Disks large homolog 1

Overview
NameDisks large homolog 1
Smed IDSMED30021297
Length (bp)1364
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Disks large homolog 1 (SMED30021297) t-SNE clustered cells

Violin plots show distribution of expression levels for Disks large homolog 1 (SMED30021297) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Disks large homolog 1 (SMED30021297) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Disks large homolog 1 (SMED30021297) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021297

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30021297SMESG000020502.1 dd_Smed_v4_3493_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30021297SMESG000020502.1 dd_Smed_v4_3493_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30021297SMESG000020502.1 dd_Smed_v4_3493_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021297SMESG000020502.1 dd_Smed_v4_3493_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021297SMESG000020502.1 dd_Smed_v4_3493_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021297SMESG000033033.1 Contig4256GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021297SMESG000020502.1 Contig41372newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021297SMESG000020502.1 Contig41372uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021297SMESG000020502.1 Contig4256GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 4 cellSMED30021297SMESG000020502.1 dd_Smed_v4_3493_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021297SMESG000020502.1 dd_Smed_v4_3493_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021297SMESG000020502.1 SMED_03599_V2_1rGPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30021297SMESG000020502.1 SMED_03599_V2_1rGPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Disks large homolog 1 vs. Ensembl Human
Match: DLG1 (discs large MAGUK scaffold protein 1 [Source:HGNC Symbol;Acc:HGNC:2900])

HSP 1 Score: 147.517 bits (371), Expect = 1.623e-39
Identity = 136/418 (32.54%), Postives = 201/418 (48.09%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSL---SSAISGNK--SPVQPVYNDIIPEAKLEVQETPVXXXXXXXXXXXXXXXXXXXXXXXIASPKPVSKVKSNDNYEPEDYP--DYQDPNYNQE-------YEPEANLEDENN--------------------PWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            M +RK DT+RA++LL+ Y+SKL+++E++ L+ ++E++I+  ++ LF AL+DIQEFYEV+L      I  +K   P+QPV          E+   P      ++                   P  +S       Y+ ED P  ++  P    E       +  E NL +  N                     + Y +I L +G  G GF++AGG + PH   D+ IF+TKIIT GAA  DGRL+++D I+ VN+V++  VTH  AV+ LK AG  + L ++R K                         P  E              +  E+ LIK    GLG SI GG    +   D+ I ++K+  GG A  DG+LQ+GD +L V++  L  VTHEEAV  LKNT   V L +A+
Sbjct:    1 MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNT-------WEISSLPSSTVTSETL------------------PSSLSPSVEKYRYQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRK-------------------------PVSE--------------KIMEIKLIK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAK 353          

HSP 2 Score: 73.1738 bits (178), Expect = 2.028e-13
Identity = 48/104 (46.15%), Postives = 63/104 (60.58%), Query Frame = 2
Query:  488 FQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTN 784
             +I L KG KG GF++AGG    H  GDN I+VTKII  GAA  DG+L+I D +++VN+V LE VTHE AV  LKN    + L + +     + D Y   + TN
Sbjct:  267 MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITN 370          
BLAST of Disks large homolog 1 vs. Ensembl Human
Match: DLG1 (discs large MAGUK scaffold protein 1 [Source:HGNC Symbol;Acc:HGNC:2900])

HSP 1 Score: 147.902 bits (372), Expect = 1.349e-37
Identity = 136/418 (32.54%), Postives = 201/418 (48.09%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSL---SSAISGNK--SPVQPVYNDIIPEAKLEVQETPVXXXXXXXXXXXXXXXXXXXXXXXIASPKPVSKVKSNDNYEPEDYP--DYQDPNYNQE-------YEPEANLEDENN--------------------PWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            M +RK DT+RA++LL+ Y+SKL+++E++ L+ ++E++I+  ++ LF AL+DIQEFYEV+L      I  +K   P+QPV          E+   P      ++                   P  +S       Y+ ED P  ++  P    E       +  E NL +  N                     + Y +I L +G  G GF++AGG + PH   D+ IF+TKIIT GAA  DGRL+++D I+ VN+V++  VTH  AV+ LK AG  + L ++R K                         P  E              +  E+ LIK    GLG SI GG    +   D+ I ++K+  GG A  DG+LQ+GD +L V++  L  VTHEEAV  LKNT   V L +A+
Sbjct:    1 MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNT-------WEISSLPSSTVTSETL------------------PSSLSPSVEKYRYQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRK-------------------------PVSE--------------KIMEIKLIK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAK 353          

HSP 2 Score: 96.6709 bits (239), Expect = 1.170e-20
Identity = 83/235 (35.32%), Postives = 120/235 (51.06%), Query Frame = 2
Query:  488 FQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNLHE------------VVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
             +I L KG KG GF++AGG    H  GDN I+VTKII  GAA  DG+L+I D +++VN+V LE VTHE AV  LKN    + L + +     + D Y   + TN               + Q   +   YSP  +         +++  ++    ++ R + GLG +I GG      E+   I IS +  GG AD+ G L+ GD I+ V+   L   +HE+A   LKN G+ VT+
Sbjct:  267 MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVL-----GDDEITREPRKVVLHRGSTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTI 490          
BLAST of Disks large homolog 1 vs. Ensembl Human
Match: DLG1 (discs large MAGUK scaffold protein 1 [Source:HGNC Symbol;Acc:HGNC:2900])

HSP 1 Score: 147.902 bits (372), Expect = 1.349e-37
Identity = 136/418 (32.54%), Postives = 201/418 (48.09%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSL---SSAISGNK--SPVQPVYNDIIPEAKLEVQETPVXXXXXXXXXXXXXXXXXXXXXXXIASPKPVSKVKSNDNYEPEDYP--DYQDPNYNQE-------YEPEANLEDENN--------------------PWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            M +RK DT+RA++LL+ Y+SKL+++E++ L+ ++E++I+  ++ LF AL+DIQEFYEV+L      I  +K   P+QPV          E+   P      ++                   P  +S       Y+ ED P  ++  P    E       +  E NL +  N                     + Y +I L +G  G GF++AGG + PH   D+ IF+TKIIT GAA  DGRL+++D I+ VN+V++  VTH  AV+ LK AG  + L ++R K                         P  E              +  E+ LIK    GLG SI GG    +   D+ I ++K+  GG A  DG+LQ+GD +L V++  L  VTHEEAV  LKNT   V L +A+
Sbjct:    1 MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNT-------WEISSLPSSTVTSETL------------------PSSLSPSVEKYRYQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRK-------------------------PVSE--------------KIMEIKLIK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAK 353          

HSP 2 Score: 96.6709 bits (239), Expect = 1.170e-20
Identity = 83/235 (35.32%), Postives = 120/235 (51.06%), Query Frame = 2
Query:  488 FQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNLHE------------VVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
             +I L KG KG GF++AGG    H  GDN I+VTKII  GAA  DG+L+I D +++VN+V LE VTHE AV  LKN    + L + +     + D Y   + TN               + Q   +   YSP  +         +++  ++    ++ R + GLG +I GG      E+   I IS +  GG AD+ G L+ GD I+ V+   L   +HE+A   LKN G+ VT+
Sbjct:  267 MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVL-----GDDEITREPRKVVLHRGSTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTI 490          
BLAST of Disks large homolog 1 vs. Ensembl Human
Match: DLG1 (discs large MAGUK scaffold protein 1 [Source:HGNC Symbol;Acc:HGNC:2900])

HSP 1 Score: 147.517 bits (371), Expect = 1.664e-37
Identity = 136/418 (32.54%), Postives = 201/418 (48.09%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSL---SSAISGNK--SPVQPVYNDIIPEAKLEVQETPVXXXXXXXXXXXXXXXXXXXXXXXIASPKPVSKVKSNDNYEPEDYP--DYQDPNYNQE-------YEPEANLEDENN--------------------PWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            M +RK DT+RA++LL+ Y+SKL+++E++ L+ ++E++I+  ++ LF AL+DIQEFYEV+L      I  +K   P+QPV          E+   P      ++                   P  +S       Y+ ED P  ++  P    E       +  E NL +  N                     + Y +I L +G  G GF++AGG + PH   D+ IF+TKIIT GAA  DGRL+++D I+ VN+V++  VTH  AV+ LK AG  + L ++R K                         P  E              +  E+ LIK    GLG SI GG    +   D+ I ++K+  GG A  DG+LQ+GD +L V++  L  VTHEEAV  LKNT   V L +A+
Sbjct:    1 MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNT-------WEISSLPSSTVTSETL------------------PSSLSPSVEKYRYQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRK-------------------------PVSE--------------KIMEIKLIK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAK 353          

HSP 2 Score: 96.2857 bits (238), Expect = 1.515e-20
Identity = 83/235 (35.32%), Postives = 120/235 (51.06%), Query Frame = 2
Query:  488 FQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNLHE------------VVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
             +I L KG KG GF++AGG    H  GDN I+VTKII  GAA  DG+L+I D +++VN+V LE VTHE AV  LKN    + L + +     + D Y   + TN               + Q   +   YSP  +         +++  ++    ++ R + GLG +I GG      E+   I IS +  GG AD+ G L+ GD I+ V+   L   +HE+A   LKN G+ VT+
Sbjct:  267 MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVL-----GDDEITREPRKVVLHRGSTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTI 490          
BLAST of Disks large homolog 1 vs. Ensembl Human
Match: DLG1 (discs large MAGUK scaffold protein 1 [Source:HGNC Symbol;Acc:HGNC:2900])

HSP 1 Score: 147.517 bits (371), Expect = 1.704e-37
Identity = 136/418 (32.54%), Postives = 201/418 (48.09%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSL---SSAISGNK--SPVQPVYNDIIPEAKLEVQETPVXXXXXXXXXXXXXXXXXXXXXXXIASPKPVSKVKSNDNYEPEDYP--DYQDPNYNQE-------YEPEANLEDENN--------------------PWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            M +RK DT+RA++LL+ Y+SKL+++E++ L+ ++E++I+  ++ LF AL+DIQEFYEV+L      I  +K   P+QPV          E+   P      ++                   P  +S       Y+ ED P  ++  P    E       +  E NL +  N                     + Y +I L +G  G GF++AGG + PH   D+ IF+TKIIT GAA  DGRL+++D I+ VN+V++  VTH  AV+ LK AG  + L ++R K                         P  E              +  E+ LIK    GLG SI GG    +   D+ I ++K+  GG A  DG+LQ+GD +L V++  L  VTHEEAV  LKNT   V L +A+
Sbjct:    1 MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPVNT-------WEISSLPSSTVTSETL------------------PSSLSPSVEKYRYQDEDTPPQEHISPQITNEVIGPELVHVSEKNLSEIENVHGFVSHSHISPIKVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRK-------------------------PVSE--------------KIMEIKLIK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAK 353          

HSP 2 Score: 96.2857 bits (238), Expect = 1.451e-20
Identity = 83/235 (35.32%), Postives = 120/235 (51.06%), Query Frame = 2
Query:  488 FQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNLHE------------VVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
             +I L KG KG GF++AGG    H  GDN I+VTKII  GAA  DG+L+I D +++VN+V LE VTHE AV  LKN    + L + +     + D Y   + TN               + Q   +   YSP  +         +++  ++    ++ R + GLG +I GG      E+   I IS +  GG AD+ G L+ GD I+ V+   L   +HE+A   LKN G+ VT+
Sbjct:  267 MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVL-----GDDEITREPRKVVLHRGSTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTI 490          
BLAST of Disks large homolog 1 vs. Ensembl Celegans
Match: dlg-1 (Disks large homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECY0])

HSP 1 Score: 124.405 bits (311), Expect = 3.344e-30
Identity = 93/256 (36.33%), Postives = 128/256 (50.00%), Query Frame = 2
Query:  458 LEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEY-------VANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTG-------------------GLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFI 1147
            ++D    W    I L KG  G GF++ GG ++P  +GD  I+VT II  GAA  DGR++ +D+I +VN+ N E V HE AV+ LK++G  + L ++R KDE            T+ L   V  TP+    + +H   S                +L + S G                   GLG SI GG    + + D+ I ++K+   G A++DGRL+VGD IL VD  SL   THE AVN LKNTG  V L I
Sbjct:  191 IDDHGRKWELENIVLEKGHTGLGFSITGGMDQPTEDGDTSIYVTNIIEGGAALADGRMRKNDIITAVNNTNCENVKHEVAVNALKSSGNVVSLSLKRRKDEAFLPIGGNFGGSTSYLRSGV--TPSVSAGNLQHAIHSPSAPIHPPPPPPVHHGSLSQLSVGQYRSTRPNTSVIDLVKGARGLGFSIAGGQGNEHVKGDTDIYVTKIIEEGAAELDGRLRVGDKILEVDHHSLINTTHENAVNVLKNTGNRVRLLI 444          

HSP 2 Score: 113.62 bits (283), Expect = 1.501e-26
Identity = 85/238 (35.71%), Postives = 120/238 (50.42%), Query Frame = 2
Query:  494 IDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQE--------------------SYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFI 1147
            IDL KG +G GF++AGG    H +GD  I+VTKII EGAAE+DGRL++ D I+ V+  +L   THE AV+ LKN G  + L+I++       +  +      Q  P T    P   Q+                    SY  +       +   V L+K    GLG +I GG      E++  I IS + PGGVAD+ G ++ GD++L V+   L   TH+EA   L+N G  V L +
Sbjct:  362 IDLVKGARGLGFSIAGGQGNEHVKGDTDIYVTKIIEEGAAELDGRLRVGDKILEVDHHSLINTTHENAVNVLKNTGNRVRLLIQQGTGAIFNDSASQ-----QFMPTTPILRPSSVQDYNRSQMGSQSHLSYGGPLNTSYSSQAPIAIPLEPRPVQLVK-GQNGLGFNIVGG------EDNEPIYISFVLPGGVADLSGNVKTGDVLLEVNGVVLRNATHKEAAEALRNAGNPVYLTL 587          

HSP 3 Score: 63.1586 bits (152), Expect = 2.481e-10
Identity = 32/89 (35.96%), Postives = 52/89 (58.43%), Query Frame = 2
Query:  887 QFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            + E  ++++   GLG SI GG D    + D+ I ++ +  GG A  DGR++  D+I  V++ +   V HE AVN LK++G  V+L + R
Sbjct:  199 ELENIVLEKGHTGLGFSITGGMDQPTEDGDTSIYVTNIIEGGAALADGRMRKNDIITAVNNTNCENVKHEVAVNALKSSGNVVSLSLKR 287          
BLAST of Disks large homolog 1 vs. Ensembl Celegans
Match: dlg-1 (Disks large homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECY0])

HSP 1 Score: 110.153 bits (274), Expect = 2.595e-26
Identity = 86/245 (35.10%), Postives = 121/245 (49.39%), Query Frame = 2
Query:  458 LEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEY-------VANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTG-------------------GLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFL 1114
            ++D    W    I L KG  G GF++ GG ++P  +GD  I+VT II  GAA  DGR++ +D+I +VN+ N E V HE AV+ LK++G  + L ++R KDE            T+ L   V  TP+    + +H   S                +L + S G                   GLG SI GG    + + D+ I ++K+   G A++DGRL+VGD IL VD  SL   THE AVN L
Sbjct:  145 IDDHGRKWELENIVLEKGHTGLGFSITGGMDQPTEDGDTSIYVTNIIEGGAALADGRMRKNDIITAVNNTNCENVKHEVAVNALKSSGNVVSLSLKRRKDEAFLPIGGNFGGSTSYLRSGV--TPSVSAGNLQHAIHSPSAPIHPPPPPPVHHGSLSQLSVGQYRSTRPNTSVIDLVKGARGLGFSIAGGQGNEHVKGDTDIYVTKIIEEGAAELDGRLRVGDKILEVDHHSLINTTHENAVNVL 387          

HSP 2 Score: 61.2326 bits (147), Expect = 5.150e-10
Identity = 32/89 (35.96%), Postives = 52/89 (58.43%), Query Frame = 2
Query:  887 QFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            + E  ++++   GLG SI GG D    + D+ I ++ +  GG A  DGR++  D+I  V++ +   V HE AVN LK++G  V+L + R
Sbjct:  153 ELENIVLEKGHTGLGFSITGGMDQPTEDGDTSIYVTNIIEGGAALADGRMRKNDIITAVNNTNCENVKHEVAVNALKSSGNVVSLSLKR 241          
BLAST of Disks large homolog 1 vs. Ensembl Celegans
Match: dlg-1 (Disks large homolog 1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECY0])

HSP 1 Score: 110.153 bits (274), Expect = 2.595e-26
Identity = 86/245 (35.10%), Postives = 121/245 (49.39%), Query Frame = 2
Query:  458 LEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEY-------VANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTG-------------------GLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFL 1114
            ++D    W    I L KG  G GF++ GG ++P  +GD  I+VT II  GAA  DGR++ +D+I +VN+ N E V HE AV+ LK++G  + L ++R KDE            T+ L   V  TP+    + +H   S                +L + S G                   GLG SI GG    + + D+ I ++K+   G A++DGRL+VGD IL VD  SL   THE AVN L
Sbjct:  145 IDDHGRKWELENIVLEKGHTGLGFSITGGMDQPTEDGDTSIYVTNIIEGGAALADGRMRKNDIITAVNNTNCENVKHEVAVNALKSSGNVVSLSLKRRKDEAFLPIGGNFGGSTSYLRSGV--TPSVSAGNLQHAIHSPSAPIHPPPPPPVHHGSLSQLSVGQYRSTRPNTSVIDLVKGARGLGFSIAGGQGNEHVKGDTDIYVTKIIEEGAAELDGRLRVGDKILEVDHHSLINTTHENAVNVL 387          

