y+ V   + TT  E +  +    G+ KP  SG++LF  +  GR  +HC   ++K  + D++ +WE     + P KC  +  V L +K R++
Sbjct:  914 TVAAGSNNINVGSEFEQLVCKLLNIEGEPSSQIWRHPMLCHSKEGILSPLTTLPSEALQTEAIKLFKT------CQLFINAAVDSPA---IDYHISLAQSALQVCLTHPELQNEICCQLIKQTRRRQLQNQPGPLQGWQLLALCVGLFLPH-HPFLWLLQLHLQR-NADSRTEFGKYAIYCQRCVERTQQNGDREARPSRMEILSTLLRNPYHHSRPFSIPVHFMNGLYQVVGFDASTTVEEFLNTLNQDTGMRKPAQSGFALFTDDPSGRDLEHCLQGNIK--ICDIISKWEQASKEQQPGKCEGSRTVRLTYKNRLY 1219          
BLAST of Unconventional myosin-X vs. UniProt/SwissProt
Match: sp|Q9ULM0|PKHH1_HUMAN (Pleckstrin homology domain-containing family H member 1 OS=Homo sapiens OX=9606 GN=PLEKHH1 PE=2 SV=2)

HSP 1 Score: 93.5893 bits (231), Expect = 3.660e-18
Identity = 98/396 (24.75%), Postives = 167/396 (42.17%), Query Frame = 2
Query:  329 TTFVGNGNLSINNSHNQVN---LDMTAAIKSKFWTH-----SKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKY-----WQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQ------CMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGL-KPDTSGWSLF--EQLGRFEKHC---DVKELVSDMLFRWE-SLKS--PRKCNHK---VYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDAYVSLRILPQYLRPTINQNII 1423
            T   G  +  +  ++ Q+    +D      S  W H     SK  +  SL     + +   A+K+F     +   N  +E+ S         +   L Q+ L+  L++ EL+ EIY QL+KQ +          QKY     WQ+L++   +  PQ    + Y+    + +  D  +E G+YA YCQ+ + RT+    R   PS  EV +++ R          + ++  +G+Y  V     +T  E ++ +  ++G+ KP  SG++LF  +  GR  +HC    VK  + D + +WE ++K   P K       V L++K R++           E  LL  Q   +I   R  +    A E+ AL    E  D        P    P   Q+++
Sbjct:  792 TVAAGGSSAKVGTAYEQLIGKLMDGEGDPDSPLWRHPMLCYSKDGLYASLTTLPSEALQTEALKLFKSCQLF--INVPVEAAS-------VDYHVSLAQTALQVCLVHPELQSEIYCQLMKQTSCR------PPQKYSLMQCWQLLALCAPLFLPQ-HHFLWYVKQQLQRHA-DPRSETGQYATYCQRAVERTLRTGEREARPSRMEVVSILLRNPFHHSLPFSIPVHFTNGTYHVVGFDGSSTVDEFLQRLNQEIGMRKPSHSGFALFTDDPSGRDLEHCLQGSVK--ICDAISKWEQAMKELHPGKSEGGTRVVKLMYKNRLYFRSQVKGETDRERLLLASQTSREIVAGRFPINKELALEMAALMAQVEYGDLEKPALPGPGGTSPAKAQHLL 1168          
BLAST of Unconventional myosin-X vs. UniProt/SwissProt
Match: sp|Q00IB7|PKHH1_DANRE (Pleckstrin homology domain-containing family H member 1 OS=Danio rerio OX=7955 GN=plekhh1 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.164e-17
Identity = 90/340 (26.47%), Postives = 153/340 (45.00%), Query Frame = 2
Query:  386 LDMTAAIKSKFWTH-----SKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQI---TDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQ------CMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGL-KPDTSGWSLF--EQLGRFEKHC-DVKELVSDMLFRWE-SLKS--PRK--CNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICAL 1336
            LD+     S  W       SK+ +R  L     + +   A+K+F     +   N  +ES S         + T L Q+ L+  L + EL++E+Y QLIKQ    T +N  +     + WQ+LS+   +  PQ    + YL  + +    D  TE G+YA+YCQ+ + RT++   R   PS  E+ +++ R          + ++ ++ +Y  V     TT  E +  V  + G+ KP  SG++LF  +  G+  +HC      + D++ +WE +LK   P K      V L +K R+            E  LL +Q   ++ +    ++   A E+ AL
Sbjct:  878 LDVDGVSDSALWKREVLCFSKEGLRYPLTTLPSEALQTEAIKLFKSCQLF--INVLVESPS-------IDYHTSLAQNALQVCLTHPELQNEMYCQLIKQTNCRTPHNYAL----TQCWQLLSLCVALFLPQ-HHFLWYLRQYLQR-NADPRTEVGKYAVYCQRSVERTLQNGEREAKPSRMEILSILLRNPYHHSLPFSIPVHFMNNTYEVVGFDGSTTVEEFLNTVNQRTGMRKPQISGFALFTDDPSGKDLEHCLQPANKICDVISKWEQALKELHPGKYEGTRTVRLTYKSRLCFRAQAKGETERERLLLAYQVNDEVLQGHFPVSKELALEVAAL 1202          
BLAST of Unconventional myosin-X vs. TrEMBL
Match: A0A2C9KE43 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106055370 PE=3 SV=1)

HSP 1 Score: 253.062 bits (645), Expect = 7.065e-67
Identity = 172/558 (30.82%), Postives = 294/558 (52.69%), Query Frame = 2
Query:  134 SNWMQQANQRLLLRMARFTEEDRLRLQESIHQCRQALLLTNQVSL-VQSHNSGIFRSFKRLKRRNETTFVGNGNLSINNSHNQVNLDMTAAIKSKFWTHSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQE-------NCDAYVSLRILPQYLRPTINQNIILKYAETIKNLPDFEXXXXXXXXXXXXXXXDPFCAIHFSVSQYSVPIWPTEITVSVNKKGLYFTAKLIGSILLFTKFTDIIRISVKPIGFFTMFLKHEQYSEMKMYSNVAEDISILIRDYL 1783
            ++WM+  N  +  +M + ++ED+L+L E + +CR+AL  T  +    Q   SG  R+   L+R  ++      +LS +++     LD        FW+++K  I+QSL       ++++AVKMFN ++ YA        G +   +     ++ ++Q L++K L    + +E Y+QL+KQ TD+ D     N + WQ+++V  + + P + +V  Y+  H K   +D+TTEEG+YA +  KCLNRT EK  R F PS KE++AVI+R+ +  +++ L+G  R +E  S  T GE+IK VK+K+G++ D   ++++E +G  E+     E +SD + +WE L S       + LVFKK +F + + + +D +E DLL +Q I D+FE R+ ++  +A  +CAL++  E       + D    +RILP+ +R T+    +   A T K + D       L  + L K    F A  F VSQ      P  + + V+++G+Y       SIL    +++I+  S        +     +  +    +N A  IS LI+DY+
Sbjct: 1729 ASWMKSDNDSMKKQM-KMSDEDKLKLYEELVRCRKALSETRLLQRPAQDFGSGFLRN--TLRRLTKSKLDKLRSLSSSDASTNFGLD--------FWSYTKTVIKQSLTIIHDPSLEESAVKMFNQILIYA--------GIEEAENTNEAEKSNMVQQLMQKCLESDFICNEFYMQLVKQTTDHPDPNSTVNCRSWQLMAVTTSTLAPANMRVHKYVQCHLKKCSMDTTTEEGKYARFSLKCLNRTAEKKRRKFAPSLKEIHAVIQRKPITQKVFFLNGEQRIIEFDSAGTCGEVIKTVKTKIGMRSDAECFAIYEMMGTSERAMTSDERLSDTVSKWERL-SRSGAIRDLKLVFKKHLFIDPYINTSDPVECDLLFNQLIEDVFEQRIPISHKEAVHLCALKVQSEIEDMKSGDIDYTSVMRILPRDMRCTVRPEEV---ATTHKTVLDISPHQAILSFINLLKNWSLFGATVFEVSQTYTSTLPKVLLLGVHQRGIYLLEVSSFSILSSFTYSEIVHASPAIKSIMIVIGNMAKGIKFMFNTNQAHQISQLIKDYM 2263          

HSP 2 Score: 75.0998 bits (183), Expect = 6.535e-10
Identity = 70/248 (28.23%), Postives = 116/248 (46.77%), Query Frame = 2
Query:  593 LIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFS-HTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWE---------------SLKSPRKC--NHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDI 1282
            +IQ +++  +   ELRDEI +QL++Q  DN +      ++ W IL  +C      S+ +  YL ++ K    D     GRYA+ C K L       +R   PST E+ +V     +  +++ +DG  + V + S  TT   LIK+ K ++GL+    GW+L+E     E+     E ++D+L +WE               S K P+         L+F+KR++       ND IE  LL  + +  +
Sbjct: 1303 IIQMVIKTGIDRIELRDEILIQLLRQTNDNPE--PEALKQAW-ILMCLCTAAFSPSKNLHKYLLSYVKRCCSDPVG--GRYAMTCYKQLT-VPRATTRKLPPSTVEILSVHNLSPIVCKVFFMDGKTKAVSLNSVDTTQDVLIKVAK-RIGLQ-SVEGWALYEANKDTERFIRSYEYIADILAQWEGADHLSIQPTKYETVSRKGPKLALGGSDSKLLFRKRVYRHVHDIPNDPIEYHLLYAEAVHKV 1542          
BLAST of Unconventional myosin-X vs. TrEMBL
Match: A0A2T7NZI1 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_14247 PE=3 SV=1)

