Protein SCAI

Overview
NameProtein SCAI
Smed IDSMED30021300
Length (bp)1007
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein SCAI (SMED30021300) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein SCAI (SMED30021300) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein SCAI (SMED30021300) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein SCAI (SMED30021300) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021300

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30021300SMESG000075968.1 SmedASXL_008686SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parenchymaSMED30021300SMESG000075968.1 dd_Smed_v4_24482_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30021300SMESG000075968.1 dd_Smed_v4_24482_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021300SMESG000075968.1 SMED_11548_V2_2GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30021300SMESG000075968.1 SMED_11548_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30021300SMESG000075968.1 SMED_11548_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein SCAI vs. Ensembl Human
Match: SCAI (suppressor of cancer cell invasion [Source:HGNC Symbol;Acc:HGNC:26709])

HSP 1 Score: 67.781 bits (164), Expect = 8.059e-12
Identity = 37/134 (27.61%), Postives = 69/134 (51.49%), Query Frame = 3
Query:  492 DDTKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEFN-EMCLSIIKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPI---ETILSENADLKAIVYSISRVAKLNEFF 881
            D ++ G+LFTLFL+ P+ A   +     + +  W + Q+YL + N ++   +   R I + +L F  D F++ ++  + FCS  +R HK F +   +P S P +   ET+  EN  L+  +  ++ +  +   F
Sbjct:  467 DQSQRGSLFTLFLNNPLMAFLFVSGLSSMRRGLWEKCQEYLRKINRDIAQLLTHSRSIDQAFLQFFGDEFLRLLLTRFIFCSATMRMHKIFRETRNYPESYPQLPRDETV--ENPHLQKHILELASILDVRNVF 598          
BLAST of Protein SCAI vs. Ensembl Human
Match: SCAI (suppressor of cancer cell invasion [Source:HGNC Symbol;Acc:HGNC:26709])

HSP 1 Score: 67.3958 bits (163), Expect = 9.243e-12
Identity = 37/134 (27.61%), Postives = 69/134 (51.49%), Query Frame = 3
Query:  492 DDTKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEFN-EMCLSIIKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPI---ETILSENADLKAIVYSISRVAKLNEFF 881
            D ++ G+LFTLFL+ P+ A   +     + +  W + Q+YL + N ++   +   R I + +L F  D F++ ++  + FCS  +R HK F +   +P S P +   ET+  EN  L+  +  ++ +  +   F
Sbjct:  490 DQSQRGSLFTLFLNNPLMAFLFVSGLSSMRRGLWEKCQEYLRKINRDIAQLLTHSRSIDQAFLQFFGDEFLRLLLTRFIFCSATMRMHKIFRETRNYPESYPQLPRDETV--ENPHLQKHILELASILDVRNVF 621          
BLAST of Protein SCAI vs. Ensembl Fly
Match: CG13293 (gene:FBgn0035677 transcript:FBtr0332064)

HSP 1 Score: 74.7146 bits (182), Expect = 2.110e-14
Identity = 48/160 (30.00%), Postives = 73/160 (45.62%), Query Frame = 3
Query:  465 RPLIISLFPDD---------TKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEF-NEMCLSIIKKRI---------ILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNP--PIETILSENADLKAIVYSISRVAKLNEFF 881
            +PL++ + P D           HG+LFTLFL  P+ AL  IC+   +    W R Q Y++ F  E    + + RI         I   Y+ F  D F++ +IL + FC VVLR H+ F      P   P  P   +L E+  L  I++ ++    +   F
Sbjct:  434 QPLVVLMSPQDVPPAFQADVQHHGSLFTLFLHSPLTALCYICNVGDVPIHHWERCQTYVDRFITEASRLVTRCRIDEIEQGIGFIDSSYVQFFGDDFLRTLILRFVFCDVVLRLHRGFRGRHMRPRCEPQLPANELL-EHPSLSHIIFQLASALDVRGHF 592          
BLAST of Protein SCAI vs. Ensembl Fly
Match: CG13293 (gene:FBgn0035677 transcript:FBtr0332061)