HSP 2 Score: 61.2326 bits (147), Expect = 5.150e-10
Identity = 32/89 (35.96%), Postives = 52/89 (58.43%), Query Frame = 2
Query:  887 QFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            + E  ++++   GLG SI GG D    + D+ I ++ +  GG A  DGR++  D+I  V++ +   V HE AVN LK++G  V+L + R
Sbjct:  153 ELENIVLEKGHTGLGFSITGGMDQPTEDGDTSIYVTNIIEGGAALADGRMRKNDIITAVNNTNCENVKHEVAVNALKSSGNVVSLSLKR 241          
BLAST of Disks large homolog 1 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 72.0182 bits (175), Expect = 2.326e-13
Identity = 69/250 (27.60%), Postives = 111/250 (44.40%), Query Frame = 2
Query:  407 PDYQDPNYNQEYEPEANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIARF 1156
            P+ ++ +  + +  E     EN      +ID  K  KG G ++ GG +         + + ++ ++GAA  DGRLK  D ++ VN  +L  VTH+ ++  L+     + L+I R       N   +L +  Q                          +  FE+ L+K++  GLGISI G      NE   Y+S  ++  GG+A+ DGRL  GD IL V+ K + G   E+    LK     V L + R+
Sbjct:   13 PNQEELSRKKSFSQERTQAIENGRETMIEID--KDGKGLGLSIVGGADTVL----GTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR-----DVNLQLSLLDPTQI-------------------------YNIFEIDLVKKTGRGLGISIVG----RKNEPGVYVS--EIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRW 220          

HSP 2 Score: 54.6842 bits (130), Expect = 7.636e-8
Identity = 38/117 (32.48%), Postives = 59/117 (50.43%), Query Frame = 2
Query:  803 ATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            A PN    S    ++S+ +E  +     +  +  I +   GLG+SI GG D         + I ++   G A  DGRL+ GD +L V+  SL GVTH++++ +L+ T   V L I R
Sbjct:   11 AAPNQEELS---RKKSFSQERTQAIENGRETMIEIDKDGKGLGLSIVGGADTVLG----TVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR 120          
BLAST of Disks large homolog 1 vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 72.4034 bits (176), Expect = 3.157e-13
Identity = 69/250 (27.60%), Postives = 111/250 (44.40%), Query Frame = 2
Query:  407 PDYQDPNYNQEYEPEANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIARF 1156
            P+ ++ +  + +  E     EN      +ID  K  KG G ++ GG +         + + ++ ++GAA  DGRLK  D ++ VN  +L  VTH+ ++  L+     + L+I R       N   +L +  Q                          +  FE+ L+K++  GLGISI G      NE   Y+S  ++  GG+A+ DGRL  GD IL V+ K + G   E+    LK     V L + R+
Sbjct:  523 PNQEELSRKKSFSQERTQAIENGRETMIEID--KDGKGLGLSIVGGADTVL----GTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR-----DVNLQLSLLDPTQI-------------------------YNIFEIDLVKKTGRGLGISIVG----RKNEPGVYVS--EIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRW 730          

HSP 2 Score: 55.4546 bits (132), Expect = 6.869e-8
Identity = 38/117 (32.48%), Postives = 59/117 (50.43%), Query Frame = 2
Query:  803 ATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            A PN    S    ++S+ +E  +     +  +  I +   GLG+SI GG D         + I ++   G A  DGRL+ GD +L V+  SL GVTH++++ +L+ T   V L I R
Sbjct:  521 AAPNQEELS---RKKSFSQERTQAIENGRETMIEIDKDGKGLGLSIVGGADTVLG----TVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR 630          
BLAST of Disks large homolog 1 vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0073484)

HSP 1 Score: 117.472 bits (293), Expect = 7.881e-28
Identity = 88/232 (37.93%), Postives = 125/232 (53.88%), Query Frame = 2
Query:  470 NNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHV----DDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            ++ WLY  I L +G  G GF++AGG + PH   D  I++TK+I+ GAA  DGRL I+D+IVSVNDV++  V H +AVD LK AG  + L ++R +                 TP  G  + +         ++     +  E+ L+K    GLG SI GG    +   D+ I ++KL  GG A VDGRL +GD ++ V     +K+L  VTHE AV  LK+    VTL I +
Sbjct:  506 DDSWLYEDIQLERGNSGLGFSIAGGTDNPHIGTDTSIYITKLISGGAAAADGRLSINDIIVSVNDVSVVDVPHASAVDALKKAGNVVKLHVKRKRG-------------TATTPAAGSAAGDA-------RDSAASGPKVIEIDLVK-GGKGLGFSIAGGIGNQHIPGDNGIYVTKLMDGGAAQVDGRLSIGDKLIAVRTNGSEKNLENVTHELAVATLKSITDKVTLIIGK 716          
BLAST of Disks large homolog 1 vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0301288)

HSP 1 Score: 117.087 bits (292), Expect = 1.490e-27
Identity = 88/232 (37.93%), Postives = 125/232 (53.88%), Query Frame = 2
Query:  470 NNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHV----DDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            ++ WLY  I L +G  G GF++AGG + PH   D  I++TK+I+ GAA  DGRL I+D+IVSVNDV++  V H +AVD LK AG  + L ++R +                 TP  G  + +         ++     +  E+ L+K    GLG SI GG    +   D+ I ++KL  GG A VDGRL +GD ++ V     +K+L  VTHE AV  LK+    VTL I +
Sbjct:  447 DDSWLYEDIQLERGNSGLGFSIAGGTDNPHIGTDTSIYITKLISGGAAAADGRLSINDIIVSVNDVSVVDVPHASAVDALKKAGNVVKLHVKRKRG-------------TATTPAAGSAAGD-------ARDSAASGPKVIEIDLVK-GGKGLGFSIAGGIGNQHIPGDNGIYVTKLMDGGAAQVDGRLSIGDKLIAVRTNGSEKNLENVTHELAVATLKSITDKVTLIIGK 657          

HSP 2 Score: 50.447 bits (119), Expect = 2.930e-6
Identity = 31/80 (38.75%), Postives = 44/80 (55.00%), Query Frame = 2
Query:  905 IKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLF 1144
            I++   GLG +I GG      E+   I +S +  GG AD+   L+ GD +L V++ +L   THEEA   LK +G  VTL 
Sbjct:  747 IQKGPQGLGFNIVGG------EDGQGIYVSFILAGGPADLGSELKRGDQLLSVNNVNLTHATHEEAAQALKTSGGVVTLL 820          
BLAST of Disks large homolog 1 vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0308088)

HSP 1 Score: 116.316 bits (290), Expect = 2.098e-27
Identity = 88/232 (37.93%), Postives = 125/232 (53.88%), Query Frame = 2
Query:  470 NNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHV----DDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            ++ WLY  I L +G  G GF++AGG + PH   D  I++TK+I+ GAA  DGRL I+D+IVSVNDV++  V H +AVD LK AG  + L ++R +                 TP  G  + +         ++     +  E+ L+K    GLG SI GG    +   D+ I ++KL  GG A VDGRL +GD ++ V     +K+L  VTHE AV  LK+    VTL I +
Sbjct:   41 DDSWLYEDIQLERGNSGLGFSIAGGTDNPHIGTDTSIYITKLISGGAAAADGRLSINDIIVSVNDVSVVDVPHASAVDALKKAGNVVKLHVKRKRG-------------TATTPAAGSAAGD-------ARDSAASGPKVIEIDLVKGGK-GLGFSIAGGIGNQHIPGDNGIYVTKLMDGGAAQVDGRLSIGDKLIAVRTNGSEKNLENVTHELAVATLKSITDKVTLIIGK 251          

HSP 2 Score: 50.447 bits (119), Expect = 2.683e-6
Identity = 31/80 (38.75%), Postives = 44/80 (55.00%), Query Frame = 2
Query:  905 IKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLF 1144
            I++   GLG +I GG      E+   I +S +  GG AD+   L+ GD +L V++ +L   THEEA   LK +G  VTL 
Sbjct:  497 IQKGPQGLGFNIVGG------EDGQGIYVSFILAGGPADLGSELKRGDQLLSVNNVNLTHATHEEAAQALKTSGGVVTLL 570          
BLAST of Disks large homolog 1 vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0330390)

HSP 1 Score: 116.316 bits (290), Expect = 2.177e-27
Identity = 91/239 (38.08%), Postives = 128/239 (53.56%), Query Frame = 2
Query:  455 NLEDEN--NPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHV----DDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            NL+  N  + WLY  I L +G  G GF++AGG + PH   D  I++TK+I+ GAA  DGRL I+D+IVSVNDV++  V H +AVD LK AG  + L ++R +                 TP  G  + +         ++     +  E+ L+K    GLG SI GG    +   D+ I ++KL  GG A VDGRL +GD ++ V     +K+L  VTHE AV  LK+    VTL I +
Sbjct:   26 NLDSVNGDDSWLYEDIQLERGNSGLGFSIAGGTDNPHIGTDTSIYITKLISGGAAAADGRLSINDIIVSVNDVSVVDVPHASAVDALKKAGNVVKLHVKRKRG-------------TATTPAAGSAAGD-------ARDSAASGPKVIEIDLVKGGK-GLGFSIAGGIGNQHIPGDNGIYVTKLMDGGAAQVDGRLSIGDKLIAVRTNGSEKNLENVTHELAVATLKSITDKVTLIIGK 243          

HSP 2 Score: 59.3066 bits (142), Expect = 5.756e-9
Identity = 38/101 (37.62%), Postives = 56/101 (55.45%), Query Frame = 2
Query:  851 YHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            ++ ++   D+   +E   ++R   GLG SI GG D  +   D+ I I+KL  GG A  DGRL + D+I+ V+D S+  V H  AV+ LK  G  V L + R
Sbjct:   25 FNLDSVNGDDSWLYEDIQLERGNSGLGFSIAGGTDNPHIGTDTSIYITKLISGGAAAADGRLSINDIIVSVNDVSVVDVPHASAVDALKKAGNVVKLHVKR 125          

HSP 3 Score: 50.8322 bits (120), Expect = 2.625e-6
Identity = 31/80 (38.75%), Postives = 44/80 (55.00%), Query Frame = 2
Query:  905 IKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLF 1144
            I++   GLG +I GG      E+   I +S +  GG AD+   L+ GD +L V++ +L   THEEA   LK +G  VTL 
Sbjct:  489 IQKGPQGLGFNIVGG------EDGQGIYVSFILAGGPADLGSELKRGDQLLSVNNVNLTHATHEEAAQALKTSGGVVTLL 562          
BLAST of Disks large homolog 1 vs. Ensembl Fly
Match: dlg1 (gene:FBgn0001624 transcript:FBtr0073485)

HSP 1 Score: 116.316 bits (290), Expect = 2.189e-27
Identity = 91/239 (38.08%), Postives = 128/239 (53.56%), Query Frame = 2
Query:  455 NLEDEN--NPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHV----DDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            NL+  N  + WLY  I L +G  G GF++AGG + PH   D  I++TK+I+ GAA  DGRL I+D+IVSVNDV++  V H +AVD LK AG  + L ++R +                 TP  G  + +         ++     +  E+ L+K    GLG SI GG    +   D+ I ++KL  GG A VDGRL +GD ++ V     +K+L  VTHE AV  LK+    VTL I +
Sbjct:   26 NLDSVNGDDSWLYEDIQLERGNSGLGFSIAGGTDNPHIGTDTSIYITKLISGGAAAADGRLSINDIIVSVNDVSVVDVPHASAVDALKKAGNVVKLHVKRKRG-------------TATTPAAGSAAGD-------ARDSAASGPKVIEIDLVKGGK-GLGFSIAGGIGNQHIPGDNGIYVTKLMDGGAAQVDGRLSIGDKLIAVRTNGSEKNLENVTHELAVATLKSITDKVTLIIGK 243          

HSP 2 Score: 58.9214 bits (141), Expect = 6.536e-9
Identity = 38/101 (37.62%), Postives = 56/101 (55.45%), Query Frame = 2
Query:  851 YHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            ++ ++   D+   +E   ++R   GLG SI GG D  +   D+ I I+KL  GG A  DGRL + D+I+ V+D S+  V H  AV+ LK  G  V L + R
Sbjct:   25 FNLDSVNGDDSWLYEDIQLERGNSGLGFSIAGGTDNPHIGTDTSIYITKLISGGAAAADGRLSINDIIVSVNDVSVVDVPHASAVDALKKAGNVVKLHVKR 125          

HSP 3 Score: 50.447 bits (119), Expect = 2.786e-6
Identity = 31/80 (38.75%), Postives = 44/80 (55.00%), Query Frame = 2
Query:  905 IKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLF 1144
            I++   GLG +I GG      E+   I +S +  GG AD+   L+ GD +L V++ +L   THEEA   LK +G  VTL 
Sbjct:  489 IQKGPQGLGFNIVGG------EDGQGIYVSFILAGGPADLGSELKRGDQLLSVNNVNLTHATHEEAAQALKTSGGVVTLL 562          
BLAST of Disks large homolog 1 vs. Ensembl Zebrafish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 119.398 bits (298), Expect = 2.977e-28
Identity = 88/223 (39.46%), Postives = 115/223 (51.57%), Query Frame = 2
Query:  485 YFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            Y +I L +G  G GF++AGG + PH   D GIF+TKII  GAA +DGRL ++D ++ VNDV++  V H  AV+ LK AG  + L++RR                 QA P T                         EV L+K    GLG SI GG    +   D+ I I+K+  GG A  DGRLQ GD +L V++  L  V HEEAV  LKNT   V L +A+
Sbjct:  148 YEEIILERGNSGLGFSIAGGMDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNDVDVSEVVHSKAVEALKEAGPVVRLLVRRR----------------QAPPET-----------------------ILEVNLLK-GPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIILQDVRHEEAVAALKNTSDMVYLKVAK 330          

HSP 2 Score: 106.686 bits (265), Expect = 4.851e-24
Identity = 83/251 (33.07%), Postives = 124/251 (49.40%), Query Frame = 2
Query:  476 PWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYV---------------ANETTNLHEVVQATPNTGYYSPEHEQESY----HEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIARF 1156
            P    +++L KG KG GF++AGG    H  GDN I++TKII  GAA+ DGRL+  D +++VN++ L+ V HE AV  LKN    + L + +     L D Y                    +++  +    P   Y  P+     Y         E D  ++    L+ + + GLG +I GG      E+   I +S +  GG AD+ G L+ GD IL V+  +L   THE+A   LK  G+TVT+ IA++
Sbjct:  240 PETILEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIILQDVRHEEAVAALKNTSDMVYLKVAKPGPVHLNDMYAPPDYSSTFPTMVDNHVGHNSSMAYMGGMEPKPVYQPPQVTPSRYSPVPRHMLGEEDFTREPRKILLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTI-IAQY 483          

HSP 3 Score: 76.2554 bits (186), Expect = 2.573e-14
Identity = 38/94 (40.43%), Postives = 55/94 (58.51%), Query Frame = 2
Query:  872 NDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            +D   ++E  +++R   GLG SI GG D  +  +D  I I+K+ PGG A +DGRL V D +L V+D  ++ V H +AV  LK  G  V L + R
Sbjct:  142 SDGMYKYEEIILERGNSGLGFSIAGGMDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNDVDVSEVVHSKAVEALKEAGPVVRLLVRR 235          

HSP 4 Score: 53.9138 bits (128), Expect = 2.895e-7
Identity = 59/181 (32.60%), Postives = 80/181 (44.20%), Query Frame = 2
Query:  344 IASPKPVSKVKSNDNYEPEDY---------------------------PDYQDPNYN-QEYEPEAN--LEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEV 796
            +A P PV     ND Y P DY                           P YQ P      Y P     L +E+      +I L+KG  G GF + GG      E   GIFV+ I+  G A++ G L+  D I+SVN VNL   THE A   LK AGQ++ +I +   +EY   E + +H++
Sbjct:  328 VAKPGPVH---LNDMYAPPDYSSTFPTMVDNHVGHNSSMAYMGGMEPKPVYQPPQVTPSRYSPVPRHMLGEEDFTREPRKILLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTIIAQYRPEEYSRFE-SKIHDL 498          
BLAST of Disks large homolog 1 vs. Ensembl Zebrafish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 119.398 bits (298), Expect = 3.035e-28
Identity = 88/223 (39.46%), Postives = 115/223 (51.57%), Query Frame = 2
Query:  485 YFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            Y +I L +G  G GF++AGG + PH   D GIF+TKII  GAA +DGRL ++D ++ VNDV++  V H  AV+ LK AG  + L++RR                 QA P T                         EV L+K    GLG SI GG    +   D+ I I+K+  GG A  DGRLQ GD +L V++  L  V HEEAV  LKNT   V L +A+
Sbjct:  148 YEEIILERGNSGLGFSIAGGMDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNDVDVSEVVHSKAVEALKEAGPVVRLLVRRR----------------QAPPET-----------------------ILEVNLLK-GPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIILQDVRHEEAVAALKNTSDMVYLKVAK 330          