HSP 1 Score: 248.054 bits (632), Expect = 3.066e-65
Identity = 169/553 (30.56%), Postives = 287/553 (51.90%), Query Frame = 2
Query:  173 RMARFTEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSGIFRSFKRLKRRNETTFVGNGNLSINNS-----HNQVNLDMTAAIKSKFWTHSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQL---GRFE-KHCDVKELVSDMLFRWESLKSPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQ--ENCDA----YVS-LRILPQYLRPTINQNIILKYAETIKNLPDFEXXXXXXXXXXXXXXXDPFCAIHFSVSQYSVPIWPTEITVSVNKKGLYFTAKLIGSILLFTKFTDIIRISVKPIGFFTMFLKHEQYSEMKMYSNVAEDISILIRDYL 1783
            +M + T++++L+L E I +CR+AL  +              R  +R  +   T F+ N    +  S      +  + D  +     FW++SK P+RQSL        ++ AVKMF+ ++ Y+     +E   D+D      H T ++Q++++K L    L +E YLQL+KQ TD+ D     N++ WQ+LSV C  + P   +V  Y+  H K   +D+T+EEG++A +  KCLNRT EK  R F PS +E+  VI+R+ +  RI+ L+G  R VE  S  T GE+IKI+++K+G++ D  G+ ++E +     F  +   V E +SD + +WE L S      + +L F+KR+F E + D ND +E DL+ HQ I D+FE+R+ +T   A ++CAL++    E+C +    Y S LRILP+ +R  I    I+    T   L D   +      + + ++   F A  F VSQ      P  + ++V+++G+         +L    +++++  S        +     + ++    +N A  I+ L++DY+
Sbjct: 1542 KMMKLTDDEKLKLYEEIVRCRKALAES--------------RILQRPPQEGSTGFIRNTLRRLTKSKLDRLRSYASSDAGSNFGVDFWSYSKTPLRQSLTIVHNPAHEETAVKMFSCILIYS----GIEESVDTDED----HVT-MMQNVMQKCLENDLLCNEFYLQLVKQTTDHPDPNSLVNRRSWQLLSVACATLPPVHTRVHKYVQVHLKKCAMDTTSEEGKFARFSLKCLNRTGEKKRRKFPPSVREIQCVIQRKLITQRIFFLNGDQRVVEFDSAATCGEVIKIIQAKIGMRSDAEGFGIYEVMTSSASFTCRGMGVDERMSDTISKWERL-SRSGAVQEFHLTFRKRLFIEPYVDYNDPVECDLVFHQLIQDVFEERIPITPTHAVQLCALKIQSEMEDCKSGDINYSSVLRILPRPMRGYIRLEDIVTVHRT---LLDLSPQQAVTSFISVLQEWPLFGATIFPVSQTYTSSMPKNLLLAVHQRGISLLELHTYRLLSSFGYSEVVHSSPAIKSIMIVIGNMAKGTKFMFNTNEASQIAHLVKDYM 2067          
BLAST of Unconventional myosin-X vs. TrEMBL
Match: V3ZQG6 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_119149 PE=3 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 6.782e-58
Identity = 158/542 (29.15%), Postives = 274/542 (50.55%), Query Frame = 2
Query:  134 SNWMQQANQRLLLRMARFTEEDRLRLQESIHQCRQAL----LLTNQVSLVQSHNSGIFR-SFKRLKRRNETTFVGNGNLSINNSHNQVNLDMTAAIKSKFWTHSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESL-KSPRKCN-------------HKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDAYVS----------LRILPQYLRPTINQNIILKYAETIKNLPDFEXXXXXXXXXXXXXXXDPFCAIHFSVSQYSVPIWPTEITVSVNKKGLYFTAKLIGSILLFTKFTDIIRIS 1672
            ++WM+   + L  +  + ++E++L+L E + +CR+ L    LL   ++   + ++G F+ + +RL +             ++   N    D T      +W+++K PI+QSL       +++ A+KMF  ++ Y       ESG+++D+       T +IQ ++ K L    + +E YLQLIKQ TD+ D     N++ WQ+++V  N++ P + +V  YL  H K   +DSTTEEG+YA Y  KCL+RT+EK  R F PST+EV  VI R+ +  +++ + G  R +E  S  +  E+ K +K+K+G++ D   ++L+E +   E+     E +SD L +WE L +S    N             +  Y + +KR+F E + + ND +E DL+ +Q I  +FE R+ L++  A  +CA ++  E  D               RILP+ +RPT+    I   A T K + D   +   L  +   K    F A  F + Q    + P  + ++V++KG++        +L    ++DI   S
Sbjct: 1521 ASWMKADYESL--KKIKMSDEEKLKLYEELVRCRKLLSESRLLQRPIT---TADTGFFKNTLRRLTKSK-----------MDRLRNYAAGD-TGQFDVNYWSYTKLPIKQSLTLIHDPAMEEVAIKMFTSILIYTGYE---ESGNNNDN----YDHTGMIQIVMTKCLESDHVCNEFYLQLIKQTTDHPDPNSYVNKRSWQLMAVTTNILPPPNTRVQKYLQVHLKKCSMDSTTEEGKYARYSYKCLSRTLEKKRRKFPPSTREVECVIHRKPITEKVFFMTGESRVIEFDSAASCTEVNKTIKAKIGMRSDAECFALYELMSGSERAMATDERLSDTLSKWERLSRSGAMANAAFSLHTAWINMPYIYYFILQKRLFIEPYINPNDPVECDLVFNQLIESVFEQRVPLSMQDAVHLCAFKVQSEIEDMKTGDIDYRLVDSVTRILPRDMRPTVK---IEDIATTHKTILDLSPQQAVLGFINTLKSWHLFGAAVFEIGQTYTSMLPKNLLLAVHQKGIHLLETKTFKVLGAYPYSDIAHSS 2035          

HSP 2 Score: 71.2478 bits (173), Expect = 8.512e-9
Identity = 67/282 (23.76%), Postives = 134/282 (47.52%), Query Frame = 2
Query:  551 SDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEK-ISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWE---------------SLKSPRKC--NHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFE-DRLKLTINQAAEICALR 1339
            +  DSS+  T   ++I++ LE++    ELRDEI+ QLI+Q  +N +    + ++ W ++ +      P S+ +  Y+ ++ K    D     G+YA+     L  TI +  SR +  S+ E+ +V     +  +++ +DG  + V +    T  ++++ V  K+GLK    GW+++E    +E+     E ++D++ +WE               S K P+         ++F+KR++       ND IE  LL  + +  + + D   ++   A ++  L+
Sbjct: 1087 AKEDSSV--TTIQHIIKTGLERI----ELRDEIFCQLIRQTNENPE--PESLRQAWVLMCLFSASFAP-SKNLHKYMLSYVKKSCFDKNV--GKYALMTHNHL--TIPRATSRKYPASSIEIMSVQSLAPIVCKVFFMDGKTKAVSMMPCDTATDVLEKVARKIGLK-SVEGWAIYELTNEYERFIRSYEYIADIMAQWELQDRVAAKPSHYETISKKGPKLALGGADAKIMFRKRVYKHVHDIPNDPIEYHLLYAEAVYKVVKMDEFSISDKVALQLAGLQ 1354          
BLAST of Unconventional myosin-X vs. TrEMBL
Match: A0A0L8GYK6 (Uncharacterized protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22025704mg PE=4 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 4.792e-55
Identity = 159/559 (28.44%), Postives = 287/559 (51.34%), Query Frame = 2
Query:  182 RFTEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSG-IFRSFKRLKRRNETTFVGNGNLSINNSHNQVNLDMTAAIKSKFWTHSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESL-KSPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDA------YVS-LRILPQYLRPTINQNIILKYAETIKNLPDFEXXXXXXXXXXXXXXXDPFCAIHFSVSQYSVPIWPTEITVSVNKKGLYFTAKLIGSILLFTKFTDIIRISVKPIGFFTMFLKHEQYSEMKMYSNVAEDISILIRDYLVDQSILKTRTPSFSSS 1831
            R ++E++L+L E + + R+ L+ +N +           FRS   L++  +T        +  + H Q N        + +W +SK P +Q+++    + +++ A+K+ + ++ +A            DS         LIQ+ +++ +    L DE+YLQ IKQ TD+ +     N++ WQILS++ + + P +  +  YL  H +   +D++T+EG++A +  K L R +EK  R   PS KE+  + +R+ +  RIY L+G  R VE  S  T GE+IK VK+K+G++ D   ++L+E +G  E++   +E +SD + +WE L K+    + K  LVFKKR+F + + + ND +E DL+ HQ + D+FE R+ ++   A  +CAL+L  EN D       Y S +RILP+ +RP +    + +     K L D   +   +  ++L K    F +  F VSQ      P  + ++V++ G++F       ++    ++++   S        +     + S+    +N A  IS LI+DY+ +   L+ R+ S  +S
Sbjct:  776 RMSDEEKLKLYEEVVRTRRKLVESNILQRPSPEGGANFFRS--TLRKLTKTKMEYLRQYAEASGHEQFN--------AGYWAYSKVPPKQAMMIFKEQLLEEMALKLTSSVLAFAGVE---------DSICDINEMIELIQTFIQRCMECVFLCDELYLQAIKQTTDHPEPNSNVNRRNWQILSILTSTLCPNNIVIQKYLQVHLRKCCMDTSTDEGKFARFAYKSLTRILEKKVRKLPPSCKEIYCIAQRKPITERIYFLNGEQRMVEFDSAATCGEIIKTVKAKIGMRSDAECFALYEYIGTTERNMSSEERLSDTVSKWERLIKTSASRDPK--LVFKKRLFIDPYTNINDAVECDLVFHQLVEDVFEQRIPISSQDAVRLCALKLQSENEDIKRGETDYSSVMRILPRDMRPQVK---VEEIQAAYKMLNDVSPQQAIMSFIQLLKVWPLFGSTVFEVSQSYTSSLPKTLLLAVHQHGIHFLELKSFKVISSFSYSEVAHSSPSLTSIMIVIGHVAKGSKYMFNTNQATQISQLIKDYVEE---LRYRSVSMQAS 1307          

HSP 2 Score: 83.9593 bits (206), Expect = 9.798e-13
Identity = 72/267 (26.97%), Postives = 123/267 (46.07%), Query Frame = 2
Query:  593 LIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLK----SPRKCN------HKVYL-------VFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFE-DRLKLTINQAAEICALR 1339
             +Q+ +   L   ELRDE+Y Q+++Q   N D       K W ++S  C+     S+ +  YL ++ K +  D T   G+YA  C   L R    ++R F PS  E+ +V     +  +I+ +DG  + V      T  E++  V  K+GL+    GW+L+E     E+     E V+D+L +WE  K    +P K +      +K+ L       VF+KR++        D +E  LL  + +  + E D   ++   A ++  L+
Sbjct:  335 FLQNFVRYGLERIELRDELYCQIVRQTHRNPDTDALI--KAWGVMSF-CSAAFSASKTLQKYLVSYVKKHIGDETV--GKYAKICYSQL-RKPRVMARKFPPSASEILSVQSLSPLVCKIHFMDGKTKAVHAMPCDTTAEILDKVAHKIGLQ-SVEGWALYEVTAEHERFIRGYEYVADILAQWEQQKHLTNTPNKSDSLSKKGNKIVLDGSDCRFVFRKRVYRHVHDIPKDPVEYHLLFAEAVHKVVELDEFSVSEKVALQLAGLQ 594          
BLAST of Unconventional myosin-X vs. TrEMBL
Match: A0A146LC81 (Unconventionnal myosin-X OS=Lygus hesperus OX=30085 GN=MYO10 PE=3 SV=1)