HSP 1 Score: 74.7146 bits (182), Expect = 2.110e-14
Identity = 48/160 (30.00%), Postives = 73/160 (45.62%), Query Frame = 3
Query:  465 RPLIISLFPDD---------TKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEF-NEMCLSIIKKRI---------ILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNP--PIETILSENADLKAIVYSISRVAKLNEFF 881
            +PL++ + P D           HG+LFTLFL  P+ AL  IC+   +    W R Q Y++ F  E    + + RI         I   Y+ F  D F++ +IL + FC VVLR H+ F      P   P  P   +L E+  L  I++ ++    +   F
Sbjct:  434 QPLVVLMSPQDVPPAFQADVQHHGSLFTLFLHSPLTALCYICNVGDVPIHHWERCQTYVDRFITEASRLVTRCRIDEIEQGIGFIDSSYVQFFGDDFLRTLILRFVFCDVVLRLHRGFRGRHMRPRCEPQLPANELL-EHPSLSHIIFQLASALDVRGHF 592          
BLAST of Protein SCAI vs. Ensembl Fly
Match: CG13293 (gene:FBgn0035677 transcript:FBtr0332062)

HSP 1 Score: 74.3294 bits (181), Expect = 2.386e-14
Identity = 48/160 (30.00%), Postives = 73/160 (45.62%), Query Frame = 3
Query:  465 RPLIISLFPDD---------TKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEF-NEMCLSIIKKRI---------ILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNP--PIETILSENADLKAIVYSISRVAKLNEFF 881
            +PL++ + P D           HG+LFTLFL  P+ AL  IC+   +    W R Q Y++ F  E    + + RI         I   Y+ F  D F++ +IL + FC VVLR H+ F      P   P  P   +L E+  L  I++ ++    +   F
Sbjct:  429 QPLVVLMSPQDVPPAFQADVQHHGSLFTLFLHSPLTALCYICNVGDVPIHHWERCQTYVDRFITEASRLVTRCRIDEIEQGIGFIDSSYVQFFGDDFLRTLILRFVFCDVVLRLHRGFRGRHMRPRCEPQLPANELL-EHPSLSHIIFQLASALDVRGHF 587          
BLAST of Protein SCAI vs. Ensembl Fly
Match: CG13293 (gene:FBgn0035677 transcript:FBtr0332063)

HSP 1 Score: 74.3294 bits (181), Expect = 2.420e-14
Identity = 48/160 (30.00%), Postives = 73/160 (45.62%), Query Frame = 3
Query:  465 RPLIISLFPDD---------TKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEF-NEMCLSIIKKRI---------ILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNP--PIETILSENADLKAIVYSISRVAKLNEFF 881
            +PL++ + P D           HG+LFTLFL  P+ AL  IC+   +    W R Q Y++ F  E    + + RI         I   Y+ F  D F++ +IL + FC VVLR H+ F      P   P  P   +L E+  L  I++ ++    +   F
Sbjct:  434 QPLVVLMSPQDVPPAFQADVQHHGSLFTLFLHSPLTALCYICNVGDVPIHHWERCQTYVDRFITEASRLVTRCRIDEIEQGIGFIDSSYVQFFGDDFLRTLILRFVFCDVVLRLHRGFRGRHMRPRCEPQLPANELL-EHPSLSHIIFQLASALDVRGHF 592          
BLAST of Protein SCAI vs. Ensembl Zebrafish
Match: scai (suppressor of cancer cell invasion [Source:ZFIN;Acc:ZDB-GENE-060526-57])

HSP 1 Score: 72.7886 bits (177), Expect = 1.031e-13
Identity = 35/104 (33.65%), Postives = 57/104 (54.81%), Query Frame = 3
Query:  492 DDTKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEE-FNEMCLSIIKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPI 800
            D ++ G+LFTLFL  P+     +C    +    W +AQ+ L + F+++   I   R+I + YL F  D F++ +++ + FCS  LR HK F +    P S PP+
Sbjct:  449 DQSQRGSLFTLFLYNPLMGFLSVCGLSSMRYGLWEKAQELLRKVFHDIGQMITSSRVIDQAYLQFYGDEFLRLLMIRFVFCSSALRLHKLFREARSFPESYPPL 552          
BLAST of Protein SCAI vs. Ensembl Zebrafish
Match: scai (suppressor of cancer cell invasion [Source:ZFIN;Acc:ZDB-GENE-060526-57])