HSP 2 Score: 104.375 bits (259), Expect = 2.800e-23
Identity = 83/257 (32.30%), Postives = 124/257 (48.25%), Query Frame = 2
Query:  476 PWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYV---------------------ANETTNLHEVVQATPNTGYYSPEHEQESY----HEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIARF 1156
            P    +++L KG KG GF++AGG    H  GDN I++TKII  GAA+ DGRL+  D +++VN++ L+ V HE AV  LKN    + L + +     L D Y                          +++  +    P   Y  P+     Y         E D  ++    L+ + + GLG +I GG      E+   I +S +  GG AD+ G L+ GD IL V+  +L   THE+A   LK  G+TVT+ IA++
Sbjct:  240 PETILEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIILQDVRHEEAVAALKNTSDMVYLKVAKPGPVHLNDMYAPPDYSSSLGLPPAFPTMVDNHVGHNSSMAYMGGMEPKPVYQPPQVTPSRYSPVPRHMLGEEDFTREPRKILLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTI-IAQY 489          

HSP 3 Score: 76.2554 bits (186), Expect = 2.568e-14
Identity = 38/94 (40.43%), Postives = 55/94 (58.51%), Query Frame = 2
Query:  872 NDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            +D   ++E  +++R   GLG SI GG D  +  +D  I I+K+ PGG A +DGRL V D +L V+D  ++ V H +AV  LK  G  V L + R
Sbjct:  142 SDGMYKYEEIILERGNSGLGFSIAGGMDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNDVDVSEVVHSKAVEALKEAGPVVRLLVRR 235          

HSP 4 Score: 53.9138 bits (128), Expect = 3.488e-7
Identity = 50/136 (36.76%), Postives = 70/136 (51.47%), Query Frame = 2
Query:  398 EDYPDYQDPNYN-QEYEPEAN--LEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEV 796
            E  P YQ P      Y P     L +E+      +I L+KG  G GF + GG      E   GIFV+ I+  G A++ G L+  D I+SVN VNL   THE A   LK AGQ++ +I +   +EY   E + +H++
Sbjct:  376 EPKPVYQPPQVTPSRYSPVPRHMLGEEDFTREPRKILLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTIIAQYRPEEYSRFE-SKIHDL 504          
BLAST of Disks large homolog 1 vs. Ensembl Zebrafish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 119.398 bits (298), Expect = 3.104e-28
Identity = 88/223 (39.46%), Postives = 115/223 (51.57%), Query Frame = 2
Query:  485 YFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            Y +I L +G  G GF++AGG + PH   D GIF+TKII  GAA +DGRL ++D ++ VNDV++  V H  AV+ LK AG  + L++RR                 QA P T                         EV L+K    GLG SI GG    +   D+ I I+K+  GG A  DGRLQ GD +L V++  L  V HEEAV  LKNT   V L +A+
Sbjct:  130 YEEIILERGNSGLGFSIAGGMDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNDVDVSEVVHSKAVEALKEAGPVVRLLVRRR----------------QAPPET-----------------------ILEVNLLK-GPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIILQDVRHEEAVAALKNTSDMVYLKVAK 312          

HSP 2 Score: 104.375 bits (259), Expect = 2.666e-23
Identity = 83/257 (32.30%), Postives = 124/257 (48.25%), Query Frame = 2
Query:  476 PWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYV---------------------ANETTNLHEVVQATPNTGYYSPEHEQESY----HEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIARF 1156
            P    +++L KG KG GF++AGG    H  GDN I++TKII  GAA+ DGRL+  D +++VN++ L+ V HE AV  LKN    + L + +     L D Y                          +++  +    P   Y  P+     Y         E D  ++    L+ + + GLG +I GG      E+   I +S +  GG AD+ G L+ GD IL V+  +L   THE+A   LK  G+TVT+ IA++
Sbjct:  222 PETILEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIILQDVRHEEAVAALKNTSDMVYLKVAKPGPVHLNDMYAPPDYSSSLGLPPAFPTMVDNHVGHNSSMAYMGGMEPKPVYQPPQVTPSRYSPVPRHMLGEEDFTREPRKILLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTI-IAQY 471          

HSP 3 Score: 76.2554 bits (186), Expect = 2.588e-14
Identity = 38/101 (37.62%), Postives = 59/101 (58.42%), Query Frame = 2
Query:  851 YHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            ++++   +D   ++E  +++R   GLG SI GG D  +  +D  I I+K+ PGG A +DGRL V D +L V+D  ++ V H +AV  LK  G  V L + R
Sbjct:  117 WYDQVNGSDGMYKYEEIILERGNSGLGFSIAGGMDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNDVDVSEVVHSKAVEALKEAGPVVRLLVRR 217          

HSP 4 Score: 53.9138 bits (128), Expect = 3.378e-7
Identity = 50/136 (36.76%), Postives = 70/136 (51.47%), Query Frame = 2
Query:  398 EDYPDYQDPNYN-QEYEP--EANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEV 796
            E  P YQ P      Y P     L +E+      +I L+KG  G GF + GG      E   GIFV+ I+  G A++ G L+  D I+SVN VNL   THE A   LK AGQ++ +I +   +EY   E + +H++
Sbjct:  358 EPKPVYQPPQVTPSRYSPVPRHMLGEEDFTREPRKILLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTIIAQYRPEEYSRFE-SKIHDL 486          
BLAST of Disks large homolog 1 vs. Ensembl Zebrafish
Match: dlg1l (discs, large (Drosophila) homolog 1, like [Source:NCBI gene;Acc:497648])

HSP 1 Score: 117.857 bits (294), Expect = 6.290e-28
Identity = 87/237 (36.71%), Postives = 124/237 (52.32%), Query Frame = 2
Query:  488 FQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNLHE------------VVQATP--NTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
             +I L KG KG GF++AGG    H  GDN I+VTKII  GAA  DGRL+I D +++VN   LE VTHE AV  LKN    + L + +     + D +   + TN +             + Q  P  ++G +SP  +         ++D  ++    ++ R T GLG +I GG      E+   I IS +  GG AD+ G L+ GD ++ V+   L G THE+A   LKN G+TVT+
Sbjct:  247 MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKLLAVNSSCLEEVTHEHAVTALKNTPDVVYLKVAKPNSVFMNDSFAPPDITNSYSQHMENHISPPSYLSQPLPPVHSGRFSPTPKTTV-----GDDDVTREPRKVVLHRGTTGLGFNIVGG------EDGEGIFISFILAGGPADLCGELRKGDRLVSVNGIDLRGATHEQAAAALKNAGQTVTI 472          

HSP 2 Score: 117.087 bits (292), Expect = 1.161e-27
Identity = 86/223 (38.57%), Postives = 116/223 (52.02%), Query Frame = 2
Query:  485 YFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            Y +I L +G  G GF++AGG + PH   D  IF+TK+I  GAA  DGRL+++DVI+ VN+V++  VTH  AV+ LK AG  + L +RR K    A+E                                    +  E+ LIK    GLG SI GG    +   D+ I ++K+  GG A  DGRLQ+GD +L V+   L  VTHE AV  LKNT   V L +A+
Sbjct:  151 YEEITLERGNSGLGFSIAGGTDNPHIGEDPSIFITKVIPGGAAAQDGRLRVNDVILRVNEVDVRDVTHSKAVEALKEAGSLVRLYVRRRKS---ASE------------------------------------KVMEIKLIK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKLLAVNSSCLEEVTHEHAVTALKNTPDVVYLKVAK 333          

HSP 3 Score: 77.0258 bits (188), Expect = 1.562e-14
Identity = 43/97 (44.33%), Postives = 58/97 (59.79%), Query Frame = 2
Query:  863 NAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            N    +F+  E+TL +R   GLG SI GG D  +  ED  I I+K+ PGG A  DGRL+V D+IL V++  +  VTH +AV  LK  G  V L++ R
Sbjct:  143 NGTEADFEYEEITL-ERGNSGLGFSIAGGTDNPHIGEDPSIFITKVIPGGAAAQDGRLRVNDVILRVNEVDVRDVTHSKAVEALKEAGSLVRLYVRR 238          

HSP 4 Score: 52.373 bits (124), Expect = 7.657e-7
Identity = 36/106 (33.96%), Postives = 60/106 (56.60%), Query Frame = 2
Query:  446 PEANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEY 763
            P+  + D++      ++ L++G  G GF + GG      E   GIF++ I+  G A++ G L+  D +VSVN ++L   THE A   LKNAGQ++ ++ +   +EY
Sbjct:  382 PKTTVGDDDVTREPRKVVLHRGTTGLGFNIVGG------EDGEGIFISFILAGGPADLCGELRKGDRLVSVNGIDLRGATHEQAAAALKNAGQTVTIVAQYRPEEY 481          
BLAST of Disks large homolog 1 vs. Ensembl Zebrafish
Match: dlg2 (discs, large homolog 2 (Drosophila) [Source:NCBI gene;Acc:497638])

HSP 1 Score: 117.857 bits (294), Expect = 8.493e-28
Identity = 84/223 (37.67%), Postives = 116/223 (52.02%), Query Frame = 2
Query:  485 YFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            + +I L +G  G GF++AGG + PH   D GIF+TKII  GAA  DGRL+++D I+ VN+ ++  V+H  AV+ LK AG  + L +RR +          + E V                               E+ LIK    GLG SI GG    +   D+ I ++K+  GG A  DGRLQVGD +L V++ +L  VTHEEAV  LKNT   V L + +
Sbjct:  134 FEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNESDVSEVSHSKAVEALKAAGSIVRLYVRRRRP---------MLETVT------------------------------EIKLIK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYTLEEVTHEEAVAILKNTSDVVYLKVGK 316          

HSP 2 Score: 107.842 bits (268), Expect = 1.706e-24
Identity = 93/263 (35.36%), Postives = 127/263 (48.29%), Query Frame = 2
Query:  491 QIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNLHEVVQATPN---------------------TGYYS--PEH--------EQESYHEENAENDNFQQFEV-----TLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIARF 1156
            +I L KG KG GF++AGG    H  GDN I+VTKII  GAA+ DGRL++ D ++ VN+  LE VTHE AV  LKN    + L + +     L D Y   + T  H    A  N                      G YS  P+H           S  E      + Q F++      ++ + + GLG +I GG      E+   I +S +  GG AD+ G L+ GD IL V+   L G THE+A   LK  G+TVT+ IA++
Sbjct:  231 EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYTLEEVTHEEAVAILKNTSDVVYLKVGKPTSVYLSDPYGPPDIT--HSFSPAMENHISSPGNNGTLEYKSSLPPISPGRYSPLPKHLLGEEDINRNPSLDEMEGHRFDSQHFQLREPRKIVLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDQILSVNGIDLRGATHEQAAAALKGAGQTVTI-IAQY 484          

HSP 3 Score: 74.3294 bits (181), Expect = 1.183e-13
Identity = 38/89 (42.70%), Postives = 54/89 (60.67%), Query Frame = 2
Query:  887 QFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            +FE   ++R   GLG SI GG D  +  +D  I I+K+ PGG A  DGRL+V D IL V++  ++ V+H +AV  LK  G  V L++ R
Sbjct:  133 EFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNESDVSEVSHSKAVEALKAAGSIVRLYVRR 221          

HSP 4 Score: 53.1434 bits (126), Expect = 5.133e-7
Identity = 37/91 (40.66%), Postives = 53/91 (58.24%), Query Frame = 2
Query:  491 QIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEY 763
            +I L+KG  G GF + GG      E   GIFV+ I+  G A++ G L+  D I+SVN ++L   THE A   LK AGQ++ +I +   +EY
Sbjct:  405 KIVLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDQILSVNGIDLRGATHEQAAAALKGAGQTVTIIAQYRPEEY 489          
BLAST of Disks large homolog 1 vs. Ensembl Xenopus
Match: pinx1 (PIN2 (TERF1) interacting telomerase inhibitor 1 [Source:Xenbase;Acc:XB-GENE-951063])

HSP 1 Score: 147.517 bits (371), Expect = 1.414e-37
Identity = 133/388 (34.28%), Postives = 192/388 (49.48%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSL--SSAISGNKSPVQPVYNDIIPEAKLEVQETPVXXXXXXXXXXXXXXXXXXXXXXXIASPKPVSKVKSNDNYEPEDYPDYQDPNY--NQEYEPEANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            M +RK DT+RA+ LL+ Y+ KL+++E+K L+K++E++I   ++ LF AL+DIQEFYEV+L  +   S N  P +PV      E       T        S          +     I    PV  V +  N  P   P    P    N + E  A +   +  + Y +I L +G  G GF++AGG + PH   D  IF+TKII+ GAA  DGRL+++D I+ VN+V++  VTH  AV+ LK AG  + L +RR K                         P  E              +  ++ L+K    GLG SI GG    +   D+ I ++K+  GG A  DGRLQ+GD +L V+   L  V+HE+AV  LKNT   V L +A+
Sbjct:    1 MPVRKQDTQRALTLLEEYRCKLHQTEDKQLRKSIERVIGIFQSNLFQALIDIQEFYEVTLLDNPKSSDNAKPTEPVQTINTWEYSSLPNSTATCETLPSSLILNVETPEADTPCPPIVPVIPVIPVPAESNVIPSSTPQANPPPVIVNTDLETPAYVNGTDAEYEYEEITLERGTSGLGFSIAGGTDNPHIGDDISIFITKIISGGAAAQDGRLRVNDCILRVNEVDVHDVTHSKAVEALKEAGSIVRLYVRRRK-------------------------PVTE--------------KIMDIKLVK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKLLAVNTVCLEEVSHEDAVTALKNTSDFVNLKVAK 348          

HSP 2 Score: 116.316 bits (290), Expect = 3.808e-27
Identity = 90/235 (38.30%), Postives = 122/235 (51.91%), Query Frame = 2
Query:  494 IDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNLHEVV-------------QATPNTGYYSPEHEQESYHEENAENDNF-QQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
            I L KG KG GF++AGG    H  GDN I+VTKII  GAA  DGRL+I D +++VN V LE V+HE AV  LKN    + L + +     + D Y   + TN +                   P+ G YSP  +         E+D+  ++    +++R T GLG +I GG      E+   I IS +  GG AD+ G LQ GD I+ V+   L   THE+A   LKN G+TVT+
Sbjct:  264 IKLVKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKLLAVNTVCLEEVSHEDAVTALKNTSDFVNLKVAKPTTMYMNDNYAPPDITNSYSQQVDNHISPSGFIGHPLPPSPGRYSPAPKG------MLEDDDLTREPRKVVLQRGTTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELQKGDRIMSVNGVDLKSATHEQAAAALKNAGQTVTI 486          

HSP 3 Score: 55.8398 bits (133), Expect = 1.044e-7
Identity = 39/106 (36.79%), Postives = 61/106 (57.55%), Query Frame = 2
Query:  446 PEANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEY 763
            P+  LED++      ++ L +G  G GF + GG      E   GIF++ I+  G A++ G L+  D I+SVN V+L+  THE A   LKNAGQ++ ++ +   +EY
Sbjct:  396 PKGMLEDDDLTREPRKVVLQRGTTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELQKGDRIMSVNGVDLKSATHEQAAAALKNAGQTVTIVAQYRPEEY 495          
BLAST of Disks large homolog 1 vs. Ensembl Xenopus
Match: pinx1 (PIN2 (TERF1) interacting telomerase inhibitor 1 [Source:Xenbase;Acc:XB-GENE-951063])

HSP 1 Score: 122.479 bits (306), Expect = 3.190e-29
Identity = 91/230 (39.57%), Postives = 124/230 (53.91%), Query Frame = 2
Query:  494 IDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNLHEVVQAT--------PNTGYYSPEHEQESYHEENAENDNF-QQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
            I L KG KG GF++AGG    H  GDN I+VTKII  GAA  DGRL+I D +++VN V LE V+HE AV  LKN    + L + +     + D Y   + TNL   +  +        P+ G YSP  +         E+D+  ++    +++R T GLG +I GG      E+   I IS +  GG AD+ G LQ GD I+ V+   L   THE+A   LKN G+TVT+
Sbjct:  195 IKLVKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKLLAVNTVCLEEVSHEDAVTALKNTSDFVNLKVAKPTTMYMNDNYAPPDITNLDNHISPSGFIGHPLPPSPGRYSPAPKG------MLEDDDLTREPRKVVLQRGTTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELQKGDRIMSVNGVDLKSATHEQAAAALKNAGQTVTI 412          