HSP 1 Score: 217.238 bits (552), Expect = 5.776e-55
Identity = 163/600 (27.17%), Postives = 295/600 (49.17%), Query Frame = 2
Query:  134 SNWMQQANQRLLLRMARFTEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSGIFR-SFKRLKR-RNETTFVGNGNLSINNSHNQVNLDMTAAIKSKFWTHSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWE---------SLKSPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDA--------YVSLRILPQYLRPTINQNIILKYAETIKNLPDFEXXXXXXXXXXXXXXXDPFCAIHFSVSQYSVPIWPTEITVSVNKKGLYFTAKLIGSILLFTKFTDIIRISVKPIGFFTMFLKHEQYSEMKMYSNVAEDISILIRDYLVDQSILKTRTPSFSSSEKANYGKSEADNKRP 1876
            SNW+ +      + +   T EDR+RL +S+  CR+AL+  + +   Q    G  R + +RL R R +     +G+   N ++            + FW+ S+  + QS+ K    D D+ A++MF+I++TYA     L    D+   ++  H   LIQ+++E+ +    L  E+YLQLIKQ TD+ D     N ++W +LS+ C+V+ P  + +  YL AH K    D  TEEG+YA + +KCL++T     R + PS +E+   I R+ +  + + +DG Y  VE     T  +++++V+ K+GL+    G++++E LG  E+    +E V+D++ +WE          +K+ RK +H  + +FKK +F +++ D +D +E +LL HQ +  +  DR  +T  +A  + AL+   E  D          V+   LP  L P + Q  I  + ++++ +   E K   L +++         A  F V Q     WP  + ++V++ G++       + L   ++  I+  S        +    ++ S++ + ++ A  I+ LI++Y     +L+  TP      + N  K      RP
Sbjct: 1235 SNWITENE----VPVKAITNEDRIRLYQSVISCRRALVDADILRKPQDSAGGFIRNTLRRLSRHRLDKLRAEHGSFDPNETYK--------GFSTGFWSFSRTLLAQSISKLPEPD-DQIALQMFHIVLTYA----GLGQNGDAVRRVEDEH-VNLIQNIMERAMRKDTLLGELYLQLIKQTTDHPDPNSRVNLRHWALLSLACSVVLPPQRAIRKYLIAHLKRCSGDCITEEGKYARFAEKCLHKTQGTRRRQWPPSKEEIMCTINRRPIYAKFHFMDGQYHAVEFHPSATAKDVMELVRDKIGLREGAMGYAIYEVLGNSERSLVAEEKVADIMSKWERYRNSNNQQQVKTSRKPHH--FFLFKKHLFLDQYMDLDDPVEKELLYHQVLHSLRADRFPVTEKEAMMLAALQAQVELGDCTSNDMDYRAVASHCLPSRLVPNLPQEGITLHHQSLQGMTSPEAKKAFLNLIRSWPLHR---ATIFDVMQSFTSNWPRVLWLAVDQVGMHLLEHRSRNALCSYEYESILSYSPALNCLMIITGSEKKQSKVILTTSQAFQIATLIKEY---TEVLQ--TPQDVRRREVNGKKKAGHTSRP 1806          

HSP 2 Score: 78.5666 bits (192), Expect = 5.091e-11
Identity = 63/278 (22.66%), Postives = 121/278 (43.53%), Query Frame = 2
Query:  581 HQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQS---QQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLN--RTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKS------------PRKCNHKVY-------LVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFE-DRLKLTINQAAEICALR 1339
            H+   IQ ++   L   ELRDEI++Q I+QIT+N       +++ W +L +     +P     +  IC+L  + +         EG+   Y Q C+     +    R + PS+ E+ A+ R   +  R + LDG  + ++V    T  +    +  K+GLK    GW++++     E+H      + D++  WE  ++             R+ N            +FK+R+F        D +E+++L  Q +  + + D   ++   A ++  L+
Sbjct:  802 HEVQAIQQIVGAGLEREELRDEIFVQCIRQITNNPS--PEQSERLWLLLCLTVVAFQPSKLLFKYFICFLKKNLQC--------EGKLRQYVQWCIENCNNVRASCRQYPPSSVEIAAMRRLGTIVCRFFFLDGRTKAIDVHPTDTAADASAKLADKLGLK-HLDGWAIYQSRPDGEEHVRAHHYLYDIIAEWEIKQNNLNAGTNSFPTVTRRSNSTTLGGCGENRFIFKRRLFRNTREISQDPVEINMLYAQAVHSVVKCDDFPVSEKVAVQLAGLQ 1068          
BLAST of Unconventional myosin-X vs. Ensembl Cavefish
Match: myo10 (myosin X [Source:ZFIN;Acc:ZDB-GENE-070912-277])

HSP 1 Score: 94.3597 bits (233), Expect = 3.248e-19
Identity = 68/225 (30.22%), Postives = 111/225 (49.33%), Query Frame = 2
Query:  488 AVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFK-MYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKS 1159
            A+K+F+IL        +LE  +D            +IQ LL+       LRDE+Y QLIKQ T      G  +   W+I+S +C    P S+ ++ YL  H K    +   TE  RYA + Q  L     + S   +PS +E+ A++ RQ M   +Y   G   K+ + SHTT GE++  +   + ++   + ++LFE     +K  + + +V+D+L ++E L S
Sbjct: 1545 ALKLFSILQ-------QLEGVTDP---------VPVIQGLLQTGQDLRPLRDELYCQLIKQTTRPPQPGGPAHVNGWRIISCMCCTFSPSSRSILKYLKFHLKRTRELYPGTEMERYATFSQDALRHVRVRES---VPSREELRAILSRQEMTSTVYCHGGGSCKITINSHTTAGEVVDKLLKGLAMEDSRNMFALFEHNDTTDKAIEGRAIVADVLAKFEKLAS 1750          
BLAST of Unconventional myosin-X vs. Ensembl Cavefish
Match: plekhh1 (pleckstrin homology domain-containing family H member 1 [Source:NCBI gene;Acc:103044638])

HSP 1 Score: 93.2041 bits (230), Expect = 5.323e-19
Identity = 88/348 (25.29%), Postives = 158/348 (45.40%), Query Frame = 2
Query:  386 LDMTAAIKSKFWTH-----SKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQI---TDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQ------CMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGL-KPDTSGWSLF--EQLGRFEKHC-DVKELVSDMLFRWE-SLKSPRKCNHK----VYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCD 1360
            LD+     S  W H     S+  ++  L     + +   A+K+F     +   N  +E+ S         + T L QS L+  L + EL++E+Y QLIKQ    T NN  +     + WQ+LSV   +  PQ  + + YL  + +    D  +E G+YA+YCQ+ + R ++   R   PS  E+ +++ R          + ++ ++ +Y+ V     TT  E +  +  + G+ KP  SG++LF  +  G+  +HC      + D++ +WE +LK  +   ++    V L +K R++           E  LL +Q   ++ +    +    A E+ AL    E+ D
Sbjct:  881 LDVDGDSDSPLWKHEVLCYSRDGLQSPLTTLPSEALQTEALKLFKSFQLF--INVLVEAPS-------IDYHTSLAQSALQVCLTHPELQNEMYCQLIKQTNCRTPNNYSL----TQCWQLLSVCVALFLPQ-HRFLWYLRQYLQR-NADPKSEVGKYAVYCQRSVERALQNGEREAKPSRMEIMSILLRNPYHHSLPFSIPVHFMNNTYQVVGFDGSTTVEEFVNTLNQRAGMRKPQLSGFALFTDDPSGKDLEHCLQPAAKICDVISKWEQALKELQPGKYEGTRIVRLTYKSRLWFRAQAKGETERERLLLAYQVNEEVHQGHFPVNKELALEVAALMAQVEHGD 1213          
BLAST of Unconventional myosin-X vs. Ensembl Cavefish
Match: si:ch211-18i17.2 (pleckstrin homology, MyTH4 and FERM domain containing H3 [Source:HGNC Symbol;Acc:HGNC:26105])

HSP 1 Score: 92.4337 bits (228), Expect = 7.809e-19
Identity = 90/338 (26.63%), Postives = 148/338 (43.79%), Query Frame = 2
Query:  476 IDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQ-----KYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWE-SLKSPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRL--IQENCDAYVSLRILPQ-YLRPTINQNIILKYAETIKNLPDF 1462
            + + AV++FN L        +LES         A     LIQ +L+  L    LRDE+Y Q IKQ +          Q     +YWQ+L+ +     P S  V+ YL  H K+  +   TE   YA +  + L +T     R  +PS +E+  ++ RQ M   ++       ++ + SHTT  EL++ +  ++GL+   + ++LFEQ    E+      +++D++ R+E S+K P   + +  L FK     +      D IE   L  QC   +   +L    +    + ALRL  +Q +  A      L Q +    +    +L  AE     P F
Sbjct:  248 VREEAVRLFNCLQ-------QLES---------APEPVPLIQGILQTGLDLRPLRDELYCQTIKQTSITPKRTQTQTQPNPQLRYWQLLTCMSCTFLPSSS-VLRYLRFHLKVQSVSVDTEVESYAWFIAQALEKTR---CRECVPSWEEIQGLMGRQEMLCTVHYPGPGCCRIAISSHTTANELVRKMAERLGLQDSPNTFALFEQKACRERVIGGGTIIADVITRFELSVKEP---DSEWRLCFKLYCLLDTDNISTDSIEYLFLYEQCHEMVVRGQLPACEDDLLSLAALRLQAVQGDYSALAPFPALEQVFPARVLEARALLTPAEPQGCPPPF 562          
BLAST of Unconventional myosin-X vs. Ensembl Cavefish
Match: plekhh1 (pleckstrin homology domain-containing family H member 1 [Source:NCBI gene;Acc:103044638])