HSP 1 Score: 72.7886 bits (177), Expect = 1.123e-13
Identity = 35/104 (33.65%), Postives = 57/104 (54.81%), Query Frame = 3
Query:  492 DDTKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEE-FNEMCLSIIKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPI 800
            D ++ G+LFTLFL  P+     +C    +    W +AQ+ L + F+++   I   R+I + YL F  D F++ +++ + FCS  LR HK F +    P S PP+
Sbjct:  426 DQSQRGSLFTLFLYNPLMGFLSVCGLSSMRYGLWEKAQELLRKVFHDIGQMITSSRVIDQAYLQFYGDEFLRLLMIRFVFCSSALRLHKLFREARSFPESYPPL 529          
BLAST of Protein SCAI vs. Ensembl Zebrafish
Match: scai (suppressor of cancer cell invasion [Source:ZFIN;Acc:ZDB-GENE-060526-57])

HSP 1 Score: 72.4034 bits (176), Expect = 1.242e-13
Identity = 35/104 (33.65%), Postives = 57/104 (54.81%), Query Frame = 3
Query:  492 DDTKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEE-FNEMCLSIIKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPI 800
            D ++ G+LFTLFL  P+     +C    +    W +AQ+ L + F+++   I   R+I + YL F  D F++ +++ + FCS  LR HK F +    P S PP+
Sbjct:  435 DQSQRGSLFTLFLYNPLMGFLSVCGLSSMRYGLWEKAQELLRKVFHDIGQMITSSRVIDQAYLQFYGDEFLRLLMIRFVFCSSALRLHKLFREARSFPESYPPL 538          
BLAST of Protein SCAI vs. Ensembl Zebrafish
Match: scai (suppressor of cancer cell invasion [Source:ZFIN;Acc:ZDB-GENE-060526-57])

HSP 1 Score: 72.4034 bits (176), Expect = 1.333e-13
Identity = 35/104 (33.65%), Postives = 57/104 (54.81%), Query Frame = 3
Query:  492 DDTKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEE-FNEMCLSIIKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPI 800
            D ++ G+LFTLFL  P+     +C    +    W +AQ+ L + F+++   I   R+I + YL F  D F++ +++ + FCS  LR HK F +    P S PP+
Sbjct:  469 DQSQRGSLFTLFLYNPLMGFLSVCGLSSMRYGLWEKAQELLRKVFHDIGQMITSSRVIDQAYLQFYGDEFLRLLMIRFVFCSSALRLHKLFREARSFPESYPPL 572          
BLAST of Protein SCAI vs. Ensembl Xenopus
Match: SCAI (suppressor of cancer cell invasion [Source:NCBI gene;Acc:100493243])

HSP 1 Score: 68.9366 bits (167), Expect = 2.472e-12
Identity = 36/132 (27.27%), Postives = 67/132 (50.76%), Query Frame = 3
Query:  492 DDTKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEFN-EMCLSIIKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPI-ETILSENADLKAIVYSISRVAKLNEFF 881
            D ++ G+LFTLFL  P+ A   +     + K  W + QD++ + N ++   +   R I + +L F  D F++ ++  + FCS  LR HK F +   +P + PP+    L EN  L+  +  ++ +  +   +
Sbjct:  425 DHSQRGSLFTLFLKKPLMAFLFVSGLSSMRKGLWEKCQDHVRKINRDIAQLLTHSRSIDQAFLQFFGDEFLRLLLTRFIFCSATLRMHKSFRETRNYPETYPPLPRDELVENLHLQKQILELASILDVRNLY 556          
BLAST of Protein SCAI vs. Ensembl Mouse
Match: Scai (suppressor of cancer cell invasion [Source:MGI Symbol;Acc:MGI:2443716])