HSP 2 Score: 114.39 bits (285), Expect = 1.596e-26
Identity = 90/261 (34.48%), Postives = 128/261 (49.04%), Query Frame = 2
Query:  377 SNDNYEPEDYPDYQDPNY--NQEYEPEANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            +  N  P   P    P    N + E  A +   +  + Y +I L +G  G GF++AGG + PH   D  IF+TKII+ GAA  DGRL+++D I+ VN+V++  VTH  AV+ LK AG  + L +RR K                         P  E              +  ++ L+K    GLG SI GG    +   D+ I ++K+  GG A  DGRLQ+GD +L V+   L  V+HE+AV  LKNT   V L +A+
Sbjct:   59 AESNVIPSSTPQANPPPVIVNTDLETPAYVNGTDAEYEYEEITLERGTSGLGFSIAGGTDNPHIGDDISIFITKIISGGAAAQDGRLRVNDCILRVNEVDVHDVTHSKAVEALKEAGSIVRLYVRRRK-------------------------PVTE--------------KIMDIKLVK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKLLAVNTVCLEEVSHEDAVTALKNTSDFVNLKVAK 279          

HSP 3 Score: 56.225 bits (134), Expect = 7.321e-8
Identity = 47/142 (33.10%), Postives = 71/142 (50.00%), Query Frame = 2
Query:  380 NDNYEPEDYPDYQD------------PNYNQEYEP--EANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEY 763
            NDNY P D  +  +            P     Y P  +  LED++      ++ L +G  G GF + GG      E   GIF++ I+  G A++ G L+  D I+SVN V+L+  THE A   LKNAGQ++ ++ +   +EY
Sbjct:  286 NDNYAPPDITNLDNHISPSGFIGHPLPPSPGRYSPAPKGMLEDDDLTREPRKVVLQRGTTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELQKGDRIMSVNGVDLKSATHEQAAAALKNAGQTVTIVAQYRPEEY 421          
BLAST of Disks large homolog 1 vs. Ensembl Xenopus
Match: hmmr (hyaluronan-mediated motility receptor (RHAMM) [Source:Xenbase;Acc:XB-GENE-5851601])

HSP 1 Score: 122.094 bits (305), Expect = 4.342e-29
Identity = 88/237 (37.13%), Postives = 123/237 (51.90%), Query Frame = 2
Query:  443 EPEANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            +P +++   +  + Y +I L +G  G GF++AGG + PH   D GIF+TKII  GAA +DGRL + D ++ VNDV++  V H  AV+ LK AG  + L++RR                 Q+ P T                         EV L+K    GLG SI GG    +   D+ I I+K+  GG A  DGRLQ+GD +L V++ +L  V HEEAV  LKNT   V L +A+
Sbjct:  124 DPGSSVNGSDTLYKYEEIVLERGNSGLGFSIAGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLSVSDCVLRVNDVDVTEVVHSKAVEALKEAGPVVRLLVRRR----------------QSPPET-----------------------IVEVNLLK-GPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVAALKNTSDMVYLKVAK 320          

HSP 2 Score: 103.99 bits (258), Expect = 4.928e-23
Identity = 86/251 (34.26%), Postives = 125/251 (49.80%), Query Frame = 2
Query:  467 ENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR----------LKDEYVANETTNLHEVVQATPNTGYYSPEHEQES----------------YHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
            ++ P    +++L KG KG GF++AGG    H  GDN I++TKII  GAA+ DGRL+I D +++VN+ NL+ V HE AV  LKN    + L + +             +Y +  T + H  +      G Y    E +S                 H    E+   +  ++ L K ST GLG +I GG      E+   I +S +  GG AD+ G L+ GD IL V+  +L   THE+A   LK  G+TVT+
Sbjct:  227 QSPPETIVEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVAALKNTSDMVYLKVAKPGPVHLNEIYAPPDYASTFTVDNH--ISHNSTLGAYLSSMESKSPYPPPQVTPSRFSPVPRHMLGEEDFTREPRKIILHKGST-GLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRSATHEQAAAALKRAGQTVTI 468          

HSP 3 Score: 53.5286 bits (127), Expect = 5.380e-7
Identity = 39/96 (40.62%), Postives = 55/96 (57.29%), Query Frame = 2
Query:  491 QIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANET 778
            +I L+KG  G GF + GG      E   GIFV+ I+  G A++ G L+  D I+SVN VNL   THE A   LK AGQ++ ++ +   +EY   E+
Sbjct:  393 KIILHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRSATHEQAAAALKRAGQTVTIVAQYRPEEYSRFES 482          
BLAST of Disks large homolog 1 vs. Ensembl Xenopus
Match: hmmr (hyaluronan-mediated motility receptor (RHAMM) [Source:Xenbase;Acc:XB-GENE-5851601])

HSP 1 Score: 122.094 bits (305), Expect = 4.876e-29
Identity = 88/237 (37.13%), Postives = 123/237 (51.90%), Query Frame = 2
Query:  443 EPEANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            +P +++   +  + Y +I L +G  G GF++AGG + PH   D GIF+TKII  GAA +DGRL + D ++ VNDV++  V H  AV+ LK AG  + L++RR                 Q+ P T                         EV L+K    GLG SI GG    +   D+ I I+K+  GG A  DGRLQ+GD +L V++ +L  V HEEAV  LKNT   V L +A+
Sbjct:  124 DPGSSVNGSDTLYKYEEIVLERGNSGLGFSIAGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLSVSDCVLRVNDVDVTEVVHSKAVEALKEAGPVVRLLVRRR----------------QSPPET-----------------------IVEVNLLK-GPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVAALKNTSDMVYLKVAK 320          

HSP 2 Score: 103.605 bits (257), Expect = 5.589e-23
Identity = 86/251 (34.26%), Postives = 125/251 (49.80%), Query Frame = 2
Query:  467 ENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR----------LKDEYVANETTNLHEVVQATPNTGYYSPEHEQES----------------YHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
            ++ P    +++L KG KG GF++AGG    H  GDN I++TKII  GAA+ DGRL+I D +++VN+ NL+ V HE AV  LKN    + L + +             +Y +  T + H  +      G Y    E +S                 H    E+   +  ++ L K ST GLG +I GG      E+   I +S +  GG AD+ G L+ GD IL V+  +L   THE+A   LK  G+TVT+
Sbjct:  227 QSPPETIVEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVAALKNTSDMVYLKVAKPGPVHLNEIYAPPDYASTFTVDNH--ISHNSTLGAYLSSMESKSPYPPPQVTPSRFSPVPRHMLGEEDFTREPRKIILHKGST-GLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRSATHEQAAAALKRAGQTVTI 468          

HSP 3 Score: 53.9138 bits (128), Expect = 5.105e-7
Identity = 39/96 (40.62%), Postives = 55/96 (57.29%), Query Frame = 2
Query:  491 QIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANET 778
            +I L+KG  G GF + GG      E   GIFV+ I+  G A++ G L+  D I+SVN VNL   THE A   LK AGQ++ ++ +   +EY   E+
Sbjct:  393 KIILHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRSATHEQAAAALKRAGQTVTIVAQYRPEEYSRFES 482          
BLAST of Disks large homolog 1 vs. Ensembl Xenopus
Match: hmmr (hyaluronan-mediated motility receptor (RHAMM) [Source:Xenbase;Acc:XB-GENE-5851601])

HSP 1 Score: 121.709 bits (304), Expect = 4.976e-29
Identity = 88/237 (37.13%), Postives = 123/237 (51.90%), Query Frame = 2
Query:  443 EPEANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            +P +++   +  + Y +I L +G  G GF++AGG + PH   D GIF+TKII  GAA +DGRL + D ++ VNDV++  V H  AV+ LK AG  + L++RR                 Q+ P T                         EV L+K    GLG SI GG    +   D+ I I+K+  GG A  DGRLQ+GD +L V++ +L  V HEEAV  LKNT   V L +A+
Sbjct:   38 DPGSSVNGSDTLYKYEEIVLERGNSGLGFSIAGGIDNPHVPDDPGIFITKIIPGGAAAMDGRLSVSDCVLRVNDVDVTEVVHSKAVEALKEAGPVVRLLVRRR----------------QSPPET-----------------------IVEVNLLK-GPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVAALKNTSDMVYLKVAK 234          

HSP 2 Score: 106.686 bits (265), Expect = 4.732e-24
Identity = 85/246 (34.55%), Postives = 125/246 (50.81%), Query Frame = 2
Query:  467 ENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNLHEVVQATPNTGYYSPEHEQES----------------YHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
            ++ P    +++L KG KG GF++AGG    H  GDN I++TKII  GAA+ DGRL+I D +++VN+ NL+ V HE AV  LKN    + L + +     L + Y   +  ++   +      G Y    E +S                 H    E+   +  ++ L K ST GLG +I GG      E+   I +S +  GG AD+ G L+ GD IL V+  +L   THE+A   LK  G+TVT+
Sbjct:  141 QSPPETIVEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAVNNTNLQDVRHEEAVAALKNTSDMVYLKVAKPGPVHLNEIYAPPDYASIDNHISHNSTLGAYLSSMESKSPYPPPQVTPSRFSPVPRHMLGEEDFTREPRKIILHKGST-GLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRSATHEQAAAALKRAGQTVTI 379          

HSP 3 Score: 53.1434 bits (126), Expect = 6.795e-7
Identity = 39/96 (40.62%), Postives = 55/96 (57.29%), Query Frame = 2
Query:  491 QIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANET 778
            +I L+KG  G GF + GG      E   GIFV+ I+  G A++ G L+  D I+SVN VNL   THE A   LK AGQ++ ++ +   +EY   E+
Sbjct:  304 KIILHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRSATHEQAAAALKRAGQTVTIVAQYRPEEYSRFES 393          
BLAST of Disks large homolog 1 vs. Ensembl Mouse
Match: Dlg1 (discs large MAGUK scaffold protein 1 [Source:MGI Symbol;Acc:MGI:107231])

HSP 1 Score: 119.398 bits (298), Expect = 1.383e-28
Identity = 96/269 (35.69%), Postives = 133/269 (49.44%), Query Frame = 2
Query:  347 ASPKPVSKVKSNDNYEPEDYPDYQDPNYNQEYEPEANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            A+P PV  + + D+ E   Y +  D +Y  EYE               +I L +G  G GF++AGG + PH   D+ IF+TKIIT GAA  DGRL+++D I+ VN+ ++  VTH  AV+ LK AG  + L ++R K                         P  E              +  E+ LIK    GLG SI GG    +   D+ I ++K+  GG A  DG+LQ+GD +L V+   L  VTHEEAV  LKNT   V L +A+
Sbjct:  162 ANPPPV--LVNTDSLETPTYVNGTDADY--EYE---------------EITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAGSIVRLYVKRRK-------------------------PASE--------------KIMEIKLIK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAK 371          

HSP 2 Score: 100.138 bits (248), Expect = 4.064e-22
Identity = 81/221 (36.65%), Postives = 117/221 (52.94%), Query Frame = 2
Query:  488 FQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR--LKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLF 1144
             +I L KG KG GF++AGG    H  GDN I+VTKII  GAA  DG+L+I D +++VN V LE VTHE AV  LKN    + L + +     + V N  +    + Q   +   YSP  +         +++  ++    ++ R + GLG +I GG      E+   I IS +  GG AD+ G L+ GD I+ V+   L   +HE+A   LKN G+ VT+ 
Sbjct:  285 MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAKPTTSSQSVDNHVSPSSCLGQTPTSPARYSPISKAVL-----GDDEITREPRKVVLHRGSTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIV 494          

HSP 3 Score: 57.3806 bits (137), Expect = 2.519e-8
Identity = 36/79 (45.57%), Postives = 59/79 (74.68%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSL---SSAISGNKS--PVQPV 223
            M +RK DT+RA++LL+ Y+SKL+++E++ L+ ++E++I+  ++ LF AL+DIQEFYEV+L      +  +K   PVQPV
Sbjct:    1 MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCVDHSKQCEPVQPV 79          

HSP 4 Score: 50.447 bits (119), Expect = 4.085e-6
Identity = 46/138 (33.33%), Postives = 71/138 (51.45%), Query Frame = 2
Query:  356 KPVSKVKSNDNYEPEDYPDYQDPNYNQEYEP--EANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEY 763
            KP +  +S DN+        Q P     Y P  +A L D+       ++ L++G  G GF + GG      E   GIF++ I+  G A++ G L+  D I+SVN V+L   +HE A   LKNAGQ++ ++ +   +EY
Sbjct:  371 KPTTSSQSVDNHVSPSSCLGQTPTSPARYSPISKAVLGDDEITREPRKVVLHRGSTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTIVAQYRPEEY 502          
BLAST of Disks large homolog 1 vs. Ensembl Mouse
Match: Dlg1 (discs large MAGUK scaffold protein 1 [Source:MGI Symbol;Acc:MGI:107231])

HSP 1 Score: 120.168 bits (300), Expect = 1.707e-28
Identity = 85/223 (38.12%), Postives = 116/223 (52.02%), Query Frame = 2
Query:  485 YFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            Y +I L +G  G GF++AGG + PH   D+ IF+TKIIT GAA  DGRL+++D I+ VN+ ++  VTH  AV+ LK AG  + L ++R K                         P  E              +  E+ LIK    GLG SI GG    +   D+ I ++K+  GG A  DG+LQ+GD +L V+   L  VTHEEAV  LKNT   V L +A+
Sbjct:  222 YEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAGSIVRLYVKRRK-------------------------PASE--------------KIMEIKLIK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAK 404          

HSP 2 Score: 97.4413 bits (241), Expect = 4.360e-21
Identity = 84/235 (35.74%), Postives = 120/235 (51.06%), Query Frame = 2
Query:  488 FQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNL-----------HEVVQATPNT-GYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
             +I L KG KG GF++AGG    H  GDN I+VTKII  GAA  DG+L+I D +++VN V LE VTHE AV  LKN    + L + +     + D Y   + TN               +  TP +   YSP  +         +++  ++    ++ R + GLG +I GG      E+   I IS +  GG AD+ G L+ GD I+ V+   L   +HE+A   LKN G+ VT+
Sbjct:  318 MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYINDGYAPPDITNSSSQSVDNHVSPSSCLGQTPTSPARYSPISKAVL-----GDDEITREPRKVVLHRGSTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTI 541          

HSP 3 Score: 74.7146 bits (182), Expect = 1.125e-13
Identity = 41/97 (42.27%), Postives = 58/97 (59.79%), Query Frame = 2
Query:  863 NAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            N  + +++  E+TL +R   GLG SI GG D  +  +DS I I+K+  GG A  DGRL+V D IL V++  +  VTH +AV  LK  G  V L++ R
Sbjct:  214 NGTDADYEYEEITL-ERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAGSIVRLYVKR 309          

HSP 4 Score: 57.7658 bits (138), Expect = 2.248e-8
Identity = 36/79 (45.57%), Postives = 59/79 (74.68%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSL---SSAISGNKS--PVQPV 223
            M +RK DT+RA++LL+ Y+SKL+++E++ L+ ++E++I+  ++ LF AL+DIQEFYEV+L      +  +K   PVQPV
Sbjct:    1 MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCVDHSKQCEPVQPV 79          
BLAST of Disks large homolog 1 vs. Ensembl Mouse
Match: Dlg1 (discs large MAGUK scaffold protein 1 [Source:MGI Symbol;Acc:MGI:107231])

HSP 1 Score: 120.168 bits (300), Expect = 1.828e-28
Identity = 85/223 (38.12%), Postives = 116/223 (52.02%), Query Frame = 2
Query:  485 YFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            Y +I L +G  G GF++AGG + PH   D+ IF+TKIIT GAA  DGRL+++D I+ VN+ ++  VTH  AV+ LK AG  + L ++R K                         P  E              +  E+ LIK    GLG SI GG    +   D+ I ++K+  GG A  DG+LQ+GD +L V+   L  VTHEEAV  LKNT   V L +A+
Sbjct:  222 YEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAGSIVRLYVKRRK-------------------------PASE--------------KIMEIKLIK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAK 404          

HSP 2 Score: 97.8265 bits (242), Expect = 3.863e-21
Identity = 84/235 (35.74%), Postives = 120/235 (51.06%), Query Frame = 2
Query:  488 FQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNL-----------HEVVQATPNT-GYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
             +I L KG KG GF++AGG    H  GDN I+VTKII  GAA  DG+L+I D +++VN V LE VTHE AV  LKN    + L + +     + D Y   + TN               +  TP +   YSP  +         +++  ++    ++ R + GLG +I GG      E+   I IS +  GG AD+ G L+ GD I+ V+   L   +HE+A   LKN G+ VT+
Sbjct:  318 MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYINDGYAPPDITNSSSQSVDNHVSPSSCLGQTPTSPARYSPISKAVL-----GDDEITREPRKVVLHRGSTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTI 541          

HSP 3 Score: 74.7146 bits (182), Expect = 1.133e-13
Identity = 41/97 (42.27%), Postives = 58/97 (59.79%), Query Frame = 2
Query:  863 NAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            N  + +++  E+TL +R   GLG SI GG D  +  +DS I I+K+  GG A  DGRL+V D IL V++  +  VTH +AV  LK  G  V L++ R
Sbjct:  214 NGTDADYEYEEITL-ERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAGSIVRLYVKR 309          