HSP 1 Score: 88.5817 bits (218), Expect = 1.722e-17
Identity = 85/340 (25.00%), Postives = 153/340 (45.00%), Query Frame = 2
Query:  386 LDMTAAIKSKFWTH-----SKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQI---TDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQ------CMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGL-KPDTSGWSLF--EQLGRFEKHC-DVKELVSDMLFRWE-SLKSPRKCNHK----VYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICAL 1336
            LD+     S  W H     S+  ++  L     + +   A+K+F     +   N  +E+ S         + T L QS L+  L + EL++E+Y QLIKQ    T NN  +     + WQ+LSV   +  PQ  + + YL  + +        E G+YA+YCQ+ + R ++   R   PS  E+ +++ R          + ++ ++ +Y+ V     TT  E +  +  + G+ KP  SG++LF  +  G+  +HC      + D++ +WE +LK  +   ++    V L +K R++           E  LL +Q   ++ +    +    A E+ AL
Sbjct:  775 LDVDGDSDSPLWKHEVLCYSRDGLQSPLTTLPSEALQTEALKLFKSFQLF--INVLVEAPS-------IDYHTSLAQSALQVCLTHPELQNEMYCQLIKQTNCRTPNNYSL----TQCWQLLSVCVALFLPQ-HRFLWYLRQYLQRNA--DPNEVGKYAVYCQRSVERALQNGEREAKPSRMEIMSILLRNPYHHSLPFSIPVHFMNNTYQVVGFDGSTTVEEFVNTLNQRAGMRKPQLSGFALFTDDPSGKDLEHCLQPAAKICDVISKWEQALKELQPGKYEGTRIVRLTYKSRLWFRAQAKGETERERLLLAYQVNEEVHQGHFPVNKELALEVAAL 1098          
BLAST of Unconventional myosin-X vs. Ensembl Cavefish
Match: plekhh2 (pleckstrin homology, MyTH4 and FERM domain containing H2 [Source:NCBI gene;Acc:103031122])

HSP 1 Score: 84.7297 bits (208), Expect = 2.729e-16
Identity = 89/339 (26.25%), Postives = 148/339 (43.66%), Query Frame = 2
Query:  380 VNLDMTAAIKSKFWTH-----SKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQ------CMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGL-KPDTSGWSLF--EQLGRFEKHCDVKEL-VSDMLFRWE----SLKSPRKCNHK-VYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICAL 1336
            +N+D  +   S+ W H     SK+ +   L     + +   A+K+F     + +           D+     H T L Q  L+  L + EL++EIY QLIKQ             + WQ L++   +  PQ   ++  L  H K +  DS TE G+YAIYCQ+   RT +K  R   PS  E+ +++ R          L ++ L+ +Y+ V   + TT  E    +    G+ K   SG+SL+  +  G+  +H     L + D++ +WE     L + +  N + V L +K R++  +        E  LL +Q   +I      +    A E+ AL
Sbjct:  841 LNIDGDSG--SQIWRHPMLCFSKEGLTSPLTTLPSQALQTEAIKLFKTCQLFINVTI--------DTPAIDYHVT-LAQCALQVCLTHPELQNEIYCQLIKQTRRRQPHGQPGPLQGWQFLALCVGLFLPQ-HPILWLLQVHLKKHA-DSRTEVGKYAIYCQRSAERTQQKGDRQARPSRMEILSILLRNPYHHSLPFSLPVHFLNNTYQVVSFDASTTVEEFQTRLNQDTGMRKTGQSGFSLYSDDPTGQNLEHYLQGSLKICDIISKWEQACKELHTGKSENTRTVKLTYKNRLYFSQQLRGETERERLLLAYQTNEEIVAGHFPVNKELALEMSAL 1166          
BLAST of Unconventional myosin-X vs. Ensembl Sea Lamprey
Match: myo10l1 (myosin X, like 1 [Source:ZFIN;Acc:ZDB-GENE-080425-1])

HSP 1 Score: 86.2705 bits (212), Expect = 1.970e-17
Identity = 67/260 (25.77%), Postives = 119/260 (45.77%), Query Frame = 2
Query:  593 LIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGID-STTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWE---------SLKSPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRL 1342
            + Q +L+       L DE+Y QL+KQ +     +G    + W + + +     P  + V+ Y+  H K        TE  +YA +    L +T  K+ R FIPS +E+ A++ RQ M   IY   G   K+ + SHTT GE++  +   + ++   + +SLFE+ G+ EK  + + +V D+L ++E         + + P   ++   L FK   F +  +  +D +E   +  Q    +             ++ ALRL
Sbjct: 1564 IYQGVLQTCHDLRPLHDELYCQLVKQTSFAPQPLGTGGLRTWHLFACLSCTFPP-GRAVLRYVRFHLKRVKDRFPGTETEQYASFILDSLKKT--KL-REFIPSQEEIQAIVSRQEMTTTIYCHGGGSCKITIDSHTTAGEVVAKLMRGLAMEGSRNTFSLFERRGKMEKALENRTIVVDVLAKFEKYAVCSSNLAKQLPNSSSNSWRLYFKLYCFLDTGHVPSDSVEFAFMFEQAHEGLVRGHFPAPEETLQQLAALRL 1819          
BLAST of Unconventional myosin-X vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005652.1 (pep scaffold:Pmarinus_7.0:GL476764:51710:82461:1 gene:ENSPMAG00000005087.1 transcript:ENSPMAT00000005652.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.2478 bits (173), Expect = 7.333e-13
Identity = 68/265 (25.66%), Postives = 110/265 (41.51%), Query Frame = 2
Query:  587 TYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDS-----TTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKSPR--------KCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRL 1342
            T ++Q +L+       LRDE+Y QL+KQ      + G T    W +L+       P S  V+ YL  H +   I +       E  RY  +    L     K+ R  +PS  E+ A+   Q +   I+   G    + + SH T GE++  +   + ++   S ++LFE     E+  +   L+ D L R+E L + R        K   K+YLV    +  E      D IE+  +  Q    +   R  ++      + ALRL
Sbjct:  945 TPMVQGILQTCWDLLPLRDELYCQLVKQTMTWEGVDGPT--MVWHLLACTSCTFAP-SHAVLRYLHLHLRRMTIRALERSRDQELCRYVAFTWTALQC---KLCRQSVPSRDEIRALAEGQEISTTIFCHGGGSCPISITSHVTAGEVVARLLRGLRMEGSCSKFALFECGPDGERAIEENALLVDSLARFERLAATREGVDKNQWKIFFKLYLVLDTAVAPE------DSIEMAFMFEQAHDSMARGRFPVSGETLQWMAALRL 1197          
BLAST of Unconventional myosin-X vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009214.1 (pep scaffold:Pmarinus_7.0:GL476487:47743:102157:1 gene:ENSPMAG00000008327.1 transcript:ENSPMAT00000009214.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 8.222e-10
Identity = 54/214 (25.23%), Postives = 101/214 (47.20%), Query Frame = 2
Query:  407 KSKFWTHSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSY-RKVEVFSHTTNGELIKIVKSKVGL 1045
            K K  T   + ++ +   S     +K AV+ F  +M +             D  LK   +   + SLL+      E+RDEIY  ++KQIT N      +  + W++L +V    K  S  +  YL  + +    DS       A  C++ L RT++   R  +PS+ E+ A++  +  K ++ LL G+  R V++ ++++  ++I+ +  ++GL
Sbjct:   25 KEKAPTDPSEMVKYTKSPSQDPKFNKLAVEAFLAVMKFM-----------GDYPLKGQGEVDSVFSLLKFSENQPEMRDEIYCHIVKQITSNKSPKPDSCHRGWRLLYIVTAYSK-CSDNLKPYLLRYLREVANDSKASFQGMARVCEQHLRRTLQVGGRTQLPSSMELKALVAGRNSKRQLILLPGAIERHVKIKTNSSAMDVIEEICQEMGL 226          
BLAST of Unconventional myosin-X vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009212.1 (pep scaffold:Pmarinus_7.0:GL476487:37771:103167:1 gene:ENSPMAG00000008327.1 transcript:ENSPMAT00000009212.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.077 bits (144), Expect = 1.402e-9
Identity = 54/214 (25.23%), Postives = 101/214 (47.20%), Query Frame = 2
Query:  407 KSKFWTHSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSY-RKVEVFSHTTNGELIKIVKSKVGL 1045
            K K  T   + ++ +   S     +K AV+ F  +M +             D  LK   +   + SLL+      E+RDEIY  ++KQIT N      +  + W++L +V    K  S  +  YL  + +    DS       A  C++ L RT++   R  +PS+ E+ A++  +  K ++ LL G+  R V++ ++++  ++I+ +  ++GL
Sbjct:  303 KEKAPTDPSEMVKYTKSPSQDPKFNKLAVEAFLAVMKFM-----------GDYPLKGQGEVDSVFSLLKFSENQPEMRDEIYCHIVKQITSNKSPKPDSCHRGWRLLYIVTAYSK-CSDNLKPYLLRYLREVANDSKASFQGMARVCEQHLRRTLQVGGRTQLPSSMELKALVAGRNSKRQLILLPGAIERHVKIKTNSSAMDVIEEICQEMGL 504          
BLAST of Unconventional myosin-X vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009216.1 (pep scaffold:Pmarinus_7.0:GL476487:51634:103169:1 gene:ENSPMAG00000008327.1 transcript:ENSPMAT00000009216.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 7.485e-9
Identity = 39/140 (27.86%), Postives = 75/140 (53.57%), Query Frame = 2
Query:  629 SELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSY-RKVEVFSHTTNGELIKIVKSKVGL 1045
             E+RDEIY  ++KQIT N      +  + W++L +V    K  S  +  YL  + +    DS       A  C++ L RT++   R  +PS+ E+ A++  +  K ++ LL G+  R V++ ++++  ++I+ +  ++GL
Sbjct:   17 PEMRDEIYCHIVKQITSNKSPKPDSCHRGWRLLYIVTAYSK-CSDNLKPYLLRYLREVANDSKASFQGMARVCEQHLRRTLQVGGRTQLPSSMELKALVAGRNSKRQLILLPGAIERHVKIKTNSSAMDVIEEICQEMGL 155          
BLAST of Unconventional myosin-X vs. Ensembl Nematostella
Match: EDO44785 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUQ0])

HSP 1 Score: 87.0409 bits (214), Expect = 1.860e-17
Identity = 69/253 (27.27%), Postives = 122/253 (48.22%), Query Frame = 2
Query:  593 LIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKM-YGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKS--PRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRL 1342
            +IQ +L+       LRDE++ QLIKQ T    +    N +  Q+L  +C    P +++ + YL +H K     +S +E  ++A +  +C  R      R F PS +E+ +++ R+ +   ++   G   K+ + S TT GE+ + +   + LK   + +SLFEQ G  EK+ + + +++D+L ++E  K+    +  HK  L FK   F +     N+ +E   L  Q    I   +          + ALRL
Sbjct: 1208 VIQGILQTCQDLKPLRDEVFCQLIKQTTSPPGVDSIGNLRNMQVLVCMCCTFIP-TRKYLRYLRSHLKRSRDKNSESEMAKFATFALECAKRAR---PREFPPSREEIISLLGRRELSAVVHCYGGGSCKITINSATTAGEVTERLCKGLNLKEGFNIFSLFEQCGNTEKNIEARTVLADVLSKFERYKALGLTEAGHKWKLFFKIFCFLDPGKVPNETVESGFLFEQACDAILRGKYPAPETTLYLLAALRL 1456          
BLAST of Unconventional myosin-X vs. Ensembl Nematostella
Match: EDO43015 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZW1])