HSP 1 Score: 68.1662 bits (165), Expect = 3.582e-12
Identity = 37/134 (27.61%), Postives = 69/134 (51.49%), Query Frame = 3
Query:  492 DDTKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEFN-EMCLSIIKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPI---ETILSENADLKAIVYSISRVAKLNEFF 881
            D ++ G+LFTLFL+ P+ A   +     + +  W + Q+YL + N ++   +   R I + +L F  D F++ ++  + FCS  +R HK F +   +P S P +   ET+  EN  L+  +  ++ +  +   F
Sbjct:  467 DQSQRGSLFTLFLNNPLMAFLFVSGLSSMRRGLWEKCQEYLRKINRDIAQLLTHSRSIDQAFLQFFGDEFLRLLLTRFVFCSATMRMHKAFRETRNYPESYPQLPRDETV--ENPHLQKHILELASILDVRNIF 598          
BLAST of Protein SCAI vs. UniProt/SwissProt
Match: sp|Q8C8N2|SCAI_MOUSE (Protein SCAI OS=Mus musculus OX=10090 GN=Scai PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 2.505e-11
Identity = 37/134 (27.61%), Postives = 69/134 (51.49%), Query Frame = 3
Query:  492 DDTKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEFN-EMCLSIIKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPI---ETILSENADLKAIVYSISRVAKLNEFF 881
            D ++ G+LFTLFL+ P+ A   +     + +  W + Q+YL + N ++   +   R I + +L F  D F++ ++  + FCS  +R HK F +   +P S P +   ET+  EN  L+  +  ++ +  +   F
Sbjct:  467 DQSQRGSLFTLFLNNPLMAFLFVSGLSSMRRGLWEKCQEYLRKINRDIAQLLTHSRSIDQAFLQFFGDEFLRLLLTRFVFCSATMRMHKAFRETRNYPESYPQLPRDETV--ENPHLQKHILELASILDVRNIF 598          
BLAST of Protein SCAI vs. UniProt/SwissProt
Match: sp|Q8N9R8|SCAI_HUMAN (Protein SCAI OS=Homo sapiens OX=9606 GN=SCAI PE=1 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 3.870e-11
Identity = 37/134 (27.61%), Postives = 69/134 (51.49%), Query Frame = 3
Query:  492 DDTKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEFN-EMCLSIIKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPI---ETILSENADLKAIVYSISRVAKLNEFF 881
            D ++ G+LFTLFL+ P+ A   +     + +  W + Q+YL + N ++   +   R I + +L F  D F++ ++  + FCS  +R HK F +   +P S P +   ET+  EN  L+  +  ++ +  +   F
Sbjct:  467 DQSQRGSLFTLFLNNPLMAFLFVSGLSSMRRGLWEKCQEYLRKINRDIAQLLTHSRSIDQAFLQFFGDEFLRLLLTRFIFCSATMRMHKIFRETRNYPESYPQLPRDETV--ENPHLQKHILELASILDVRNVF 598          
BLAST of Protein SCAI vs. TrEMBL
Match: G7Y7U7 (Protein SCAI OS=Clonorchis sinensis OX=79923 GN=CLF_102400 PE=4 SV=1)