HSP 4 Score: 57.7658 bits (138), Expect = 2.434e-8
Identity = 36/79 (45.57%), Postives = 59/79 (74.68%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSL---SSAISGNKS--PVQPV 223
            M +RK DT+RA++LL+ Y+SKL+++E++ L+ ++E++I+  ++ LF AL+DIQEFYEV+L      +  +K   PVQPV
Sbjct:    1 MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCVDHSKQCEPVQPV 79          
BLAST of Disks large homolog 1 vs. Ensembl Mouse
Match: Dlg1 (discs large MAGUK scaffold protein 1 [Source:MGI Symbol;Acc:MGI:107231])

HSP 1 Score: 120.168 bits (300), Expect = 1.828e-28
Identity = 85/223 (38.12%), Postives = 116/223 (52.02%), Query Frame = 2
Query:  485 YFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            Y +I L +G  G GF++AGG + PH   D+ IF+TKIIT GAA  DGRL+++D I+ VN+ ++  VTH  AV+ LK AG  + L ++R K                         P  E              +  E+ LIK    GLG SI GG    +   D+ I ++K+  GG A  DG+LQ+GD +L V+   L  VTHEEAV  LKNT   V L +A+
Sbjct:  222 YEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAGSIVRLYVKRRK-------------------------PASE--------------KIMEIKLIK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAK 404          

HSP 2 Score: 97.8265 bits (242), Expect = 3.863e-21
Identity = 84/235 (35.74%), Postives = 120/235 (51.06%), Query Frame = 2
Query:  488 FQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNL-----------HEVVQATPNT-GYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
             +I L KG KG GF++AGG    H  GDN I+VTKII  GAA  DG+L+I D +++VN V LE VTHE AV  LKN    + L + +     + D Y   + TN               +  TP +   YSP  +         +++  ++    ++ R + GLG +I GG      E+   I IS +  GG AD+ G L+ GD I+ V+   L   +HE+A   LKN G+ VT+
Sbjct:  318 MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYINDGYAPPDITNSSSQSVDNHVSPSSCLGQTPTSPARYSPISKAVL-----GDDEITREPRKVVLHRGSTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTI 541          

HSP 3 Score: 74.7146 bits (182), Expect = 1.133e-13
Identity = 41/97 (42.27%), Postives = 58/97 (59.79%), Query Frame = 2
Query:  863 NAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            N  + +++  E+TL +R   GLG SI GG D  +  +DS I I+K+  GG A  DGRL+V D IL V++  +  VTH +AV  LK  G  V L++ R
Sbjct:  214 NGTDADYEYEEITL-ERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAGSIVRLYVKR 309          

HSP 4 Score: 57.7658 bits (138), Expect = 2.434e-8
Identity = 36/79 (45.57%), Postives = 59/79 (74.68%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSL---SSAISGNKS--PVQPV 223
            M +RK DT+RA++LL+ Y+SKL+++E++ L+ ++E++I+  ++ LF AL+DIQEFYEV+L      +  +K   PVQPV
Sbjct:    1 MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCVDHSKQCEPVQPV 79          
BLAST of Disks large homolog 1 vs. Ensembl Mouse
Match: Dlg1 (discs large MAGUK scaffold protein 1 [Source:MGI Symbol;Acc:MGI:107231])

HSP 1 Score: 120.168 bits (300), Expect = 1.870e-28
Identity = 85/223 (38.12%), Postives = 116/223 (52.02%), Query Frame = 2
Query:  485 YFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            Y +I L +G  G GF++AGG + PH   D+ IF+TKIIT GAA  DGRL+++D I+ VN+ ++  VTH  AV+ LK AG  + L ++R K                         P  E              +  E+ LIK    GLG SI GG    +   D+ I ++K+  GG A  DG+LQ+GD +L V+   L  VTHEEAV  LKNT   V L +A+
Sbjct:  222 YEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAGSIVRLYVKRRK-------------------------PASE--------------KIMEIKLIK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAK 404          

HSP 2 Score: 97.8265 bits (242), Expect = 3.879e-21
Identity = 84/235 (35.74%), Postives = 120/235 (51.06%), Query Frame = 2
Query:  488 FQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNL-----------HEVVQATPNT-GYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
             +I L KG KG GF++AGG    H  GDN I+VTKII  GAA  DG+L+I D +++VN V LE VTHE AV  LKN    + L + +     + D Y   + TN               +  TP +   YSP  +         +++  ++    ++ R + GLG +I GG      E+   I IS +  GG AD+ G L+ GD I+ V+   L   +HE+A   LKN G+ VT+
Sbjct:  318 MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYINDGYAPPDITNSSSQSVDNHVSPSSCLGQTPTSPARYSPISKAVL-----GDDEITREPRKVVLHRGSTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTI 541          

HSP 3 Score: 74.7146 bits (182), Expect = 1.050e-13
Identity = 41/97 (42.27%), Postives = 58/97 (59.79%), Query Frame = 2
Query:  863 NAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            N  + +++  E+TL +R   GLG SI GG D  +  +DS I I+K+  GG A  DGRL+V D IL V++  +  VTH +AV  LK  G  V L++ R
Sbjct:  214 NGTDADYEYEEITL-ERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAGSIVRLYVKR 309          

HSP 4 Score: 57.7658 bits (138), Expect = 2.256e-8
Identity = 36/79 (45.57%), Postives = 59/79 (74.68%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSL---SSAISGNKS--PVQPV 223
            M +RK DT+RA++LL+ Y+SKL+++E++ L+ ++E++I+  ++ LF AL+DIQEFYEV+L      +  +K   PVQPV
Sbjct:    1 MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCVDHSKQCEPVQPV 79          
BLAST of Disks large homolog 1 vs. UniProt/SwissProt
Match: sp|Q6R005|DLG4_DANRE (Disks large homolog 4 OS=Danio rerio OX=7955 GN=dlg4 PE=2 SV=1)

HSP 1 Score: 127.487 bits (319), Expect = 3.733e-30
Identity = 121/384 (31.51%), Postives = 180/384 (46.88%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSLSSAISGNKSPVQPVYNDIIPEAKLEVQETPVXXXXXXXXXXXXXXXXXXXXXXXIASPKPVSKVKSNDNYEPEDYPDYQDPNYNQEYEPEANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            M ++++DTERA+  ++        + ++  +   E+L+   ++ LF ALLDIQEFYE+++    +  ++    +      E    +Q +P  L   KS +      S     + I +  P   V      +P   P    P Y         +   +    Y +I L +G  G GF++AGG + PH   D  IF+TKII  GAA  DGRL+++D I+ VNDV++  VTH  AV+ LK AG  + L + R                                   H+ +AE       E+ LIK    GLG SI GG    +   D+ I ++K+  GG A  DGRLQ+GD IL V++  L  V HE+AV  LKNTG  V L +A+
Sbjct:    1 MPLKREDTERALQAME----ACQSAGDEGFRTRAERLLTIFQSDLFQALLDIQEFYELTVFENQTAGRALTPGLKYRYHDEETPPLQHSPAHLSTGKSAEMLHLGDSGHAPIDGIHAYTPQMHVSPA---KPVLLPSGHAPYYATS----TLMNGMDGDVEYEEITLERGNSGLGFSIAGGTDNPHIGDDPSIFITKIIPGGAAAQDGRLRVNDSILFVNDVDVREVTHSFAVEALKEAGPIVRLYVLR-----------------------------------HKPSAEKIT----ELKLIK-GPKGLGFSIAGGVGNQHVPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNNMYLEEVMHEDAVAALKNTGDVVFLRVAK 333          

HSP 2 Score: 116.316 bits (290), Expect = 2.321e-26
Identity = 86/234 (36.75%), Postives = 122/234 (52.14%), Query Frame = 2
Query:  491 QIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENA----------------ENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLF 1144
            ++ L KG KG GF++AGG    H  GDN I+VTKII  GAA  DGRL+I D I++VN++ LE V HE AV  LKN G  + L + +   ++   +  N  ++      T  YSP  +   Y +  +                ++D  ++    +I R + GLG +I GG      E+   I IS +  GG AD+ G L+ GD IL V+   L   THE+A   LKN G+TVT+ 
Sbjct:  248 ELKLIKGPKGLGFSIAGGVGNQHVPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNNMYLEEVMHEDAVAALKNTGDVVFLRVAKTLHQHHHQDAYNPPDI------TSSYSPHMDMSDYPQALSPSSPRRYSPIPKGLFLDDDISREPRRVVIHRGSTGLGFNIVGG------EDGEGIFISFILAGGAADLSGELRKGDQILSVNGVDLRHATHEQAAAALKNAGQTVTII 469          

HSP 3 Score: 61.6178 bits (148), Expect = 9.655e-9
Identity = 47/145 (32.41%), Postives = 77/145 (53.10%), Query Frame = 2
Query:  401 DYPDYQDPNYNQEYEP--EANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYS 829
            DYP    P+  + Y P  +    D++      ++ +++G  G GF + GG      E   GIF++ I+  GAA++ G L+  D I+SVN V+L + THE A   LKNAGQ++ +I +   +EY   E   +H++ +   N+   S
Sbjct:  361 DYPQALSPSSPRRYSPIPKGLFLDDDISREPRRVVIHRGSTGLGFNIVGG------EDGEGIFISFILAGGAADLSGELRKGDQILSVNGVDLRHATHEQAAAALKNAGQTVTIITQYRPEEYSRFE-AKIHDLREQLMNSSLVS 498          
BLAST of Disks large homolog 1 vs. UniProt/SwissProt
Match: sp|G5ECY0|DLG1_CAEEL (Disks large homolog 1 OS=Caenorhabditis elegans OX=6239 GN=dlg-1 PE=1 SV=1)

HSP 1 Score: 124.405 bits (311), Expect = 4.253e-29
Identity = 93/256 (36.33%), Postives = 128/256 (50.00%), Query Frame = 2
Query:  458 LEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEY-------VANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTG-------------------GLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFI 1147
            ++D    W    I L KG  G GF++ GG ++P  +GD  I+VT II  GAA  DGR++ +D+I +VN+ N E V HE AV+ LK++G  + L ++R KDE            T+ L   V  TP+    + +H   S                +L + S G                   GLG SI GG    + + D+ I ++K+   G A++DGRL+VGD IL VD  SL   THE AVN LKNTG  V L I
Sbjct:  191 IDDHGRKWELENIVLEKGHTGLGFSITGGMDQPTEDGDTSIYVTNIIEGGAALADGRMRKNDIITAVNNTNCENVKHEVAVNALKSSGNVVSLSLKRRKDEAFLPIGGNFGGSTSYLRSGV--TPSVSAGNLQHAIHSPSAPIHPPPPPPVHHGSLSQLSVGQYRSTRPNTSVIDLVKGARGLGFSIAGGQGNEHVKGDTDIYVTKIIEEGAAELDGRLRVGDKILEVDHHSLINTTHENAVNVLKNTGNRVRLLI 444          

HSP 2 Score: 113.62 bits (283), Expect = 1.910e-25
Identity = 85/238 (35.71%), Postives = 120/238 (50.42%), Query Frame = 2
Query:  494 IDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQE--------------------SYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFI 1147
            IDL KG +G GF++AGG    H +GD  I+VTKII EGAAE+DGRL++ D I+ V+  +L   THE AV+ LKN G  + L+I++       +  +      Q  P T    P   Q+                    SY  +       +   V L+K    GLG +I GG      E++  I IS + PGGVAD+ G ++ GD++L V+   L   TH+EA   L+N G  V L +
Sbjct:  362 IDLVKGARGLGFSIAGGQGNEHVKGDTDIYVTKIIEEGAAELDGRLRVGDKILEVDHHSLINTTHENAVNVLKNTGNRVRLLIQQGTGAIFNDSASQ-----QFMPTTPILRPSSVQDYNRSQMGSQSHLSYGGPLNTSYSSQAPIAIPLEPRPVQLVK-GQNGLGFNIVGG------EDNEPIYISFVLPGGVADLSGNVKTGDVLLEVNGVVLRNATHKEAAEALRNAGNPVYLTL 587          

HSP 3 Score: 63.1586 bits (152), Expect = 3.155e-9
Identity = 32/89 (35.96%), Postives = 52/89 (58.43%), Query Frame = 2
Query:  887 QFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            + E  ++++   GLG SI GG D    + D+ I ++ +  GG A  DGR++  D+I  V++ +   V HE AVN LK++G  V+L + R
Sbjct:  199 ELENIVLEKGHTGLGFSITGGMDQPTEDGDTSIYVTNIIEGGAALADGRMRKNDIITAVNNTNCENVKHEVAVNALKSSGNVVSLSLKR 287          
BLAST of Disks large homolog 1 vs. UniProt/SwissProt
Match: sp|Q811D0|DLG1_MOUSE (Disks large homolog 1 OS=Mus musculus OX=10090 GN=Dlg1 PE=1 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.278e-27
Identity = 85/223 (38.12%), Postives = 116/223 (52.02%), Query Frame = 2
Query:  485 YFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            Y +I L +G  G GF++AGG + PH   D+ IF+TKIIT GAA  DGRL+++D I+ VN+ ++  VTH  AV+ LK AG  + L ++R K                         P  E              +  E+ LIK    GLG SI GG    +   D+ I ++K+  GG A  DG+LQ+GD +L V+   L  VTHEEAV  LKNT   V L +A+
Sbjct:  222 YEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAGSIVRLYVKRRK-------------------------PASE--------------KIMEIKLIK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAK 404          

HSP 2 Score: 97.8265 bits (242), Expect = 2.702e-20
Identity = 84/235 (35.74%), Postives = 120/235 (51.06%), Query Frame = 2
Query:  488 FQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNL-----------HEVVQATPNT-GYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
             +I L KG KG GF++AGG    H  GDN I+VTKII  GAA  DG+L+I D +++VN V LE VTHE AV  LKN    + L + +     + D Y   + TN               +  TP +   YSP  +         +++  ++    ++ R + GLG +I GG      E+   I IS +  GG AD+ G L+ GD I+ V+   L   +HE+A   LKN G+ VT+
Sbjct:  318 MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNSVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYINDGYAPPDITNSSSQSVDNHVSPSSCLGQTPTSPARYSPISKAVL-----GDDEITREPRKVVLHRGSTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTI 541          

HSP 3 Score: 74.7146 bits (182), Expect = 7.927e-13
Identity = 41/97 (42.27%), Postives = 58/97 (59.79%), Query Frame = 2
Query:  863 NAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            N  + +++  E+TL +R   GLG SI GG D  +  +DS I I+K+  GG A  DGRL+V D IL V++  +  VTH +AV  LK  G  V L++ R
Sbjct:  214 NGTDADYEYEEITL-ERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEADVRDVTHSKAVEALKEAGSIVRLYVKR 309          

HSP 4 Score: 57.7658 bits (138), Expect = 1.702e-7
Identity = 36/79 (45.57%), Postives = 59/79 (74.68%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSL---SSAISGNKS--PVQPV 223
            M +RK DT+RA++LL+ Y+SKL+++E++ L+ ++E++I+  ++ LF AL+DIQEFYEV+L      +  +K   PVQPV
Sbjct:    1 MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCVDHSKQCEPVQPV 79          
BLAST of Disks large homolog 1 vs. UniProt/SwissProt
Match: sp|Q12959|DLG1_HUMAN (Disks large homolog 1 OS=Homo sapiens OX=9606 GN=DLG1 PE=1 SV=2)

HSP 1 Score: 119.398 bits (298), Expect = 2.022e-27
Identity = 86/223 (38.57%), Postives = 118/223 (52.91%), Query Frame = 2
Query:  485 YFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            Y +I L +G  G GF++AGG + PH   D+ IF+TKIIT GAA  DGRL+++D I+ VN+V++  VTH  AV+ LK AG  + L ++R K                         P  E              +  E+ LIK    GLG SI GG    +   D+ I ++K+  GG A  DG+LQ+GD +L V++  L  VTHEEAV  LKNT   V L +A+
Sbjct:  222 YEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRK-------------------------PVSE--------------KIMEIKLIK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAK 404          

HSP 2 Score: 97.0561 bits (240), Expect = 4.984e-20
Identity = 83/235 (35.32%), Postives = 120/235 (51.06%), Query Frame = 2
Query:  488 FQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNLHE------------VVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
             +I L KG KG GF++AGG    H  GDN I+VTKII  GAA  DG+L+I D +++VN+V LE VTHE AV  LKN    + L + +     + D Y   + TN               + Q   +   YSP  +         +++  ++    ++ R + GLG +I GG      E+   I IS +  GG AD+ G L+ GD I+ V+   L   +HE+A   LKN G+ VT+
Sbjct:  318 MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVL-----GDDEITREPRKVVLHRGSTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTI 541          

HSP 3 Score: 73.559 bits (179), Expect = 1.441e-12
Identity = 41/97 (42.27%), Postives = 58/97 (59.79%), Query Frame = 2
Query:  863 NAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            N  + +++  E+TL +R   GLG SI GG D  +  +DS I I+K+  GG A  DGRL+V D IL V++  +  VTH +AV  LK  G  V L++ R
Sbjct:  214 NGTDADYEYEEITL-ERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKR 309          