HSP 1 Score: 84.3445 bits (207), Expect = 8.885e-17
Identity = 85/327 (25.99%), Postives = 158/327 (48.32%), Query Frame = 2
Query:  422 THSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNN-DLVGGTNQKY---WQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRR-----QC-MKLRIYLLDGSYRKV-EVF---SHTTNGELIKIVKSKVGLKPDT-SGWSLF--EQLGRFEKHCDVKELVSDMLFRWE-SLKS--PRKCNHK--VYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICAL 1336
            T S++PI   L      +++K A+++F  ++ +          +D ++     +   L Q+ L+ V    EL++EIY QL+KQ +    DL       Y   WQ+L++  ++  P+ Q  + YL AH K    +  T+ G+YAIYC K L RTI    R   PS  EV +V+ +      C M L ++ +  ++  + +VF     TT  E  + + S +G++  + SG+++F    +   E        + D++ +WE +++S    K + K  + L ++ R++ +   DK    E   L +Q   ++ + R  ++ + A E+ AL
Sbjct:  243 TFSREPITTPLTTLPSPELEKEALELFKSILLFTTV------ATDENA---IDYHVALAQNALQVVFDNPELQNEIYCQLVKQTSKQTIDLRPVQEYVYLQTWQLLAMCTSLFVPK-QHFLVYLRAHLKR-SCNPKTKHGKYAIYCVKSLERTIANGKREARPSRMEVLSVLVQNPYDHSCRMSLPVHFIFDTFSDIYQVFGLDGSTTVEEFTEAINSTLGIREASQSGFAIFTDNPVSPVEHCLQASVKLCDVISKWEQAMRSNGQGKLDSKRLIKLTYRNRLYFKSLQDKETEKEKYFLVYQTNINVVKGRFPVSHDMAIELAAL 558          
BLAST of Unconventional myosin-X vs. Ensembl Nematostella
Match: EDO35247 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM15])

HSP 1 Score: 75.485 bits (184), Expect = 1.836e-15
Identity = 62/220 (28.18%), Postives = 115/220 (52.27%), Query Frame = 2
Query:  638 RDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLF----EQLGRFEKHCD-VKELVSDMLFRWESLKSPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDI 1282
            RDEIY QL KQ+ +N  +   + ++ W ++ ++C V  P S Q + YL    K + +   TE    A +C   L RT+E+ +R   PS  E+ A  R + + L + L+DG+    EV +++T  EL + ++ K+GLK    G+S++    +Q+  +    + V + VS +  R+   K   + + K++   +K IF   +  ++D +E +L+  Q +  +
Sbjct:    1 RDEIYCQLCKQLVNNPSMT--STRRGWILMGILCGVFPP-SDQFLNYL----KNFILTEATEH--VAEFCISRLRRTVERTNRKQPPSWIEMQASRRAENIVLPVTLMDGATLDCEVDANSTFKELCESIREKLGLK-SIYGFSIYIAAVDQIFNWGSDDENVMDAVS-LAERYSVRKGNPESDTKLHFYLRKNIFRPSYSPEDDPLEANLVFAQLMGGL 209          
BLAST of Unconventional myosin-X vs. Ensembl Nematostella
Match: EDO35658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKY6])

HSP 1 Score: 67.3958 bits (163), Expect = 1.812e-11
Identity = 77/262 (29.39%), Postives = 120/262 (45.80%), Query Frame = 2
Query:  542 ESGSDSD------SSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEG--RYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDV---KELVSDMLFRWESL---KSPRKCNHKVYLVFKKRIFDEKWYDKN-DHIEVDLLTHQCISDI 1282
            ESG+ SD      +  K T     +  ++   +L  ELRDEIY Q+ KQ+T N      ++ + W +LS+      P S++ + YL    K         EG   YA YC++ L RT +   R   PS  E+ A   ++ + L I  +DG+ + +   S TT  EL   +  K+ L  D  G+SL+  L  F+K   +    + V D + + E     +  ++ N    L F+K IF   W+D   D I  +L+  Q I  I
Sbjct:  875 ESGTLSDGYGPLSAQDKPTTNLEKLHFIIGHGILRKELRDEIYCQICKQLTGNPSKT--SHARGWILLSLCLGCFAP-SEKFVKYLWCFIK---------EGPPGYAPYCEERLRRTQQNGCRHQPPSWLELQATKSKKPLMLPITFMDGTTKTLLADSATTARELCTQLADKISLL-DQFGFSLYIAL--FDKVSSLGSGSDHVMDAISQCEQYAKEQGAQERNAPWRLFFRKEIF-SPWHDPTMDKIGTNLIYQQVIRGI 1120          

HSP 2 Score: 67.0106 bits (162), Expect = 2.966e-11
Identity = 89/385 (23.12%), Postives = 158/385 (41.04%), Query Frame = 2
Query:  566 SLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKL--RIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQL---------GRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDAYVSLRILPQYLRPTINQNIILKYAE---------TIKNLPDFEXXXXXXXXXXXXXXXDPFCAIHFSVSQYSVPIWPTEITVSVNKKGLYFTAKLIGSILLFTKFTDI 1660
            S ++   T L  ++ E  LL+  LRDE+Y QLIKQIT+N   +  +  + W++L  +C  I   S  ++  ++  F+     S          C   L +TI    R + P   EV A I+ Q  ++  ++Y  D S +  EV S T   E   I+  ++GLK    G+SLF ++         G F    D    +++ L +    K  R  N    + F K+++      K+   +     HQ +        K    +AA++ AL    +  +     + +P+ ++  I  +++ + +               P        +  LK+  +   F +  F V Q + P +P  + +++NK G+         IL    FT I
Sbjct: 1487 SKRSRQATDLTDAIFESALLHEPLRDEVYCQLIKQITENR--LPSSFDRGWELL-WLCTGIFACSAVLLREVNQIFR-----SWVSRQPLGHDCLARLQKTIRVGQRKYPPHIVEVEA-IQHQTTQIFHKVYFPDDSDQAFEVDSGTKAKEFCNIIAQRLGLK-SAEGFSLFVKITDKVISVPEGDF--FFDFVRHLTEWLKKAGPTKDGRTPNLTYQVFFMKKLWTNTVVGKDPAADCIFHYHQELPKYLRGYHKCIKEEAAQLAALIYRVKFGEDKSQFQNIPRMVKELIPHDLVKQMSPDEWKRAIVAQFNKHPGRTKSEAKISFLKIIYRWPTFGSAFFEVKQGTEPNFPDNLLIAINKSGVNLINPQTKEILATYPFTKI 1859          
BLAST of Unconventional myosin-X vs. Ensembl Nematostella
Match: EDO35783 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKK1])

HSP 1 Score: 46.9802 bits (110), Expect = 4.197e-6
Identity = 33/122 (27.05%), Postives = 60/122 (49.18%), Query Frame = 2
Query:  428 SKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHF 793
            SK PI++ L+  + + + K AV +F +++ Y           D    +K T    L   +  +      +RDEIYLQ+ KQ TDN +    + ++ W+++S +C  + P S +   YL+ + 
Sbjct:   24 SKVPIKKPLILMSDRQLKKDAVDVFKLILGYM---------GDRPIRVKTTRDIAL--DICTRGWETPLIRDEIYLQICKQTTDNGN--SESLRRGWELMS-ICLTLFPPSTKFHSYLEGYI 131          
BLAST of Unconventional myosin-X vs. Ensembl Medaka
Match: plekhh1 (pleckstrin homology, MyTH4 and FERM domain containing H1 [Source:NCBI gene;Acc:101165607])

HSP 1 Score: 98.5969 bits (244), Expect = 1.247e-20
Identity = 99/372 (26.61%), Postives = 168/372 (45.16%), Query Frame = 2
Query:  329 TTFVGNG-NLSINNSHNQVN---LDMTAAIKSKFWTH-----SKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQI----TDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQ------CMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGL-KPDTSGWSLF--EQLGRFEKHC-DVKELVSDMLFRWE-SLKS--PRK--CNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCD 1360
            T   G G N  +   + Q+    LD      S  WT      SK+ +R  L     + +   A+K+F     +   N  +ES S         + T L Q+ L+  L + EL++E+Y QLIKQ       N+ L      + WQ+LS+   +  PQ Q  + YL  + ++   D+ TE G+YA+YCQ+ L RT++   R   PS  E+ +++ R          + ++ ++ +Y+ V     T   E +  +  ++ + KP  +G++L   +  G+  +HC    + + D++ +WE +LK   P K      V L  KKR+F           E  LL +Q  +D+ + R  +    A E+ AL    E+ D
Sbjct:  695 TVAAGCGANFRVGTEYEQLIGKLLDADGDPDSPLWTSDALSFSKEGLRSPLTTLPSEALQTEALKLFKSCQLF--INVLVESPS-------VDYHTSLAQNALQVCLTHPELQNEMYCQLIKQTHRRTPHNHSLT-----QCWQLLSLCAALFLPQ-QHFLWYLREYLQL-NADTRTEVGKYAVYCQRSLERTLQNGEREARPSRMEIISILLRNPYHHSLPFSIPVHFMNNTYQVVGFDGSTIVEEFLNTLNQRIAMRKPQLTGFALVTDDPSGKDLEHCLQPTDKICDVISKWEQALKEMHPGKNEGTRIVRLTCKKRLFFRSQVKGETERERLLLAYQVNADVQQGRFPVNKELALEVAALMAKVEHGD 1050          
BLAST of Unconventional myosin-X vs. Ensembl Medaka
Match: si:ch211-18i17.2 (pleckstrin homology, MyTH4 and FERM domain containing H3 [Source:NCBI gene;Acc:101172661])