HSP 1 Score: 95.1301 bits (235), Expect = 1.379e-17
Identity = 46/121 (38.02%), Postives = 71/121 (58.68%), Query Frame = 3
Query:  444 ICLLIDIRPLIISLFPDDTKH-GNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEFNEMCLSII-KKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPI 800
            +CLL    P ++    +  +H GN+FTLFL CPI A   IC    I+ K W+RAQ  L+ F   C  I+ + R +   Y+ F+ D F++ ++L YCFCS+VL+ H+ F  P ++P  +P +
Sbjct:  906 VCLL---SPEVVPDKLESMRHRGNVFTLFLHCPITAFCYICGLTTIQYKTWDRAQAILDSFLTECYRILTRSRNLDYSYMQFLVDDFLRLLVLRYCFCSIVLQFHRGFTGPSFYPSCSPSL 1023          
BLAST of Protein SCAI vs. TrEMBL
Match: H9JS49 (Uncharacterized protein OS=Bombyx mori OX=7091 PE=4 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 8.548e-17
Identity = 44/128 (34.38%), Postives = 75/128 (58.59%), Query Frame = 3
Query:  501 KHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEF-NEMCLSIIKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPIETILSENADLKAIVYSISRVAKLNEFF 881
            + GN+FTLF+SCP    S I +   +   QW R+Q +LE+F NE+   I++ R+ +  YL F+ D F++ +I  Y FC + +R H+ F    Y P  +PP+   L E+  LK I++ +++  ++ + F
Sbjct:  296 RQGNMFTLFMSCPFTGFSFITELFSVSLSQWERSQLHLEDFMNELSQIILRGRVDIM-YLHFLGDDFLRLMIFRYIFCEMSIRMHRSFRSRNYWPRCSPPLPEDLLEHTRLKHIIFDLAKCLQVQQHF 422          
BLAST of Protein SCAI vs. TrEMBL
Match: C1LIU1 (Uncharacterized protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 9.182e-17
Identity = 47/121 (38.84%), Postives = 72/121 (59.50%), Query Frame = 3
Query:  444 ICLLIDIRPLIISLFPDDTKH-GNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEFNEMCLSII-KKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPI 800
            +CLL    P +I    +  +H GNLFTLFL CP+ A  + C+   I  K W+R Q  +E F   C  ++ + R +   Y  F+SD F++ IIL YCFC++VL+ H+ F+ P ++P  +PP+
Sbjct:  438 VCLL---SPKVIPEKLESQRHRGNLFTLFLHCPLTAFCLTCNLTKITMKIWDRGQSIIESFLTECYHVLTRSRNLDYSYQQFLSDDFLRTIILRYCFCNIVLQLHRGFHGPSFYPSCSPPL 555          
BLAST of Protein SCAI vs. TrEMBL
Match: A0A183LFA6 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS2481 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 5.994e-16
Identity = 52/144 (36.11%), Postives = 83/144 (57.64%), Query Frame = 3
Query:  444 ICLLIDIRPLIISLFPDDTKH-GNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEFNEMCLSI-IKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPIETILSENADLKAIVYSISRVAKL 869
            +CLL    P +I    +  +H GNLFTLFL CP++A  + C+   I  K W+RAQ  ++ F   C  + ++ R +   Y  F+SD F++ IIL YCFC++VL+ H+ F+ P ++P  +P +    SE  D + +   I+ +A L
Sbjct:  404 VCLL---SPKVIPEKLESQRHRGNLFTLFLHCPLSAFCLTCNLTKITLKTWDRAQSIIDSFLTECYQVLMRSRSLDYSYQQFLSDDFLRIIILRYCFCNIVLQLHRSFHGPSFYPSCSPSLPG--SELIDCRVLHKLITELASL 542          
BLAST of Protein SCAI vs. TrEMBL
Match: A0A183JY21 (Uncharacterized protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS7620 PE=4 SV=1)

HSP 1 Score: 89.3521 bits (220), Expect = 7.932e-16
Identity = 52/144 (36.11%), Postives = 82/144 (56.94%), Query Frame = 3
Query:  444 ICLLIDIRPLIISLFPDDTKH-GNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEFNEMCLSI-IKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPIETILSENADLKAIVYSISRVAKL 869
            +CLL    P +I    +  +H GNLFTLFL CP+ A  + C+   I  K W+RAQ  ++ F   C  + ++ R +   Y  F+SD F++ IIL YCFC++VL+ H+ F+ P ++P  +P +    SE  D + +   I+ +A L
Sbjct:  431 VCLL---SPKVIPEKLESQRHRGNLFTLFLHCPLTAFCLTCNLTKITLKTWDRAQSIIDSFLTECYQVLMRSRSLDYSYQQFLSDDFLRIIILRYCFCNIVLQLHRSFHGPSFYPSCSPSLPG--SELIDCRVLHKLITELASL 569          
BLAST of Protein SCAI vs. Ensembl Cavefish
Match: scai (suppressor of cancer cell invasion [Source:ZFIN;Acc:ZDB-GENE-060526-57])

HSP 1 Score: 66.6254 bits (161), Expect = 1.010e-11
Identity = 34/131 (25.95%), Postives = 67/131 (51.15%), Query Frame = 3
Query:  492 DDTKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEFNEMCLSIIKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPI-ETILSENADLKAIVYSISRVAKLNEFF 881
            D ++ G+LFTLFL  P+     IC    + +  W +AQ++L + +     ++     ++ +L F  D F++ +++ + FCS  LR HK F +    P S P + +  + EN+ L+  +  ++ +  +   F
Sbjct:  414 DQSQRGSLFTLFLYNPLMGFLSICGITSMRQGLWEKAQEFLRKISHDIGQMLTSSRAIQAFLQFYGDEFLRLLMIRFVFCSATLRLHKLFREARSVPDSYPQLPKQEMVENSLLQKHILELASMLDVQNLF 544          
BLAST of Protein SCAI vs. Ensembl Sea Lamprey
Match: scai (suppressor of cancer cell invasion [Source:ZFIN;Acc:ZDB-GENE-060526-57])