HSP 4 Score: 57.7658 bits (138), Expect = 1.601e-7
Identity = 36/79 (45.57%), Postives = 59/79 (74.68%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSL---SSAISGNK--SPVQPV 223
            M +RK DT+RA++LL+ Y+SKL+++E++ L+ ++E++I+  ++ LF AL+DIQEFYEV+L      I  +K   P+QPV
Sbjct:    1 MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKPSEPIQPV 79          
BLAST of Disks large homolog 1 vs. UniProt/SwissProt
Match: sp|Q5PYH7|DLG2_DANRE (Disks large homolog 2 OS=Danio rerio OX=7955 GN=dlg2 PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 6.686e-27
Identity = 84/223 (37.67%), Postives = 116/223 (52.02%), Query Frame = 2
Query:  485 YFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            + +I L +G  G GF++AGG + PH   D GIF+TKII  GAA  DGRL+++D I+ VN+ ++  V+H  AV+ LK AG  + L +RR +          + E V                               E+ LIK    GLG SI GG    +   D+ I ++K+  GG A  DGRLQVGD +L V++ +L  VTHEEAV  LKNT   V L + +
Sbjct:  153 FEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNESDVSEVSHSKAVEALKAAGSIVRLYVRRRRP---------MLETVT------------------------------EIKLIK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYTLEEVTHEEAVAILKNTSDVVYLKVGK 335          

HSP 2 Score: 107.842 bits (268), Expect = 1.566e-23
Identity = 93/263 (35.36%), Postives = 127/263 (48.29%), Query Frame = 2
Query:  491 QIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNLHEVVQATPN---------------------TGYYS--PEH--------EQESYHEENAENDNFQQFEV-----TLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIARF 1156
            +I L KG KG GF++AGG    H  GDN I+VTKII  GAA+ DGRL++ D ++ VN+  LE VTHE AV  LKN    + L + +     L D Y   + T  H    A  N                      G YS  P+H           S  E      + Q F++      ++ + + GLG +I GG      E+   I +S +  GG AD+ G L+ GD IL V+   L G THE+A   LK  G+TVT+ IA++
Sbjct:  250 EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYTLEEVTHEEAVAILKNTSDVVYLKVGKPTSVYLSDPYGPPDIT--HSFSPAMENHISSPGNNGTLEYKSSLPPISPGRYSPLPKHLLGEEDINRNPSLDEMEGHRFDSQHFQLREPRKIVLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDQILSVNGIDLRGATHEQAAAALKGAGQTVTI-IAQY 503          

HSP 3 Score: 74.3294 bits (181), Expect = 8.785e-13
Identity = 38/89 (42.70%), Postives = 54/89 (60.67%), Query Frame = 2
Query:  887 QFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            +FE   ++R   GLG SI GG D  +  +D  I I+K+ PGG A  DGRL+V D IL V++  ++ V+H +AV  LK  G  V L++ R
Sbjct:  152 EFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVNDCILRVNESDVSEVSHSKAVEALKAAGSIVRLYVRR 240          

HSP 4 Score: 53.1434 bits (126), Expect = 4.179e-6
Identity = 37/91 (40.66%), Postives = 53/91 (58.24%), Query Frame = 2
Query:  491 QIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEY 763
            +I L+KG  G GF + GG      E   GIFV+ I+  G A++ G L+  D I+SVN ++L   THE A   LK AGQ++ +I +   +EY
Sbjct:  424 KIVLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDQILSVNGIDLRGATHEQAAAALKGAGQTVTIIAQYRPEEY 508          
BLAST of Disks large homolog 1 vs. TrEMBL
Match: A0A2P1GIU4 (DLG OS=Oscarella lobularis OX=121494 PE=2 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 1.407e-35
Identity = 142/403 (35.24%), Postives = 203/403 (50.37%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSLSSAISGNKSPVQPVYNDIIPEAKLEVQETPVXXXXXXXXXXXXXXXXXXXXXXX-----IASPKPVSK------VKSNDNYEPEDYPDY----QDPNYNQEYEPEANLEDENNP--WLYFQ--IDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            M  RK D  RA+ LL+ Y +KL  ++++ L+ A+EK+I    + LF ALLDIQEFYE +L   +   KS  Q  +  +   A  E Q +P+  KK+K         +             AS  PV+        ++   +E + + D     + P      E    + D+  P  W + Q  I L KG  G GF++AGGY+ PH   DN ++VTKII  G A  DGRL++DD I+SVN   L+YVTH  AVD L++AG  +IL+++R            +  V  AT      SP+ E   +             E+ L+K +  GLG SI GG    +   D+ I ++K+   G A  DGRL VGD IL V++ S+  VTHEEAV  LK T +TV L + +
Sbjct:   25 MPARKQDAHRALELLEDYHAKLTGTDDRQLRSAIEKVIRIFRSRLFQALLDIQEFYEETL---LDSGKSKEQKTHETMEMAAAWEKQ-SPMPHKKKKEVAVSATAAATAAAVVVEKENDKASSSPVASDLLPPPPEATVTFERQAFLDESMPPEIPPSTSGVEVSPIVVDQPGPDKWQWEQETIILEKGSSGLGFSIAGGYDHPHSPDDNLVYVTKIIPTGGAAKDGRLRLDDCILSVNGNELKYVTHGEAVDALRHAGNRVILLVKR-----------KVLLVEMAT------SPKGEGRIH-------------EIKLVK-AGKGLGFSIAGGVGNQHIPGDNGIFVTKIIDTGAAAADGRLSVGDRILRVNEGSVENVTHEEAVQALKMTDQTVILLVEK 392          

HSP 2 Score: 116.316 bits (290), Expect = 5.886e-24
Identity = 84/227 (37.00%), Postives = 114/227 (50.22%), Query Frame = 2
Query:  491 QIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLK--------DEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFI 1147
            +I L K  KG GF++AGG    H  GDNGIFVTKII  GAA  DGRL + D I+ VN+ ++E VTHE AV  LK   Q++IL++ + K         + V   +   H+VV  +     Y             A  D         +K+ + GLG +I GG      E+   I IS +  GG AD  G L+ GD I+ V+   +   THE+A   LK  G TVT+ +
Sbjct:  307 EIKLVKAGKGLGFSIAGGVGNQHIPGDNGIFVTKIIDTGAAAADGRLSVGDRILRVNEGSVENVTHEEAVQALKMTDQTVILLVEKAKKDENDGAFSQPVVTSSPMPHQVVDVS--VASYEESASPTKVDAARASRD----LRTVELKKGSTGLGFNIIGG------EDGEGIFISFILAGGAADRSGMLRRGDQIIEVNGADMRLATHEDAALALKGAGSTVTMVV 521          
BLAST of Disks large homolog 1 vs. TrEMBL
Match: A0A4W4FCC0 (Uncharacterized protein OS=Electrophorus electricus OX=8005 PE=3 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 9.851e-35
Identity = 135/398 (33.92%), Postives = 202/398 (50.75%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSLSSAISGNKSPVQPVYNDIIPEAKL----EVQETPVXXXXXXXXXXXXXXXXXXXXXXXIASPKPVSKVKSNDNYEPEDYPDYQDPNYNQ-----EYEPEANLE-----DENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            M +RK+D +RA+ LL+ Y++KLN +E++ LK +++++ID  ++ LF AL+DIQEFYEV+L   +   K        D  P+A L     VQ T V      S  +   +  + ++    ASP+  S  +  DN    +     + N +Q      Y   A++           + Y +I L +G  G GF++AGG + PH   D GIF+TK+I  GAA  DGRL+++DVI+ VN+V++  VTH  AV+ LK AG  + L +RR K         ++ E +                               E+ L+K    GLG SI GG    +   D+ I ++K+  GG A  DGRLQ+GD +L V+   L  VTHE+AV  LKNT   V L +A+
Sbjct:    1 MPVRKNDAQRALLLLEEYRTKLNNAEDRPLKNSIQRVIDIFQSNLFQALIDIQEFYEVTL---LDNQKCGASLKVTDAAPQANLWDFSSVQNTSVTSDTLPSLSTSTEKYRQHDED---ASPQEQSSPQLTDNTPDPELVQVAEKNISQIENVHGYVAHAHISPLKVNGTEADYEYEEITLERGNSGLGFSIAGGTDNPHIGEDPGIFITKVIPGGAAAQDGRLRVNDVILRVNEVDVRDVTHSKAVEALKEAGSLVRLYVRRRK---------SVSEKI------------------------------VEIKLVK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKLLAVNSTCLEEVTHEQAVTALKNTTDVVYLKVAK 352          

HSP 2 Score: 112.849 bits (281), Expect = 9.341e-23
Identity = 86/237 (36.29%), Postives = 120/237 (50.63%), Query Frame = 2
Query:  491 QIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNLHE------------VVQATPNT--GYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLF 1144
            +I L KG KG GF++AGG    H  GDN I+VTKII  GAA  DGRL+I D +++VN   LE VTHE AV  LKN    + L + +     + D +   + TN +             + Q  P T  G YSP     +      ++D  ++    ++ R   GLG +I GG      E+   I IS +  GG AD+ G L+ GD ++ V+   L   THE+A   LKN G+ VT+ 
Sbjct:  267 EIKLVKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKLLAVNSTCLEEVTHEQAVTALKNTTDVVYLKVAKPNNVFMNDNFAPPDITNSYSQHMENHISPPSFLSQPVPPTTSGPYSP-----TPRPTGGDDDITREPRKVVLHRGATGLGFNIVGG------EDGEGIFISFILAGGPADLSGELRKGDRLVSVNGVDLRSATHEQAAAALKNAGQIVTII 492          
BLAST of Disks large homolog 1 vs. TrEMBL
Match: W5KTN9 (Discs, large homolog 1 (Drosophila) OS=Astyanax mexicanus OX=7994 PE=3 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 2.097e-34
Identity = 125/399 (31.33%), Postives = 193/399 (48.37%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSLSSAISGNKSPVQPVYNDII--PEAKLEVQETPVXXXXXXXXXXXXXXXXXXXXXXXIASPKPVSKVKSNDNYEPEDY---PDYQDPNYNQEYEPE----------ANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            M +RK+DT+RA+ LL+ Y+SKL+++++  +++++E++I+  ++ LF AL+DIQEFYEVSL         P +P    +   P  + ++   P      +                    P  ++       Y+ ED    P++  P    + +P           + +E+ +    +  I   KG  G GF++AGG + PH   D  IF+TKII  GAA  DGRL+++D I+ VNDVN+  VTH  AV+ LK AG  + L +RR K                         P  E              +  ++ L+K    GLG SI GG    +   D+ I ++K+  GG A  DGRLQ+GD ++ V+   L  VTHE+AV  LKNT   V L +A+
Sbjct:    1 MPVRKNDTQRALKLLEEYRSKLSQTKDPQIRQSIERVINIFQSSLFQALIDIQEFYEVSLQEKPDACTEPSEPAQPSLPSPPANQWDITSIPSTSAAVE------------------TQPSSLTSTSEKYRYQDEDTTSPPEHSSPRLPADLQPPELVQVSEKNISQIENVHGFVSHSHISPMKGNSGLGFSIAGGTDNPHIGEDPSIFITKIIPGGAAAQDGRLRVNDCILRVNDVNVRDVTHSKAVEALKEAGCIVRLYVRRRK-------------------------PGSE--------------KIVDLKLVK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKLVAVNAACLEEVTHEDAVAALKNTTDVVYLKVAK 341          

HSP 2 Score: 112.079 bits (279), Expect = 1.371e-22
Identity = 88/237 (37.13%), Postives = 120/237 (50.63%), Query Frame = 2
Query:  494 IDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNLHE----------------VVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
            + L KG KG GF++AGG    H  GDN I+VTKII  GAA  DGRL+I D +V+VN   LE VTHE AV  LKN    + L + +     + D Y   + TN +                 +  ATP+   YSP  +     EE       ++    ++ R + GLG +I GG      E+   I IS +  GG AD+ G L+ GD ++ V+   L   THE+A   LKN G+TVT+
Sbjct:  257 LKLVKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKLVAVNAACLEEVTHEDAVAALKNTTDVVYLKVAKPTSVFMNDSYAPPDVTNSYSQHMENHITTPNYLSQPLTPATPSR--YSPVSKSTLGDEEIT-----REPRKVVLHRGSTGLGFNIVGG------EDGEGIFISFILAGGPADLCGELRKGDRLISVNGVDLRSATHEQAAAALKNAGQTVTI 480          
BLAST of Disks large homolog 1 vs. TrEMBL
Match: F7CY76 (PIN2 (TERF1) interacting telomerase inhibitor 1 OS=Xenopus tropicalis OX=8364 GN=map3k15 PE=3 SV=2)

HSP 1 Score: 147.517 bits (371), Expect = 2.220e-34
Identity = 133/388 (34.28%), Postives = 192/388 (49.48%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSL--SSAISGNKSPVQPVYNDIIPEAKLEVQETPVXXXXXXXXXXXXXXXXXXXXXXXIASPKPVSKVKSNDNYEPEDYPDYQDPNY--NQEYEPEANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            M +RK DT+RA+ LL+ Y+ KL+++E+K L+K++E++I   ++ LF AL+DIQEFYEV+L  +   S N  P +PV      E       T        S          +     I    PV  V +  N  P   P    P    N + E  A +   +  + Y +I L +G  G GF++AGG + PH   D  IF+TKII+ GAA  DGRL+++D I+ VN+V++  VTH  AV+ LK AG  + L +RR K                         P  E              +  ++ L+K    GLG SI GG    +   D+ I ++K+  GG A  DGRLQ+GD +L V+   L  V+HE+AV  LKNT   V L +A+
Sbjct:    1 MPVRKQDTQRALTLLEEYRCKLHQTEDKQLRKSIERVIGIFQSNLFQALIDIQEFYEVTLLDNPKSSDNAKPTEPVQTINTWEYSSLPNSTATCETLPSSLILNVETPEADTPCPPIVPVIPVIPVPAESNVIPSSTPQANPPPVIVNTDLETPAYVNGTDAEYEYEEITLERGTSGLGFSIAGGTDNPHIGDDISIFITKIISGGAAAQDGRLRVNDCILRVNEVDVHDVTHSKAVEALKEAGSIVRLYVRRRK-------------------------PVTE--------------KIMDIKLVK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKLLAVNTVCLEEVSHEDAVTALKNTSDFVNLKVAK 348          

HSP 2 Score: 116.316 bits (290), Expect = 5.979e-24
Identity = 90/235 (38.30%), Postives = 122/235 (51.91%), Query Frame = 2
Query:  494 IDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNLHEVV-------------QATPNTGYYSPEHEQESYHEENAENDNF-QQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
            I L KG KG GF++AGG    H  GDN I+VTKII  GAA  DGRL+I D +++VN V LE V+HE AV  LKN    + L + +     + D Y   + TN +                   P+ G YSP  +         E+D+  ++    +++R T GLG +I GG      E+   I IS +  GG AD+ G LQ GD I+ V+   L   THE+A   LKN G+TVT+
Sbjct:  264 IKLVKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKLLAVNTVCLEEVSHEDAVTALKNTSDFVNLKVAKPTTMYMNDNYAPPDITNSYSQQVDNHISPSGFIGHPLPPSPGRYSPAPKG------MLEDDDLTREPRKVVLQRGTTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELQKGDRIMSVNGVDLKSATHEQAAAALKNAGQTVTI 486          
BLAST of Disks large homolog 1 vs. TrEMBL
Match: A0A2K5KXB5 (Discs large MAGUK scaffold protein 1 OS=Cercocebus atys OX=9531 GN=DLG1 PE=3 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 2.269e-34
Identity = 136/418 (32.54%), Postives = 201/418 (48.09%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSL---SSAISGNK--SPVQPVYNDIIPEAKLEVQETPVXXXXXXXXXXXXXXXXXXXXXXXIASPKPVSKVKSNDNYEPEDYP--DYQDPNYNQE-------YEPEANLEDENN--------------------PWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            M +RK DT+RA++LL+ Y+SKL+++E++ L+ ++E++I+  ++ LF AL+DIQEFYEV+L      I  +K   P+QPV          E+   P      ++                   P  +S       Y+ ED P  ++  P    E       +  E NL +  N                     + Y +I L +G  G GF++AGG + PH   D+ IF+TKIIT GAA  DGRL+++D I+ VN+V++  VTH  AV+ LK AG  + L ++R K                         P  E              +  E+ LIK    GLG SI GG    +   D+ I ++K+  GG A  DG+LQ+GD +L V++  L  VTHEEAV  LKNT   V L +A+
Sbjct:    1 MPVRKQDTQRALHLLEEYRSKLSQTEDRQLRSSIERVINIFQSNLFQALIDIQEFYEVTLLDNPKCIDRSKLSEPIQPVNT-------WEISSLPSSTVTSETL------------------PSSLSPSVEKYRYQDEDTPPQEHISPQITNEVVGPELVHVSEKNLSEIENVHGFVSHSHISPIKVNGTDADYEYEEITLERGNSGLGFSIAGGTDNPHIGDDSSIFITKIITGGAAAQDGRLRVNDCILRVNEVDVRDVTHSKAVEALKEAGSIVRLYVKRRK-------------------------PVSE--------------KIMEIKLIK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAK 353          