HSP 1 Score: 89.3521 bits (220), Expect = 6.485e-18
Identity = 74/289 (25.61%), Postives = 130/289 (44.98%), Query Frame = 2
Query:  476 IDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRL 1342
            + + AV++FN L        +LES  D            +IQ +L+  L    LRDE+Y QL+KQ +         + +YWQ+L+ +     P    V+ YL  H K       +E   YA +  + L++T     R  +PS +E+  ++ RQ M   ++       ++ + SHTT  E+++ ++ K+GL+   + ++L+EQ   +E+      L++D+L R++      +   +  L FK     +      D IE   L  QC   +   +L         + ALRL
Sbjct:  207 VREEAVRIFNCLQ-------QLESVRDP---------VPIIQGVLQTCLDLRPLRDEVYCQLVKQTSHTPSPYTAAHLRYWQLLTCMSCTFLP-GPTVLKYLRFHLKTQSQSPESEMDNYASFISEALDKTK---CRECVPSWEEIQMLMSRQEMLCTVHYPGPGSCQLYISSHTTANEVVRRMQEKLGLQDSKNTFALYEQNALWEQPVAGSALIADILTRFKFTTKESESKSQWKLCFKLYCLLDADNISVDSIEYLFLFEQCHDMVVRGQLPACEEDLQALAALRL 475          
BLAST of Unconventional myosin-X vs. Ensembl Medaka
Match: ENSORLT00000020820.2 (unconventional myosin-X [Source:NCBI gene;Acc:101172290])

HSP 1 Score: 85.5001 bits (210), Expect = 1.468e-16
Identity = 65/224 (29.02%), Postives = 112/224 (50.00%), Query Frame = 2
Query:  488 AVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGID--STTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESL 1153
            AVK+FN L        ++E+ SD            +IQ +L+       LRDE+Y QLIKQ           N+ +W +L+ +     P S+ ++ YL  H K Y  +    TE   +A +  + L +T    +R F+PS +E+ A++ RQ M   +Y   G   K+ + SHTT GE+++ +   + ++   + ++LFE     +K  + + LV+D+L ++E L
Sbjct: 1493 AVKIFNSLQ-------EMEAVSDP---------VPIIQGILQTCQDLRPLRDEVYCQLIKQTNHVPHPNSLANRAHWHLLTCMSCTFLP-SRGILRYLKFHLKRYTWELFPGTEIEMFAHFIGESLKKTK---TREFVPSQEEIMALLTRQEMTTTVYCHGGGSCKISINSHTTAGEVVEKLIRGLAMEDSRNMFALFEHKNTLDKAVESRVLVADVLAKFERL 1696          
BLAST of Unconventional myosin-X vs. Ensembl Medaka
Match: plekhh2 (pleckstrin homology, MyTH4 and FERM domain containing H2 [Source:NCBI gene;Acc:101155790])

HSP 1 Score: 83.5741 bits (205), Expect = 5.341e-16
Identity = 89/376 (23.67%), Postives = 166/376 (44.15%), Query Frame = 2
Query:  179 ARFTEEDRLR-LQESIHQCRQALLLTNQVSLVQSHNSGIFRSFKRLKRRNE-TTFVGNGNLSINNSHNQVNLDMTAAIK----------SKFWTH-----SKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQ------CMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGL-KPDTSGWSLF--EQLGRFEKHCDVKEL-VSDMLFRW-----ESLKSPRKCNHKVYLVFKKRIF 1210
            AR  E DR R L + + +C ++L     +  +   + G+  ++  ++ RNE  +++ + +++   +  +V  +    +           S+ W H     SK+ +   L     + +   AVK+F        C   +    D+ +     +   L QS L+  L + EL++EI+ QLIKQ             + WQ L++   +  PQ       L  H + +G DS TE G+YAIYCQ+ + RT  +  R   PS  E+ +++ R          + ++ L+ +Y+ V   + TT  E    +    G+ K   SG++L+  +  GR  +HC    + + D++ +W     E+L +       V L +K R++
Sbjct:  804 ARVEEVDRSRGLDDILKECGRSLQSAPFILSIHPQDQGL--TYLLVESRNEKESWLYHLSVAAGTTVGKVGTEFEQLVGKLFQEDGDPNSQIWNHPMLVFSKEALLSPLTTLPSQALQTEAVKLFKT------CQLFINVAIDAPA---IDYHVSLAQSALQVCLAHPELQNEIFCQLIKQTRKRQPHAQPGPLQGWQFLALCVGLFLPQ-HPFFWLLQVHLQKHG-DSRTEVGKYAIYCQRSMERTQLRGGRQARPSRMEILSILLRNPYHHSLPFSVPVHFLNNTYQVVSFDASTTVDEFQCRLNLDTGMRKTGLSGFALYTDDPSGRELEHCVQGGIKICDIISKWEQASKENLSAKSDTTRSVRLTYKNRLY 1166          
BLAST of Unconventional myosin-X vs. Ensembl Medaka
Match: myo10 (myosin X [Source:NCBI gene;Acc:101167072])

HSP 1 Score: 79.337 bits (194), Expect = 9.971e-15
Identity = 66/252 (26.19%), Postives = 113/252 (44.84%), Query Frame = 2
Query:  593 LIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFK-MYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLK-SPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRL 1342
            +IQ +L+       LRDE+Y QLIKQ           N   W+IL+ +     P S+ ++ YL  H +    +   TE  RYA +    L +T     R  +PS +E+  ++ R  M   ++   G   K+ + SHTT GE+++ +   + ++   + ++LFE     EK  + + +V+D+L ++E L  SP + N      FK   F +      D +E   +  Q    +   +          + ALRL
Sbjct: 1114 IIQGILQTGQELKPLRDELYCQLIKQTARPPQPDSAGNLCKWKILACMSCTFVP-SRSILRYLKFHLRRTRELFPGTEMDRYAAFALDSLKKTR---CRENVPSHEEIRCIVARHDMSTTVHCHGGGSCKITINSHTTAGEVVEKLIRGLAMENSRNMFALFEHNDATEKAIESRTVVADVLAKFEKLSASPEENNTGWKFYFKLYCFLDTESVPKDSVEFAFMFEQAHEAVIRAQYPAPEETLQFLAALRL 1361          
BLAST of Unconventional myosin-X vs. Planmine SMEST
Match: SMESG000078081.1 (SMESG000078081.1)

HSP 1 Score: 1407.51 bits (3642), Expect = 0.000e+0
Identity = 697/699 (99.71%), Postives = 699/699 (100.00%), Query Frame = 2
Query:   35 MMPENRESLSLANNSENINRSLMQCEEVNVSKKSNWMQQANQRLLLRMARFTEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSGIFRSFKRLKRRNETTFVGNGNLSINNSHNQVNLDMTAAIKSKFWTHSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDAYVSLRILPQYLRPTINQNIILKYAETIKNLPDFEXXXXXXXXXXXXXXXDPFCAIHFSVSQYSVPIWPTEITVSVNKKGLYFTAKLIGSILLFTKFTDIIRISVKPIGFFTMFLKHEQYSEMKMYSNVAEDISILIRDYLVDQSILKTRTPSFSSSEKANYGKSEADNKRPNNDCDLSTYSIDNIPNPVNGANFKCKPDSKDAFIDYDDGEKRLQNMRYLKEYFDSFSLQSDEIFDLRESPQSLPFEIQNLNIDRD 2131
            MMPENRESLSLANNSENINRSLMQCEEVNVSKKSNWMQQANQRLLLRMARFTEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSGIFRSFKRLKRRNETTFVGNGNLSINNSHNQVNLDMTAAIKSKFWTHSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVYL+FKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDAYVSLRILPQYLRPTINQNIILKYAETIKNLPDFELKNCNLKILKLCKKCDPFCAIHFSVSQYSVPIWPTEITVSVNKKGLYFTAKLIGSILLFTKFTDIIRISVKPIGFFTMFLKHEQ+SEMKMYSNVAEDISILIRDYLVDQSILKTRTPSFSSSEKANYGKSEADNKRPNNDCDLSTYSIDNIPNPVNGANFKCKPDSKDAFIDYDDGEKRLQNMRYLKEYFDSFSLQSDEIFDLRESPQSLPFEIQNLNIDRD
Sbjct:    1 MMPENRESLSLANNSENINRSLMQCEEVNVSKKSNWMQQANQRLLLRMARFTEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSGIFRSFKRLKRRNETTFVGNGNLSINNSHNQVNLDMTAAIKSKFWTHSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVYLIFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDAYVSLRILPQYLRPTINQNIILKYAETIKNLPDFELKNCNLKILKLCKKCDPFCAIHFSVSQYSVPIWPTEITVSVNKKGLYFTAKLIGSILLFTKFTDIIRISVKPIGFFTMFLKHEQHSEMKMYSNVAEDISILIRDYLVDQSILKTRTPSFSSSEKANYGKSEADNKRPNNDCDLSTYSIDNIPNPVNGANFKCKPDSKDAFIDYDDGEKRLQNMRYLKEYFDSFSLQSDEIFDLRESPQSLPFEIQNLNIDRD 699          
BLAST of Unconventional myosin-X vs. Planmine SMEST
Match: SMESG000078081.1 (SMESG000078081.1)

HSP 1 Score: 1404.42 bits (3634), Expect = 0.000e+0
Identity = 696/698 (99.71%), Postives = 698/698 (100.00%), Query Frame = 2
Query:   38 MPENRESLSLANNSENINRSLMQCEEVNVSKKSNWMQQANQRLLLRMARFTEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSGIFRSFKRLKRRNETTFVGNGNLSINNSHNQVNLDMTAAIKSKFWTHSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVYLVFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDAYVSLRILPQYLRPTINQNIILKYAETIKNLPDFEXXXXXXXXXXXXXXXDPFCAIHFSVSQYSVPIWPTEITVSVNKKGLYFTAKLIGSILLFTKFTDIIRISVKPIGFFTMFLKHEQYSEMKMYSNVAEDISILIRDYLVDQSILKTRTPSFSSSEKANYGKSEADNKRPNNDCDLSTYSIDNIPNPVNGANFKCKPDSKDAFIDYDDGEKRLQNMRYLKEYFDSFSLQSDEIFDLRESPQSLPFEIQNLNIDRD 2131
            MPENRESLSLANNSENINRSLMQCEEVNVSKKSNWMQQANQRLLLRMARFTEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSGIFRSFKRLKRRNETTFVGNGNLSINNSHNQVNLDMTAAIKSKFWTHSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVYL+FKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDAYVSLRILPQYLRPTINQNIILKYAETIKNLPDFELKNCNLKILKLCKKCDPFCAIHFSVSQYSVPIWPTEITVSVNKKGLYFTAKLIGSILLFTKFTDIIRISVKPIGFFTMFLKHEQ+SEMKMYSNVAEDISILIRDYLVDQSILKTRTPSFSSSEKANYGKSEADNKRPNNDCDLSTYSIDNIPNPVNGANFKCKPDSKDAFIDYDDGEKRLQNMRYLKEYFDSFSLQSDEIFDLRESPQSLPFEIQNLNIDRD
Sbjct:    1 MPENRESLSLANNSENINRSLMQCEEVNVSKKSNWMQQANQRLLLRMARFTEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSGIFRSFKRLKRRNETTFVGNGNLSINNSHNQVNLDMTAAIKSKFWTHSKKPIRQSLVKSTRKDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVYLIFKKRIFDEKWYDKNDHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDAYVSLRILPQYLRPTINQNIILKYAETIKNLPDFELKNCNLKILKLCKKCDPFCAIHFSVSQYSVPIWPTEITVSVNKKGLYFTAKLIGSILLFTKFTDIIRISVKPIGFFTMFLKHEQHSEMKMYSNVAEDISILIRDYLVDQSILKTRTPSFSSSEKANYGKSEADNKRPNNDCDLSTYSIDNIPNPVNGANFKCKPDSKDAFIDYDDGEKRLQNMRYLKEYFDSFSLQSDEIFDLRESPQSLPFEIQNLNIDRD 698          
BLAST of Unconventional myosin-X vs. Planmine SMEST
Match: SMESG000078081.1 (SMESG000078081.1)