HSP 1 Score: 49.2914 bits (116), Expect = 7.932e-7
Identity = 31/131 (23.66%), Postives = 56/131 (42.75%), Query Frame = 3
Query:  495 DTKHGNLFTLFLSCPIAALSIICD----------KKCIEKKQWNRAQDYLEEFNEMCLSIIKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPIET-ILSENADLKAIVYSIS 854
             +  G L T+FL+CP+A  + +C             C E+ Q         E   + L    +  +   +L F+ D F+++++  +   S  +R+H+        P S PP+ T  L  N  L A+V  ++
Sbjct:  415 GSGGGGLLTIFLACPVAGFASLCGIGGPLPASLVATCCERVQQG-------EVEALALLGASQPALEPSWLLFLGDVFIRRLVARFILMSCAMRAHRQLRALGSFPESRPPLPTEDLLSNPRLLALVRELA 538          
BLAST of Protein SCAI vs. Ensembl Nematostella
Match: EDO34366 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPK0])

HSP 1 Score: 55.4546 bits (132), Expect = 1.288e-8
Identity = 34/129 (26.36%), Postives = 57/129 (44.19%), Query Frame = 3
Query:  501 KHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEFNEMCLSIIK--KRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPIETILSENADLKAIVYSISRVAKLNEFF 881
            + G+LFT+FL  P+ A S IC    +    W+  Q  +       L +     R +   +  F+ D  MK +IL Y FC   +  H+ F   EY+P   P + T +  N  ++  V  ++ +  +   F
Sbjct:  442 RKGSLFTMFLYSPLVAFSYICSIADLRSDLWDSCQRQIRRILGDILRVFHDWSRAVDLTFQKFLEDDLMKMLILRYVFCFYAMHLHRAFKGSEYYPKCFPKLPTEILINGGVEKQVLELASMLDVRSLF 570          
BLAST of Protein SCAI vs. Ensembl Medaka
Match: scai (suppressor of cancer cell invasion [Source:NCBI gene;Acc:101156422])

HSP 1 Score: 83.1889 bits (204), Expect = 3.236e-17
Identity = 39/104 (37.50%), Postives = 61/104 (58.65%), Query Frame = 3
Query:  492 DDTKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEE-FNEMCLSIIKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPI 800
            D ++ G+LFTLFL  P+ A S +C    I++  W RAQD+L + F ++   I + R I + +L F  D F++ +++ + FCS VLR HK F +    P S P +
Sbjct:  427 DQSQRGSLFTLFLYSPLLAFSSVCGLSSIQRGIWERAQDFLRKVFRDIGQMITRSRTIDQAFLQFFGDEFLRLLLIRFVFCSAVLRLHKLFREARSFPESYPEL 530          
BLAST of Protein SCAI vs. Planmine SMEST
Match: SMESG000075968.1 (SMESG000075968.1)

HSP 1 Score: 263.462 bits (672), Expect = 2.830e-84
Identity = 134/147 (91.16%), Postives = 135/147 (91.84%), Query Frame = 3
Query:  465 RPLIISLFPD--------DTKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEFNEMCLSIIKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPIETILSENADLKAIVYSISRVAKLNEFF 881
            +PLI  L P         DTKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEFNEMCLSIIKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPIETILSENADLKAIVYSISRVAKLNEFF
Sbjct:  346 KPLICLLSPRILPPESKYDTKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEFNEMCLSIIKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPIETILSENADLKAIVYSISRVAKLNEFF 492          
BLAST of Protein SCAI vs. Planmine SMEST
Match: SMESG000075966.1 (SMESG000075966.1)