HSP 2 Score: 98.9821 bits (245), Expect = 2.790e-18
Identity = 84/234 (35.90%), Postives = 121/234 (51.71%), Query Frame = 2
Query:  488 FQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNLHEVV-----------QATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
             +I L KG KG GF++AGG    H  GDN I+VTKII  GAA  DG+L+I D +++VN+V LE VTHE AV  LKN    + L + +     + D Y   + TN  + V           Q   +   YSP  +         +++  ++    ++ R + GLG +I GG      E+   I IS +  GG AD+ G L+ GD I+ V+   L   +HE+A   LKN G+ VT+
Sbjct:  267 MEIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGKLQIGDKLLAVNNVCLEEVTHEEAVTALKNTSDFVYLKVAKPTSMYMNDGYAPPDITNSSQPVDNHVSPSSFLGQTPASPARYSPVSKAVL-----GDDEITREPRKVVLHRGSTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELRKGDRIISVNSVDLRAASHEQAAAALKNAGQAVTI 489          
BLAST of Disks large homolog 1 vs. Ensembl Cavefish
Match: dlg1 (disks large homolog 1 [Source:NCBI gene;Acc:103021716])

HSP 1 Score: 147.517 bits (371), Expect = 7.943e-38
Identity = 125/399 (31.33%), Postives = 193/399 (48.37%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSLSSAISGNKSPVQPVYNDII--PEAKLEVQETPVXXXXXXXXXXXXXXXXXXXXXXXIASPKPVSKVKSNDNYEPEDY---PDYQDPNYNQEYEPE----------ANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            M +RK+DT+RA+ LL+ Y+SKL+++++  +++++E++I+  ++ LF AL+DIQEFYEVSL         P +P    +   P  + ++   P      +                    P  ++       Y+ ED    P++  P    + +P           + +E+ +    +  I   KG  G GF++AGG + PH   D  IF+TKII  GAA  DGRL+++D I+ VNDVN+  VTH  AV+ LK AG  + L +RR K                         P  E              +  ++ L+K    GLG SI GG    +   D+ I ++K+  GG A  DGRLQ+GD ++ V+   L  VTHE+AV  LKNT   V L +A+
Sbjct:    1 MPVRKNDTQRALKLLEEYRSKLSQTKDPQIRQSIERVINIFQSSLFQALIDIQEFYEVSLQEKPDACTEPSEPAQPSLPSPPANQWDITSIPSTSAAVE------------------TQPSSLTSTSEKYRYQDEDTTSPPEHSSPRLPADLQPPELVQVSEKNISQIENVHGFVSHSHISPMKGNSGLGFSIAGGTDNPHIGEDPSIFITKIIPGGAAAQDGRLRVNDCILRVNDVNVRDVTHSKAVEALKEAGCIVRLYVRRRK-------------------------PGSE--------------KIVDLKLVK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKLVAVNAACLEEVTHEDAVAALKNTTDVVYLKVAK 341          

HSP 2 Score: 112.079 bits (279), Expect = 5.191e-26
Identity = 88/237 (37.13%), Postives = 120/237 (50.63%), Query Frame = 2
Query:  494 IDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNLHE----------------VVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
            + L KG KG GF++AGG    H  GDN I+VTKII  GAA  DGRL+I D +V+VN   LE VTHE AV  LKN    + L + +     + D Y   + TN +                 +  ATP+   YSP  +     EE       ++    ++ R + GLG +I GG      E+   I IS +  GG AD+ G L+ GD ++ V+   L   THE+A   LKN G+TVT+
Sbjct:  257 LKLVKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKLVAVNAACLEEVTHEDAVAALKNTTDVVYLKVAKPTSVFMNDSYAPPDVTNSYSQHMENHITTPNYLSQPLTPATPSR--YSPVSKSTLGDEEIT-----REPRKVVLHRGSTGLGFNIVGG------EDGEGIFISFILAGGPADLCGELRKGDRLISVNGVDLRSATHEQAAAALKNAGQTVTI 480          

HSP 3 Score: 55.4546 bits (132), Expect = 8.029e-8
Identity = 52/156 (33.33%), Postives = 78/156 (50.00%), Query Frame = 2
Query:  356 KPVSKVKSNDNYEPED----YPDYQD-----PNYNQE---------YEP--EANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEY 763
            KP S V  ND+Y P D    Y  + +     PNY  +         Y P  ++ L DE       ++ L++G  G GF + GG      E   GIF++ I+  G A++ G L+  D ++SVN V+L   THE A   LKNAGQ++ ++ +   +EY
Sbjct:  341 KPTS-VFMNDSYAPPDVTNSYSQHMENHITTPNYLSQPLTPATPSRYSPVSKSTLGDEEITREPRKVVLHRGSTGLGFNIVGG------EDGEGIFISFILAGGPADLCGELRKGDRLISVNGVDLRSATHEQAAAALKNAGQTVTIVAQYRPEEY 489          
BLAST of Disks large homolog 1 vs. Ensembl Cavefish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 138.272 bits (347), Expect = 1.177e-34
Identity = 129/389 (33.16%), Postives = 191/389 (49.10%), Query Frame = 2
Query:    8 IRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSLSSAIS-------GNKSPVQPVYNDIIPEAKLEVQETPVXXXXXXXXXXXXXXXXXXXXXXXIASPKPVSKVKSNDNYEPEDYPDYQDPNYNQEYEPEANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            + K DTERAV LLK Y++ L   EE++L+ ++ K+     + LF ALLDIQE YEV+L    +       G K  ++    + +   ++  + +P K+++     S+ H ++ +      A+P P+  + + D+ +   Y +  D  Y                  Y +I L +G  G GF++AGG + PH   D GIF+TKII  GAA +DGRL ++D ++ VN+V++  V H  AV+ LK AG  + L++RR                 QA P T                         EV L+K    GLG SI GG    +   D+ I I+K+  GG A  DGRLQ GD +L V++  L  V HEEAV  LKNT   V L +A+
Sbjct:    2 VHKYDTERAVGLLKQYQASLTSPEEQALRTSVGKVSAIFGSQLFKALLDIQECYEVTLQLNTTENGIKENGPKETLENSEEECVSRVRVTSRRSPQKVERVAGLVSRSHVETPK------ANPPPI--IVNADSLDAGPYVNGSDGMYK-----------------YEEIILERGNSGLGFSIAGGIDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVVRLLVRRR----------------QAPPET-----------------------ILEVNLLK-GPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIILQDVRHEEAVAALKNTSDMVYLKVAK 325          

HSP 2 Score: 107.842 bits (268), Expect = 1.599e-24
Identity = 81/247 (32.79%), Postives = 122/247 (49.39%), Query Frame = 2
Query:  476 PWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYV---------------ANETTNLHEVVQATPNTGYYSPEHEQESY----HEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLF 1144
            P    +++L KG KG GF++AGG    H  GDN I++TKII  GAA+ DGRL+  D +++VN++ L+ V HE AV  LKN    + L + +     L D Y                 +  +++  +    P   Y  P+     Y         E+D  ++    L+ + + GLG +I GG      E+   I +S +  GG AD+ G L+ GD IL V+  +L   THE+A   LK  G+TVT+ 
Sbjct:  235 PETILEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIILQDVRHEEAVAALKNTSDMVYLKVAKPGPVHLNDMYAPPDYSSTFPTMVDNHVSHNSSMAYMGGMEPKPVYQPPQVTPSRYSPVPRHMLGEDDFTREPRKVLLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTII 475          

HSP 3 Score: 52.373 bits (124), Expect = 7.378e-7
Identity = 57/181 (31.49%), Postives = 80/181 (44.20%), Query Frame = 2
Query:  344 IASPKPVSKVKSNDNYEPEDY---------------------------PDYQDPNYN-QEYEP--EANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEV 796
            +A P PV     ND Y P DY                           P YQ P      Y P     L +++      ++ L+KG  G GF + GG      E   GIFV+ I+  G A++ G L+  D I+SVN VNL   THE A   LK AGQ++ +I +   +EY   E + +H++
Sbjct:  323 VAKPGPV---HLNDMYAPPDYSSTFPTMVDNHVSHNSSMAYMGGMEPKPVYQPPQVTPSRYSPVPRHMLGEDDFTREPRKVLLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTIIAQYRPEEYSRFE-SKIHDL 493          
BLAST of Disks large homolog 1 vs. Ensembl Cavefish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 119.783 bits (299), Expect = 1.645e-28
Identity = 87/225 (38.67%), Postives = 116/225 (51.56%), Query Frame = 2
Query:  479 WLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            + Y +I L +G  G GF++AGG + PH   D GIF+TKII  GAA +DGRL ++D ++ VN+V++  V H  AV+ LK AG  + L++RR                 QA P T                         EV L+K    GLG SI GG    +   D+ I I+K+  GG A  DGRLQ GD +L V++  L  V HEEAV  LKNT   V L +A+
Sbjct:  122 YKYEEIILERGNSGLGFSIAGGIDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVVRLLVRRR----------------QAPPET-----------------------ILEVNLLK-GPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIILQDVRHEEAVAALKNTSDMVYLKVAK 306          

HSP 2 Score: 107.842 bits (268), Expect = 1.302e-24
Identity = 81/247 (32.79%), Postives = 122/247 (49.39%), Query Frame = 2
Query:  476 PWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYV---------------ANETTNLHEVVQATPNTGYYSPEHEQESY----HEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLF 1144
            P    +++L KG KG GF++AGG    H  GDN I++TKII  GAA+ DGRL+  D +++VN++ L+ V HE AV  LKN    + L + +     L D Y                 +  +++  +    P   Y  P+     Y         E+D  ++    L+ + + GLG +I GG      E+   I +S +  GG AD+ G L+ GD IL V+  +L   THE+A   LK  G+TVT+ 
Sbjct:  216 PETILEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIILQDVRHEEAVAALKNTSDMVYLKVAKPGPVHLNDMYAPPDYSSTFPTMVDNHVSHNSSMAYMGGMEPKPVYQPPQVTPSRYSPVPRHMLGEDDFTREPRKVLLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTII 456          

HSP 3 Score: 73.9442 bits (180), Expect = 1.293e-13
Identity = 37/94 (39.36%), Postives = 54/94 (57.45%), Query Frame = 2
Query:  872 NDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            +D   ++E  +++R   GLG SI GG D  +  +D  I I+K+ PGG A +DGRL V D +L V++  ++ V H  AV  LK  G  V L + R
Sbjct:  118 SDGMYKYEEIILERGNSGLGFSIAGGIDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVVRLLVRR 211          

HSP 4 Score: 52.7582 bits (125), Expect = 7.081e-7
Identity = 39/96 (40.62%), Postives = 55/96 (57.29%), Query Frame = 2
Query:  491 QIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANET 778
            ++ L+KG  G GF + GG      E   GIFV+ I+  G A++ G L+  D I+SVN VNL   THE A   LK AGQ++ +I +   +EY   E+
Sbjct:  380 KVLLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTIIAQYRPEEYSRFES 469          
BLAST of Disks large homolog 1 vs. Ensembl Cavefish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 119.398 bits (298), Expect = 2.025e-28
Identity = 87/225 (38.67%), Postives = 116/225 (51.56%), Query Frame = 2
Query:  479 WLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            + Y +I L +G  G GF++AGG + PH   D GIF+TKII  GAA +DGRL ++D ++ VN+V++  V H  AV+ LK AG  + L++RR                 QA P T                         EV L+K    GLG SI GG    +   D+ I I+K+  GG A  DGRLQ GD +L V++  L  V HEEAV  LKNT   V L +A+
Sbjct:   97 YKYEEIILERGNSGLGFSIAGGIDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVVRLLVRRR----------------QAPPET-----------------------ILEVNLLK-GPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIILQDVRHEEAVAALKNTSDMVYLKVAK 281          

HSP 2 Score: 107.842 bits (268), Expect = 1.423e-24
Identity = 81/247 (32.79%), Postives = 122/247 (49.39%), Query Frame = 2
Query:  476 PWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYV---------------ANETTNLHEVVQATPNTGYYSPEHEQESY----HEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLF 1144
            P    +++L KG KG GF++AGG    H  GDN I++TKII  GAA+ DGRL+  D +++VN++ L+ V HE AV  LKN    + L + +     L D Y                 +  +++  +    P   Y  P+     Y         E+D  ++    L+ + + GLG +I GG      E+   I +S +  GG AD+ G L+ GD IL V+  +L   THE+A   LK  G+TVT+ 
Sbjct:  191 PETILEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIILQDVRHEEAVAALKNTSDMVYLKVAKPGPVHLNDMYAPPDYSSTFPTMVDNHVSHNSSMAYMGGMEPKPVYQPPQVTPSRYSPVPRHMLGEDDFTREPRKVLLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTII 431          

HSP 3 Score: 73.9442 bits (180), Expect = 1.320e-13
Identity = 37/94 (39.36%), Postives = 54/94 (57.45%), Query Frame = 2
Query:  872 NDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            +D   ++E  +++R   GLG SI GG D  +  +D  I I+K+ PGG A +DGRL V D +L V++  ++ V H  AV  LK  G  V L + R
Sbjct:   93 SDGMYKYEEIILERGNSGLGFSIAGGIDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVVRLLVRR 186          

HSP 4 Score: 52.7582 bits (125), Expect = 7.079e-7
Identity = 39/96 (40.62%), Postives = 55/96 (57.29%), Query Frame = 2
Query:  491 QIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANET 778
            ++ L+KG  G GF + GG      E   GIFV+ I+  G A++ G L+  D I+SVN VNL   THE A   LK AGQ++ +I +   +EY   E+
Sbjct:  355 KVLLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTIIAQYRPEEYSRFES 444          
BLAST of Disks large homolog 1 vs. Ensembl Cavefish
Match: dlg3 (discs, large homolog 3 (Drosophila) [Source:ZFIN;Acc:ZDB-GENE-050208-93])

HSP 1 Score: 119.013 bits (297), Expect = 3.338e-28
Identity = 87/223 (39.01%), Postives = 115/223 (51.57%), Query Frame = 2
Query:  485 YFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            Y +I L +G  G GF++AGG + PH   D GIF+TKII  GAA +DGRL ++D ++ VN+V++  V H  AV+ LK AG  + L++RR                 QA P T                         EV L+K    GLG SI GG    +   D+ I I+K+  GG A  DGRLQ GD +L V++  L  V HEEAV  LKNT   V L +A+
Sbjct:  130 YEEIILERGNSGLGFSIAGGIDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVVRLLVRRR----------------QAPPET-----------------------ILEVNLLK-GPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIILQDVRHEEAVAALKNTSDMVYLKVAK 312          

HSP 2 Score: 107.457 bits (267), Expect = 1.964e-24
Identity = 83/251 (33.07%), Postives = 126/251 (50.20%), Query Frame = 2
Query:  476 PWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYV---------------ANETTNLHEVVQATPNTGYYSPEHEQESY----HEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIARF 1156
            P    +++L KG KG GF++AGG    H  GDN I++TKII  GAA+ DGRL+  D +++VN++ L+ V HE AV  LKN    + L + +     L D Y                 +  +++  +    P   Y  P+     Y         E+D  ++    L+ + + GLG +I GG      E+   I +S +  GG AD+ G L+ GD IL V+  +L   THE+A   LK  G+TVT+ IA++
Sbjct:  222 PETILEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIILQDVRHEEAVAALKNTSDMVYLKVAKPGPVHLNDMYAPPDYSSTFPTMVDNHVSHNSSMAYMGGMEPKPVYQPPQVTPSRYSPVPRHMLGEDDFTREPRKVLLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTI-IAQY 465          

HSP 3 Score: 73.9442 bits (180), Expect = 1.281e-13
Identity = 37/101 (36.63%), Postives = 58/101 (57.43%), Query Frame = 2
Query:  851 YHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            ++++   +D   ++E  +++R   GLG SI GG D  +  +D  I I+K+ PGG A +DGRL V D +L V++  ++ V H  AV  LK  G  V L + R
Sbjct:  117 WYDQVNGSDGMYKYEEIILERGNSGLGFSIAGGIDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVVRLLVRR 217          

HSP 4 Score: 52.7582 bits (125), Expect = 6.822e-7
Identity = 39/96 (40.62%), Postives = 55/96 (57.29%), Query Frame = 2
Query:  491 QIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANET 778
            ++ L+KG  G GF + GG      E   GIFV+ I+  G A++ G L+  D I+SVN VNL   THE A   LK AGQ++ +I +   +EY   E+
Sbjct:  386 KVLLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTIIAQYRPEEYSRFES 475          
BLAST of Disks large homolog 1 vs. Ensembl Sea Lamprey
Match: scrib (scribble planar cell polarity protein [Source:NCBI gene;Acc:368473])

HSP 1 Score: 83.5741 bits (205), Expect = 2.503e-17
Identity = 67/216 (31.02%), Postives = 111/216 (51.39%), Query Frame = 2
Query:  518 GYGFAVAGGYNKPHYEG-DNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSM-ILIIR-RLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGY-DLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            G G ++AGG     Y+G D GIF++++  EG A + G +++ D ++ VN V L    H+ AV  LKN+G  M +L++R R+ +   A  TT     ++   +   ++PE E     E         Q  V L+ R+  GLG SI GG          S I IS++  GG AD++G + V D +L ++   +    H++AV  L ++  ++T+ + R
Sbjct:  551 GLGISIAGGKGSTPYKGEDEGIFISRVSDEGPAGIAG-VRVGDKLLQVNGVVLVDAEHQEAVSALKNSGSVMELLVLRERMVEPEHAVLTTPAQPPLRERRSAVTFAPEPEPTVMRE---------QLSVRLL-RNERGLGFSIAGGKGSTPFKGSHSGIFISRIAEGGTADLEGTMAVADRVLAINGVDMTEARHDQAVALLTSSATSITMLLQR 755          