HSP 1 Score: 187.193 bits (474), Expect = 3.640e-56
Identity = 91/91 (100.00%), Postives = 91/91 (100.00%), Query Frame = 2
Query:   35 MMPENRESLSLANNSENINRSLMQCEEVNVSKKSNWMQQANQRLLLRMARFTEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSGIFRSFK 307
            MMPENRESLSLANNSENINRSLMQCEEVNVSKKSNWMQQANQRLLLRMARFTEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSGIFRSFK
Sbjct:    1 MMPENRESLSLANNSENINRSLMQCEEVNVSKKSNWMQQANQRLLLRMARFTEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSGIFRSFK 91          

HSP 2 Score: 51.9878 bits (123), Expect = 3.640e-56
Identity = 25/26 (96.15%), Postives = 25/26 (96.15%), Query Frame = 3
Query:  303 SKDLNEEMKRLLSEMAIYQSTTAITK 380
            S DLNEEMKRLLSEMAIYQSTTAITK
Sbjct:   92 SSDLNEEMKRLLSEMAIYQSTTAITK 117          
BLAST of Unconventional myosin-X vs. Planmine SMEST
Match: SMESG000078081.1 (SMESG000078081.1)

HSP 1 Score: 184.882 bits (468), Expect = 1.865e-55
Identity = 90/90 (100.00%), Postives = 90/90 (100.00%), Query Frame = 2
Query:   38 MPENRESLSLANNSENINRSLMQCEEVNVSKKSNWMQQANQRLLLRMARFTEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSGIFRSFK 307
            MPENRESLSLANNSENINRSLMQCEEVNVSKKSNWMQQANQRLLLRMARFTEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSGIFRSFK
Sbjct:    1 MPENRESLSLANNSENINRSLMQCEEVNVSKKSNWMQQANQRLLLRMARFTEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSGIFRSFK 90          

HSP 2 Score: 51.9878 bits (123), Expect = 1.865e-55
Identity = 25/26 (96.15%), Postives = 25/26 (96.15%), Query Frame = 3
Query:  303 SKDLNEEMKRLLSEMAIYQSTTAITK 380
            S DLNEEMKRLLSEMAIYQSTTAITK
Sbjct:   91 SSDLNEEMKRLLSEMAIYQSTTAITK 116          
BLAST of Unconventional myosin-X vs. Planmine SMEST
Match: SMESG000005090.1 (SMESG000005090.1)

HSP 1 Score: 70.4774 bits (171), Expect = 4.403e-12
Identity = 104/437 (23.80%), Postives = 192/437 (43.94%), Query Frame = 2
Query:  386 LDMTAAIKSKFWTHSKKPIRQSLVKSTR--KDIDKAAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSELRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLDAHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQCMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQLGRFEKHCDVKELVSDMLF-------RWESLKSPRKCNHKVYLVFKKRIFDEK--WYDKNDHIE--VDLLTH--QCISDIFEDRLKLTINQAAEICALRLIQENCDAYVS----------LRILP----QYLRPTINQNIILKYAETIKNLPDFEXXXXXXXXXXXXXXXDPFCAIHFSVSQYSVPIWPTEITVSVNKKGLYF 1609
            + +   + S  W HS++ ++  L+K     +D+ + AV  F+ ++ Y             D   K    T +++S+ +  L +  L+DE+Y QLI QIT N +    + +  W+++ +   ++ P S      L+           +     A+ CQ  L +T++   R + P   E+NAV   + ++ +IY  + S +  E+ S+T   +L + + SK+GLK D  G++LF  +   +K   + E   D  F        W     P K      L F  ++F  K  W +    ++   D+L H  Q +        K+ I  A  + AL +++ +CD  VS          L I P    +Y +  + Q ++ +Y  + +++ D + K   LKI+        F +  F V Q +    P +I +++NK G+Y 
Sbjct: 1705 MSLGKQVASNLWQHSRQLLKLPLLKKLLNKEDLCQQAVSCFSAILIYM-----------GDQPSKNYSSTEIVESIFDPCLKHEILKDEVYCQLITQITSNPN--PQSEKAGWELIWLATGIMVPNSNLYRELLEVF--------RSASSLLALECQTRLQKTLKMGQRRYPPHAIEINAVQMGKLIQHKIYFPNESVQAFEITSNTKCKDLCQNICSKIGLK-DYKGFALF--VKSIDKAISMPE--GDFFFDFIRQLSDWVKKHRPVKDGQ---LEFAYQVFFMKKLWTNTVPGLDQVADILFHYPQEVRKYLYGYHKVVIKDAIILGAL-ILRAHCDKDVSKLQSYIESLDLLIPPDVLNRYPQTELQQKVLAQYHLS-RSMSDNDAKIAFLKIIFQWPT---FGSAFFEVKQSTNVNVPEKILIAINKNGVYL 2107          
The following BLAST results are available for this feature:
BLAST of Unconventional myosin-X vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLEKHH21.138e-2026.59pleckstrin homology, MyTH4 and FERM domain contain... [more]
PLEKHH17.622e-1924.75pleckstrin homology, MyTH4 and FERM domain contain... [more]
MYO101.362e-1630.97myosin X [Source:HGNC Symbol;Acc:HGNC:7593][more]
MYO101.372e-1630.97myosin X [Source:HGNC Symbol;Acc:HGNC:7593][more]
MYO101.639e-1630.97myosin X [Source:HGNC Symbol;Acc:HGNC:7593][more]
back to top
BLAST of Unconventional myosin-X vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
hum-63.128e-1129.27Unconventional myosin heavy chain 6 [Source:UniPr... [more]
max-12.119e-824.85Motor AXon guidance [Source:UniProtKB/TrEMBL;Acc:... [more]
max-12.142e-824.85Motor AXon guidance [Source:UniProtKB/TrEMBL;Acc:... [more]
back to top
BLAST of Unconventional myosin-X vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Myo81F5.112e-4727.62gene:FBgn0267431 transcript:FBtr0392909[more]
ck1.634e-1226.15gene:FBgn0000317 transcript:FBtr0080724[more]
ck1.634e-1226.15gene:FBgn0000317 transcript:FBtr0343687[more]
ck1.634e-1226.15gene:FBgn0000317 transcript:FBtr0343686[more]
ck1.634e-1226.15gene:FBgn0000317 transcript:FBtr0080723[more]
back to top
BLAST of Unconventional myosin-X vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo103.140e-2127.20myosin X [Source:ZFIN;Acc:ZDB-GENE-070912-277][more]
CR392032.23.621e-2127.20myosin X [Source:NCBI gene;Acc:569779][more]
myo103.710e-2127.20myosin X [Source:ZFIN;Acc:ZDB-GENE-070912-277][more]
CR392032.23.843e-2127.20myosin X [Source:NCBI gene;Acc:569779][more]
CR392032.23.960e-2127.20myosin X [Source:NCBI gene;Acc:569779][more]
back to top
BLAST of Unconventional myosin-X vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLEKHH28.680e-2227.90pleckstrin homology, MyTH4 and FERM domain contain... [more]
PLEKHH21.150e-2127.56pleckstrin homology, MyTH4 and FERM domain contain... [more]
PLEKHH21.710e-2127.56pleckstrin homology, MyTH4 and FERM domain contain... [more]
PLEKHH21.992e-2127.90pleckstrin homology, MyTH4 and FERM domain contain... [more]
PLEKHH22.146e-2127.90pleckstrin homology, MyTH4 and FERM domain contain... [more]
back to top
BLAST of Unconventional myosin-X vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plekhh12.468e-2324.44pleckstrin homology domain containing, family H (w... [more]
Plekhh12.468e-2324.44pleckstrin homology domain containing, family H (w... [more]
Plekhh25.412e-2026.65pleckstrin homology domain containing, family H (w... [more]
Myo101.076e-1727.81myosin X [Source:MGI Symbol;Acc:MGI:107716][more]
Myo101.167e-1727.81myosin X [Source:MGI Symbol;Acc:MGI:107716][more]
back to top
BLAST of Unconventional myosin-X vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q80TI1|PKHH1_MOUSE1.727e-2224.44Pleckstrin homology domain-containing family H mem... [more]
sp|Q8IVE3|PKHH2_HUMAN5.467e-2026.59Pleckstrin homology domain-containing family H mem... [more]
sp|Q8C115|PKHH2_MOUSE3.786e-1926.65Pleckstrin homology domain-containing family H mem... [more]
sp|Q9ULM0|PKHH1_HUMAN3.660e-1824.75Pleckstrin homology domain-containing family H mem... [more]
sp|Q00IB7|PKHH1_DANRE1.164e-1726.47Pleckstrin homology domain-containing family H mem... [more]
back to top
BLAST of Unconventional myosin-X vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9KE437.065e-6730.82Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2T7NZI13.066e-6530.56Uncharacterized protein OS=Pomacea canaliculata OX... [more]
V3ZQG66.782e-5829.15Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
A0A0L8GYK64.792e-5528.44Uncharacterized protein OS=Octopus bimaculoides OX... [more]
A0A146LC815.776e-5527.17Unconventionnal myosin-X OS=Lygus hesperus OX=3008... [more]
back to top
BLAST of Unconventional myosin-X vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo103.248e-1930.22myosin X [Source:ZFIN;Acc:ZDB-GENE-070912-277][more]
plekhh15.323e-1925.29pleckstrin homology domain-containing family H mem... [more]
si:ch211-18i17.27.809e-1926.63pleckstrin homology, MyTH4 and FERM domain contain... [more]
plekhh11.722e-1725.00pleckstrin homology domain-containing family H mem... [more]
plekhh22.729e-1626.25pleckstrin homology, MyTH4 and FERM domain contain... [more]
back to top
BLAST of Unconventional myosin-X vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo10l11.970e-1725.77myosin X, like 1 [Source:ZFIN;Acc:ZDB-GENE-080425-... [more]
ENSPMAT00000005652.17.333e-1325.66pep scaffold:Pmarinus_7.0:GL476764:51710:82461:1 g... [more]
ENSPMAT00000009214.18.222e-1025.23pep scaffold:Pmarinus_7.0:GL476487:47743:102157:1 ... [more]
ENSPMAT00000009212.11.402e-925.23pep scaffold:Pmarinus_7.0:GL476487:37771:103167:1 ... [more]
ENSPMAT00000009216.17.485e-927.86pep scaffold:Pmarinus_7.0:GL476487:51634:103169:1 ... [more]
back to top
BLAST of Unconventional myosin-X vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Unconventional myosin-X vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO447851.860e-1727.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430158.885e-1725.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352471.836e-1528.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356581.812e-1129.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357834.197e-627.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Unconventional myosin-X vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plekhh11.247e-2026.61pleckstrin homology, MyTH4 and FERM domain contain... [more]
si:ch211-18i17.26.485e-1825.61pleckstrin homology, MyTH4 and FERM domain contain... [more]
ENSORLT00000020820.21.468e-1629.02unconventional myosin-X [Source:NCBI gene;Acc:1011... [more]
plekhh25.341e-1623.67pleckstrin homology, MyTH4 and FERM domain contain... [more]
myo109.971e-1526.19myosin X [Source:NCBI gene;Acc:101167072][more]
back to top
BLAST of Unconventional myosin-X vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000078081.10.000e+099.71SMESG000078081.1[more]
SMESG000078081.10.000e+099.71SMESG000078081.1[more]
SMESG000078081.13.640e-56100.00SMESG000078081.1[more]
SMESG000078081.11.865e-55100.00SMESG000078081.1[more]
SMESG000005090.14.403e-1223.80SMESG000005090.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021314 ID=SMED30021314|Name=Unconventional myosin-X|organism=Schmidtea mediterranea sexual|type=transcript|length=2328bp
AAACAGTTTTGCCAAAGAATTTTAATCAATAATAATGATGCCAGAAAATC
GAGAATCTTTATCGCTAGCAAATAATTCGGAAAATATAAACCGATCCTTG
ATGCAATGTGAAGAAGTAAATGTTTCTAAAAAGAGCAACTGGATGCAACA
GGCTAATCAAAGACTTTTATTAAGAATGGCACGATTTACTGAAGAAGACC
GATTACGGCTACAAGAAAGTATTCATCAGTGCAGACAAGCCTTATTATTG
ACTAACCAAGTTTCTCTAGTTCAGTCTCATAATTCAGGAATCTTCAGATC
TTTCAAAAGACTTAAACGAAGAAATGAAACGACTTTTGTCGGAAATGGCA
ATTTATCAATCAACAACAGCCATAACCAAGTGAATTTAGACATGACGGCC
GCCATTAAATCCAAATTTTGGACGCATTCGAAAAAACCTATCCGCCAGTC
CTTAGTTAAATCAACACGGAAAGACATAGACAAAGCAGCTGTAAAAATGT
TTAATATCCTGATGACATATGCTCATTGTAACTTCAAATTAGAATCAGGA
AGTGATAGTGACTCCTCTTTAAAGGCAACGCATCAAACATATTTAATACA
GTCTCTTTTAGAGAAAGTATTGTTGTATTCCGAATTGAGAGATGAGATAT
ATTTACAGCTTATCAAACAAATAACGGATAATAATGATCTTGTTGGTGGT
ACAAATCAAAAATATTGGCAGATTCTATCCGTTGTGTGCAACGTTATCAA
GCCACAGTCTCAGCAAGTTATATGCTATTTAGACGCTCATTTTAAAATGT
ACGGAATTGATTCAACAACCGAAGAAGGAAGATATGCGATTTATTGCCAA
AAATGTCTCAATCGAACTATTGAAAAAATCAGCAGAGTATTTATTCCTTC
GACAAAAGAAGTCAATGCTGTCATTCGAAGGCAGTGCATGAAATTAAGAA
TTTATTTGCTGGACGGATCGTATCGTAAAGTTGAAGTATTTTCCCACACA
ACGAATGGAGAGTTGATAAAAATTGTGAAAAGTAAAGTCGGATTAAAGCC
TGACACATCTGGATGGTCCTTATTTGAACAATTGGGACGCTTTGAAAAGC
ATTGTGATGTAAAAGAATTGGTTTCGGATATGCTTTTCAGATGGGAATCA
TTGAAAAGTCCTAGGAAGTGTAATCATAAAGTGTACTTAGTTTTTAAGAA
AAGAATTTTTGATGAGAAATGGTATGATAAAAATGATCATATAGAGGTGG
ATTTATTAACACATCAGTGTATTTCGGATATTTTTGAAGATCGTCTAAAA
TTGACAATAAATCAGGCTGCCGAAATCTGCGCATTGAGGCTGATACAGGA
AAATTGTGATGCATATGTTTCCTTGAGAATTTTGCCACAGTATTTACGAC
CGACAATTAATCAAAATATTATTTTAAAATATGCCGAAACAATTAAAAAT
TTGCCAGATTTTGAATTGAAAAATTGCAATTTGAAAATTTTGAAATTATG
TAAGAAATGTGATCCATTTTGTGCCATCCATTTTTCGGTTTCTCAATATT
CCGTCCCCATATGGCCAACAGAAATAACAGTCTCAGTCAACAAGAAAGGT
CTCTATTTTACAGCGAAACTCATTGGTTCGATTCTTCTATTTACAAAGTT
CACGGATATTATTCGGATCTCCGTGAAACCTATCGGATTCTTTACAATGT
TTCTTAAGCATGAGCAATATTCGGAGATGAAAATGTATTCAAATGTTGCA
GAAGATATATCGATACTAATCCGGGATTACTTGGTTGATCAAAGTATTCT
CAAAACCAGAACGCCATCCTTTTCATCGTCAGAAAAAGCGAACTACGGCA
AATCAGAAGCCGACAACAAACGGCCGAATAATGATTGTGATTTATCCACA
TATTCCATTGATAATATCCCAAATCCCGTGAATGGTGCTAATTTCAAGTG
TAAACCCGACAGCAAAGATGCGTTTATTGACTACGATGACGGAGAGAAAA
GACTGCAAAACATGAGATACTTAAAAGAGTATTTTGATTCGTTTTCTTTG
CAGTCGGACGAGATTTTCGACTTGAGAGAAAGTCCCCAGTCGTTGCCGTT
TGAGATCCAAAACCTAAATATTGACAGAGACTAATTTGCAGAGTTTCCTT
TACACTATTGTCTTTCTAGAATGTCACAATAATTTAGTAAACATTTTCAT
ATTGTTATGGCTTTTATTCTATTAACATTCTATGAAATTAATGTTAATCC
TTTTTTTCTATTGTGGTAGATTATGCTTAATAATACATTTTATTACATAA
ATGTGAATAAATTCTTAAATAAATCGTG
back to top