HSP 1 Score: 88.9669 bits (219), Expect = 2.519e-19
Identity = 53/145 (36.55%), Postives = 83/145 (57.24%), Query Frame = 3
Query:  465 RPLIISLFPDDT-------KH-GNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEFNEMCLSIIKKRIILK------EYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSNPPI-ETILSENADLKAIVYSIS 854
            +PL+  + P+         KH GNLFTLF+ CPI A  +IC+   +  K W+RA  YL++F      I   +I+L+       YL F SD F++ +IL YCFC +VL+ H+ F  P+++P+S P + E  L  ++ L+  +Y I+
Sbjct:  446 QPLVCLMSPEQVPNYIQKLKHKGNLFTLFIHCPITAFCVICNVSQLSTKAWDRAHVYLDQF-----MIESGKILLRCKNLDYSYLQFYSDDFLRILILRYCFCFLVLKMHQDFQGPKFYPVSYPQLPELDLYNHSSLQKKIYEIA 585          
BLAST of Protein SCAI vs. Planmine SMEST
Match: SMESG000039882.1 (SMESG000039882.1)

HSP 1 Score: 55.4546 bits (132), Expect = 3.081e-8
Identity = 42/143 (29.37%), Postives = 66/143 (46.15%), Query Frame = 3
Query:  468 PLIISLFPD---------DTKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEFNEMCLSIIKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPLSN-PPIETILSENADLKAIVYSISRVAK 866
            P++  L PD         + K G LFTLFL+CPI A  IIC       + +   +     F     S +  RI  ++   F+ DPF + +I+ Y FC++ LR H  F    Y P  N   +E+ +  +   +  +YS++ V  
Sbjct:  365 PILCLLSPDLLPNQFVKHEMKIGKLFTLFLTCPIIAFVIICGHLDTNVQTFKELERIFTRFANAVESDL-WRISDEKLRLFMGDPFCRSLIVRYLFCNISLRLHCEFPVDGYLPKCNLIEVESTIVNDKRFQNFIYSMATVVN 506          
The following BLAST results are available for this feature:
BLAST of Protein SCAI vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
SCAI8.059e-1227.61suppressor of cancer cell invasion [Source:HGNC Sy... [more]
SCAI9.243e-1227.61suppressor of cancer cell invasion [Source:HGNC Sy... [more]
back to top
BLAST of Protein SCAI vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein SCAI vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG132932.110e-1430.00gene:FBgn0035677 transcript:FBtr0332064[more]
CG132932.110e-1430.00gene:FBgn0035677 transcript:FBtr0332061[more]
CG132932.386e-1430.00gene:FBgn0035677 transcript:FBtr0332062[more]
CG132932.420e-1430.00gene:FBgn0035677 transcript:FBtr0332063[more]
back to top
BLAST of Protein SCAI vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
scai1.031e-1333.65suppressor of cancer cell invasion [Source:ZFIN;Ac... [more]
scai1.123e-1333.65suppressor of cancer cell invasion [Source:ZFIN;Ac... [more]
scai1.242e-1333.65suppressor of cancer cell invasion [Source:ZFIN;Ac... [more]
scai1.333e-1333.65suppressor of cancer cell invasion [Source:ZFIN;Ac... [more]
back to top
BLAST of Protein SCAI vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SCAI2.472e-1227.27suppressor of cancer cell invasion [Source:NCBI ge... [more]
back to top
BLAST of Protein SCAI vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Scai3.582e-1227.61suppressor of cancer cell invasion [Source:MGI Sym... [more]
back to top
BLAST of Protein SCAI vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q8C8N2|SCAI_MOUSE2.505e-1127.61Protein SCAI OS=Mus musculus OX=10090 GN=Scai PE=1... [more]
sp|Q8N9R8|SCAI_HUMAN3.870e-1127.61Protein SCAI OS=Homo sapiens OX=9606 GN=SCAI PE=1 ... [more]
back to top
BLAST of Protein SCAI vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G7Y7U71.379e-1738.02Protein SCAI OS=Clonorchis sinensis OX=79923 GN=CL... [more]
H9JS498.548e-1734.38Uncharacterized protein OS=Bombyx mori OX=7091 PE=... [more]