protein sequence of SMED30021314-orf-1

>SMED30021314-orf-1 ID=SMED30021314-orf-1|Name=SMED30021314-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=700bp
MMPENRESLSLANNSENINRSLMQCEEVNVSKKSNWMQQANQRLLLRMAR
FTEEDRLRLQESIHQCRQALLLTNQVSLVQSHNSGIFRSFKRLKRRNETT
FVGNGNLSINNSHNQVNLDMTAAIKSKFWTHSKKPIRQSLVKSTRKDIDK
AAVKMFNILMTYAHCNFKLESGSDSDSSLKATHQTYLIQSLLEKVLLYSE
LRDEIYLQLIKQITDNNDLVGGTNQKYWQILSVVCNVIKPQSQQVICYLD
AHFKMYGIDSTTEEGRYAIYCQKCLNRTIEKISRVFIPSTKEVNAVIRRQ
CMKLRIYLLDGSYRKVEVFSHTTNGELIKIVKSKVGLKPDTSGWSLFEQL
GRFEKHCDVKELVSDMLFRWESLKSPRKCNHKVYLVFKKRIFDEKWYDKN
DHIEVDLLTHQCISDIFEDRLKLTINQAAEICALRLIQENCDAYVSLRIL
PQYLRPTINQNIILKYAETIKNLPDFELKNCNLKILKLCKKCDPFCAIHF
SVSQYSVPIWPTEITVSVNKKGLYFTAKLIGSILLFTKFTDIIRISVKPI
GFFTMFLKHEQYSEMKMYSNVAEDISILIRDYLVDQSILKTRTPSFSSSE
KANYGKSEADNKRPNNDCDLSTYSIDNIPNPVNGANFKCKPDSKDAFIDY
DDGEKRLQNMRYLKEYFDSFSLQSDEIFDLRESPQSLPFEIQNLNIDRD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003779actin binding
GO:0003774motor activity
GO:0005524ATP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR038185MyTH4_dom_sf
IPR000299FERM_domain
IPR035963FERM_2
IPR000857MyTH4_dom
IPR019748FERM_central
IPR029071Ubiquitin-like_domsf
Vocabulary: cellular component
TermDefinition
GO:0005856cytoskeleton
GO:0016459myosin complex
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000857MyTH4 domainSMARTSM00139MyTH4_1coord: 131..297
e-value: 5.5E-7
score: 27.2
IPR000857MyTH4 domainPFAMPF00784MyTH4coord: 187..295
e-value: 2.3E-23
score: 82.8
IPR000857MyTH4 domainPROSITEPS51016MYTH4coord: 131..297
score: 33.701
IPR038185MyTH4 domain superfamilyGENE3DG3DSA:1.25.40.530coord: 107..300
e-value: 4.6E-34
score: 120.0
NoneNo IPR availableGENE3DG3DSA:3.10.20.90coord: 302..392
e-value: 3.2E-18
score: 67.7
NoneNo IPR availablePANTHERPTHR46049FAMILY NOT NAMEDcoord: 149..443
NoneNo IPR availableCDDcd17208FERM_F1_DdMyo7_likecoord: 299..392
e-value: 1.84288E-19
score: 81.9134
IPR000299FERM domainPROSITEPS50057FERM_3coord: 302..593
score: 9.081
IPR019748FERM central domainCDDcd14473FERM_B-lobecoord: 404..492
e-value: 0.00690728
score: 34.5295
IPR035963FERM superfamily, second domainSUPERFAMILYSSF47031Second domain of FERMcoord: 388..493
IPR029071Ubiquitin-like domain superfamilySUPERFAMILYSSF54236Ubiquitin-likecoord: 304..392