C1LIU19.182e-1738.84Uncharacterized protein OS=Schistosoma japonicum O... [more]
A0A183LFA65.994e-1636.11Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A183JY217.932e-1636.11Uncharacterized protein OS=Schistosoma curassoni O... [more]
back to top
BLAST of Protein SCAI vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
scai1.010e-1125.95suppressor of cancer cell invasion [Source:ZFIN;Ac... [more]
back to top
BLAST of Protein SCAI vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
scai7.932e-723.66suppressor of cancer cell invasion [Source:ZFIN;Ac... [more]
back to top
BLAST of Protein SCAI vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein SCAI vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO343661.288e-826.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein SCAI vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
scai3.236e-1737.50suppressor of cancer cell invasion [Source:NCBI ge... [more]
back to top
BLAST of Protein SCAI vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000075968.12.830e-8491.16SMESG000075968.1[more]
SMESG000075966.12.519e-1936.55SMESG000075966.1[more]
SMESG000039882.13.081e-829.37SMESG000039882.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021300 ID=SMED30021300|Name=Protein SCAI|organism=Schmidtea mediterranea sexual|type=transcript|length=1007bp
GGTTATTTTTTTGGGTTTGCAGTCGGCTAATTTTTACGATCTGTCGACTC
TTGTTTTGGCTTCCATATTCGACTTTTCTGACTTTTACCAATTTAATTAC
TAAATATATTTGTTAAAAATAGTCAAAATTGAAAAAAAATTGAATATTTA
TGTTTATTTGATATCAGCAAAACTGTCAAATTATATATTATAATGTTTTT
TTTTAATTTTATAATTCTATTGTCATTGGAATAAAAGATACATAATTGTT
ACTCAATAAATTGCCATGTCGATTTTCATCAGAATGAAATCTATTGGTTC
ATGTCAGATTAAGCGAAACCAAATGTCCTCATTATATGAAGAATTCAAGT
GCAAATTTCTTGTTCAAATATAGTCTGGATAAACTTCTTGTTACTGTGTG
GTTTCTGTTTTATTTATCTATTCTCAATGAGATTAGAAAGCAGATTTGTC
TCTTGATTGATATACGGCCATTGATAATTTCATTATTTCCAGACGACACG
AAACATGGAAATCTGTTTACACTATTTTTAAGCTGTCCTATTGCGGCTCT
GAGTATAATTTGTGATAAGAAATGTATTGAAAAAAAACAGTGGAATCGTG
CTCAAGACTATCTAGAGGAATTTAATGAAATGTGTTTAAGTATAATTAAG
AAAAGGATAATTCTCAAAGAGTATTTGAGCTTTATTTCCGATCCATTTAT
GAAGAAAATAATACTTAGTTATTGTTTCTGTTCAGTTGTCCTTCGCAGTC
ACAAATATTTCAATAAACCAGAATATCATCCTTTATCCAATCCTCCCATA
GAAACAATTTTATCAGAAAATGCAGATTTGAAAGCCATTGTTTATTCAAT
ATCTCGGGTTGCCAAATTAAATGAATTTTTTTAGATTTATAAATTTTATA
AATCTGTTTATTTGTTCTAATTGTATTCAACACTGATTTGTGTTAGATTT
ATAAATAAAGTTTTTTATATATTATTTATTGTTTCGGTCGGATTGTCCAT
CGATATT
back to top

protein sequence of SMED30021300-orf-1

>SMED30021300-orf-1 ID=SMED30021300-orf-1|Name=SMED30021300-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=183bp
MKNSSANFLFKYSLDKLLVTVWFLFYLSILNEIRKQICLLIDIRPLIISL
FPDDTKHGNLFTLFLSCPIAALSIICDKKCIEKKQWNRAQDYLEEFNEMC
LSIIKKRIILKEYLSFISDPFMKKIILSYCFCSVVLRSHKYFNKPEYHPL
SNPPIETILSENADLKAIVYSISRVAKLNEFF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000429neoblast
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR022709SCAI
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:1903507negative regulation of nucleic acid-templated transcription
Vocabulary: molecular function
TermDefinition
GO:0003714transcription corepressor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022709Protein SCAIPFAMPF12070SCAIcoord: 49..142
e-value: 1.0E-19
score: 70.9
NoneNo IPR availablePANTHERPTHR21243FAMILY NOT NAMEDcoord: 54..171
NoneNo IPR availablePANTHERPTHR21243:SF15PROTEIN SCAIcoord: 54..171