HSP 2 Score: 67.3958 bits (163), Expect = 3.691e-12
Identity = 62/239 (25.94%), Postives = 115/239 (48.12%), Query Frame = 2
Query:  443 EPEANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGD-NGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNE---EDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFI 1147
            EPE  +  E        + L +  +G GF++AGG     ++G  +GIF+++I   G A+++G + + D ++++N V++    H+ AV  L ++  S+ ++++R + +                 +      + E  S H    E   +   E+ L+K + G LG+SI GG D +++    +   I ISK+   G A     ++VGD IL V+   +   TH+EAV  L      + +F+
Sbjct:  658 EPEPTVMREQ-----LSVRLLRNERGLGFSIAGGKGSTPFKGSHSGIFISRIAEGGTADLEGTMAVADRVLAINGVDMTEARHDQAVALLTSSATSITMLLQREQAQGHKPPGRPSSPPPGYPLSPDEEDGDEEDGSNHVSEQEEHPYPVEEIVLLK-TDGPLGLSIVGGSDHSSHPFGIDKPGIFISKIIADGQA-AKTNMRVGDRILSVNGLDVRHCTHQEAVCALLGGKPAIHMFV 889          
BLAST of Disks large homolog 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004677.1 (pep scaffold:Pmarinus_7.0:GL479538:28591:32639:-1 gene:ENSPMAG00000004260.1 transcript:ENSPMAT00000004677.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.8474 bits (146), Expect = 2.750e-11
Identity = 54/193 (27.98%), Postives = 85/193 (44.04%), Query Frame = 2
Query:  578 IFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIARF 1156
            I + ++  EGAA  DGRL   D I+ VN  +L   THE A++ L+ + Q + L + R +  Y  ++ + LH                                 F V L+K++  GLG+SI G       +  + + +S++  GG A+ DGRL  GD IL VD + +   + E     LK     V + + R 
Sbjct:    4 IMIHEVYEEGAAAKDGRLWAGDQILKVNGTDLRSATHEDAINALRASPQLVRLYVYRDEARYRGDDESALH--------------------------------VFTVELLKKAGRGLGLSIVG------KKSGNGVFVSEVVHGGAAEADGRLTQGDQILSVDGEDVRSASQETVAAILKCAQGVVKMEVGRM 158          
BLAST of Disks large homolog 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006056.1 (pep scaffold:Pmarinus_7.0:GL477535:225:55869:1 gene:ENSPMAG00000005437.1 transcript:ENSPMAT00000006056.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 9.278e-11
Identity = 65/215 (30.23%), Postives = 100/215 (46.51%), Query Frame = 2
Query:  494 IDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNA--GQSMILIIRR-----LKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLK 1117
            I L KG  G GF +A   + P   G   I+V  I+++GAA  DGRLK  D ++ VN +++   T E  V  L++   G S+ L++ R     L  +  A   + +     A       SP+  +E           F    + L       LG+S++G  D   N  D  I I  +  GG A  DGRL+V D ++ V+ +SL G ++ EA+  L+
Sbjct:  415 IHLKKGLDGLGFTIAT-RDTP-VGGRTPIYVKSIMSKGAALSDGRLKSGDRLLEVNGLDVTSRTQEEVVAILRSTKLGGSVDLLVSRHHDVPLSPDDPAGLNSRVWRCSAAEEEDRLLSPDGSRE-----------FLTLHIPLHDMGAASLGVSVKGTKDRRTNA-DLGIFIKTIIAGGAAAKDGRLRVDDQLIAVNRESLLGRSNLEAMESLR 615          
BLAST of Disks large homolog 1 vs. Ensembl Sea Lamprey
Match: lin7a (lin-7 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB-GENE-040426-1665])

HSP 1 Score: 59.3066 bits (142), Expect = 1.044e-10
Identity = 34/75 (45.33%), Postives = 45/75 (60.00%), Query Frame = 2
Query:  923 GLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFI 1147
            GLG +I GG      E++S I IS++ PGGVAD  G L+ GD +L V+  S+ G  HE+AV  LK    TV L +
Sbjct:   89 GLGFNIMGG-----KEQNSPIYISRIIPGGVADRQGGLKRGDQLLSVNGVSVEGEHHEKAVELLKQAQGTVKLVV 158          
BLAST of Disks large homolog 1 vs. Ensembl Sea Lamprey
Match: LIN7B (lin-7 homolog B, crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:17788])

HSP 1 Score: 56.9954 bits (136), Expect = 5.772e-10
Identity = 32/75 (42.67%), Postives = 44/75 (58.67%), Query Frame = 2
Query:  923 GLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFI 1147
            GLG ++ GG      E++S I IS++ PGGVAD  G L+ GD +L V+  S+ G  HE AV  LK    +V L +
Sbjct:   79 GLGFNVMGG-----KEQNSPIYISRIIPGGVADRQGGLKRGDQLLSVNGVSVEGEHHERAVELLKQAQGSVKLVV 148          
BLAST of Disks large homolog 1 vs. Ensembl Nematostella
Match: EDO46059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR65])

HSP 1 Score: 111.694 bits (278), Expect = 1.014e-28
Identity = 82/223 (36.77%), Postives = 117/223 (52.47%), Query Frame = 2
Query:  488 FQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIARF 1156
             +I L +G  G GF++AGG + PH + D GI++TK+I  GAA  DGRL+++D I+SVN  N   + H+ AVD LK AG  + L+  + +                        +P  E                 E+ LIK S G LG SI GG    +   D+ I I+K+  GG A  DGRLQVGD I+ V+ ++L  V+HE+AV  LK T + VT+ ++R 
Sbjct:    5 LEITLERGGSGLGFSIAGGTDNPHVDDDFGIYITKVIPGGAAAQDGRLQVNDCILSVNGTNTVDIEHQQAVDALKAAGSQVTLVREKKRGN----------------------APTRE-----------------EIVLIKGSKG-LGFSIAGGSGNQHVPGDNGIYITKIIEGGAAQQDGRLQVGDKIISVNLQNLEDVSHEDAVQVLKATKERVTIVVSRL 187          

HSP 2 Score: 76.2554 bits (186), Expect = 4.324e-16
Identity = 46/91 (50.55%), Postives = 61/91 (67.03%), Query Frame = 2
Query:  491 QIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEY 763
            +I L KG KG GF++AGG    H  GDNGI++TKII  GAA+ DGRL++ D I+SVN  NLE V+HE AV  LK   + + +++ RL   Y
Sbjct:  101 EIVLIKGSKGLGFSIAGGSGNQHVPGDNGIYITKIIEGGAAQQDGRLQVGDKIISVNLQNLEDVSHEDAVQVLKATKERVTIVVSRLTAYY 191          

HSP 3 Score: 70.4774 bits (171), Expect = 4.057e-14
Identity = 40/89 (44.94%), Postives = 55/89 (61.80%), Query Frame = 2
Query:  878 NFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLF 1144
            N++  E+TL +R   GLG SI GG D  + ++D  I I+K+ PGG A  DGRLQV D IL V+  +   + H++AV+ LK  G  VTL 
Sbjct:    1 NYETLEITL-ERGGSGLGFSIAGGTDNPHVDDDFGIYITKVIPGGAAAQDGRLQVNDCILSVNGTNTVDIEHQQAVDALKAAGSQVTLV 88          
BLAST of Disks large homolog 1 vs. Ensembl Nematostella
Match: EDO33432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS78])

HSP 1 Score: 97.0561 bits (240), Expect = 2.321e-21
Identity = 78/224 (34.82%), Postives = 115/224 (51.34%), Query Frame = 2
Query:  500 LNKGRKGYGFAVAGGY-NKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEY---VANETTNLHEVVQATPNTGY-YSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGY-DLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            +++  KG G  +AGG  + P+ E D GIF+++I   G A  DG L + D I+ VN V++   TH  AVD LK+ G+ + L + R K E       +T     V +    TG  ++PE E E   E   E +      +TL +    GLG SI GG       + D  I ISK+   G A+ DGRL+VGD +L ++ + +    H++AVN L +    VTL + R
Sbjct:  571 IHRDTKGLGINIAGGKGSTPYKENDEGIFISRISENGPAGRDGILHVGDKILKVNGVDISNATHHQAVDVLKSTGKDITLYVVREKQEIEKRTVPKTAKDESVKEEPKKTGVRFAPEPEMEDI-ETRPEKET-----ITLKRGGDKGLGFSIAGGKGSTPYKDGDPGIFISKIAKDGTAERDGRLKVGDKVLSINSRDMKNAKHDDAVNMLTSGPSFVTLIVYR 788          

HSP 2 Score: 90.1225 bits (222), Expect = 3.527e-19
Identity = 78/249 (31.33%), Postives = 123/249 (49.40%), Query Frame = 2
Query:  437 EYEPEANLED-ENNPWLYFQIDLNKGRKGYGFAVAGGY-NKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEV-VQATPNTGYY------SPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNE---EDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFI 1147
             + PE  +ED E  P          G KG GF++AGG  + P+ +GD GIF++KI  +G AE DGRLK+ D ++S+N  +++   H+ AV+ L +    + LI+ R  D  +  + T L     Q  P+          SP    + Y    A  +   +    ++K+    LG SI GG D A++    ++  I ISK+ P GVA     L++GD +L V+ K +   TH++AV  L      + L +
Sbjct:  683 RFAPEPEMEDIETRPEKETITLKRGGDKGLGFSIAGGKGSTPYKDGDPGIFISKIAKDGTAERDGRLKVGDKVLSINSRDMKNAKHDDAVNMLTSGPSFVTLIVYR--DRVINKKMTPLTRAGKQYNPSPSRAGKQYNPSPARAGKQYSPSPARAEINHEI---ILKKGNNPLGFSIVGGSDHASHPFGMDEPGIFISKIVPTGVAATTN-LKIGDRVLMVNGKDMRNATHQDAVAALIANVSLIKLLV 925          

HSP 3 Score: 66.2402 bits (160), Expect = 1.466e-11
Identity = 71/227 (31.28%), Postives = 99/227 (43.61%), Query Frame = 2
Query:  491 QIDLNKGRKGYGFAVAGGYNK---PHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLAN----NEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIA 1150
            +I L KG    GF++ GG +    P    + GIF++KI+  G A     LKI D ++ VN  ++   TH+ AV  L  A  S+I ++ R                    P  G         ++H+   E                  LGISI+GG         ++ D  I ISK++ G  A  DGRL VG  IL V+  SL G TH EAV  L++ G  VTL + 
Sbjct:  840 EIILKKGNNPLGFSIVGGSDHASHPFGMDEPGIFISKIVPTGVAATTN-LKIGDRVLMVNGKDMRNATHQDAVAALI-ANVSLIKLLVR-----------------HDPPPKGL-----NDVNFHKSPGEK-----------------LGISIRGGAKGHPGNPLDKTDEGIFISKVSEGAAAHKDGRLMVGQRILEVNGVSLLGATHLEAVRALRSMGDRVTLLVC 1025          
BLAST of Disks large homolog 1 vs. Ensembl Nematostella
Match: EDO33706 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRG3])

HSP 1 Score: 85.8853 bits (211), Expect = 8.556e-18
Identity = 73/224 (32.59%), Postives = 109/224 (48.66%), Query Frame = 2
Query:  500 LNK-GRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEY-VTHETAVDTLKNAGQSMILIIRR--LKDEYVANETTNLHEVVQATP-NTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIARF 1156
            LNK G+ G GF+V G   K    G+ GIF+ +I  EG A  DGRL+  D I+S++   L+  ++HE A+  L+     + LI+ R  +     +  T+    V+  TP N    S      S      +  +++Q E   +     GLG  I GG         S +SI  + PGGVAD DGRLQ  D I+ + D ++ G+  E+    L++ G  V L I+R 
Sbjct:  167 LNKPGQGGLGFSVVG--LKSENRGELGIFIQEIQEEGVAGRDGRLRESDQILSIDGQQLDSGISHEEAIVLLQKTRGEVELIVARGGIPRTGTSRTTSGASSVISRTPSNVSLVS----DASTTIPADDGTHWRQIETIDLHNDGTGLGFGIIGG-------RSSGVSIKTILPGGVADKDGRLQEHDQIMQIGDVNVGGMGSEQVAQVLRDAGSHVRLVISRL 377          

HSP 2 Score: 67.781 bits (164), Expect = 6.012e-12
Identity = 42/104 (40.38%), Postives = 61/104 (58.65%), Query Frame = 2
Query:  842 QESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            Q++  +  A  ++ + F V L+K  T GLGI+I G    AN++E + I I  +  G  A +DGRL+V D I+ V   SL+G  + EAV  LK TG  V+L +AR
Sbjct:  598 QQTLKDIQAGEEDVELFNVDLVK-GTRGLGITIAGYIGEANSDELAGIFIKSIAHGSTAALDGRLRVNDQIIQVGSVSLHGKNNGEAVEILKQTGPVVSLKVAR 700          

HSP 3 Score: 61.6178 bits (148), Expect = 5.229e-10
Identity = 38/94 (40.43%), Postives = 55/94 (58.51%), Query Frame = 2
Query:  461 EDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILII 742
            E+  +P     I+L +G +G GF++ GG+  PH  GD  I+V  +   GAA  DGRLK  D I++VN  +L  V+HE+AV  LK     +IL +
Sbjct: 1740 EESESPLQTKIIELERGPEGLGFSIVGGHGSPH--GDLPIYVKTVFPTGAASRDGRLKRGDQIIAVNGQSLVGVSHESAVSQLKKTRGKIILTV 1831          

HSP 4 Score: 60.4622 bits (145), Expect = 1.102e-9
Identity = 60/221 (27.15%), Postives = 101/221 (45.70%), Query Frame = 2
Query:  485 YFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKD--EYVA--NETTNLHEV--------VQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRST---GGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEA 1102
            +  + L+KG  G G ++AGG         N IF+  + + G AE DGR+K  D I+ VN   +  ++H  A   LKN G S+ L + R ++  EY++   +  + H          +Q T +T   SP   + +            +     +KRS+   G + +S     +L+  +   YI   K         DGRL+ GD ++ VDD+++ G++H E 
Sbjct: 1425 HLLVSLSKGNTGLGLSIAGGKGV----AVNRIFIVDVKSGGPAEQDGRIKQADEILEVNRTPVRGMSHYQASTVLKNTGTSVELALGRSREAAEYLSRTRQQASPHSTEPDIKPSNIQTTESTPSISPRGVEVAAGPRRTPPPVAPKPSTDSLKRSSPQAGSVTVSPTLLAELSGGQLVEYIDFVK---------DGRLRKGDQLIAVDDQAIVGLSHAEG 1632          

HSP 5 Score: 58.9214 bits (141), Expect = 3.637e-9
Identity = 36/105 (34.29%), Postives = 59/105 (56.19%), Query Frame = 2
Query:  833 EHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFI 1147
            + +  S  ++  E+++  Q ++  ++R   GLG SI GG+   +   D  I +  + P G A  DGRL+ GD I+ V+ +SL GV+HE AV+ LK T   + L +
Sbjct: 1729 QQDSPSQSDDEEESESPLQTKIIELERGPEGLGFSIVGGH--GSPHGDLPIYVKTVFPTGAASRDGRLKRGDQIIAVNGQSLVGVSHESAVSQLKKTRGKIILTV 1831          

HSP 6 Score: 56.9954 bits (136), Expect = 1.148e-8
Identity = 40/115 (34.78%), Postives = 61/115 (53.04%), Query Frame = 2
Query:  827 SPEHEQESYHEENAENDNFQQFEVT----LIKRSTG--GLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            +P+H +   +E+       +  +VT    L+  S G  GLG+SI GG  +A N     I I  +  GG A+ DGR++  D IL V+   + G++H +A   LKNTG +V L + R
Sbjct: 1398 APDHSEMPSYEDRIRELQAKYPDVTGEHLLVSLSKGNTGLGLSIAGGKGVAVNR----IFIVDVKSGGPAEQDGRIKQADEILEVNRTPVRGMSHYQASTVLKNTGTSVELALGR 1508          

HSP 7 Score: 53.9138 bits (128), Expect = 1.222e-7
Identity = 66/261 (25.29%), Postives = 109/261 (41.76%), Query Frame = 2
Query:  485 YFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMIL-IIRRLKDEYVANET--TNLHEVVQATPNTGY---------YSPEH------------------------EQESYHEENAENDNFQQFEVTLIKRS-TGGLGISIQGG-YDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
             F +DL KG +G G  +AG   + + +   GIF+  I     A +DGRL+++D I+ V  V+L    +  AV+ LK  G  + L + R +  ++   ET  +  H   + TP + +           PE                         E    H +    DN +     + K S  GGLGIS++G  Y L  +    +  I  + P G    +G +Q GD ++ V+   +  + H E V  +++      L +AR
Sbjct:  613 LFNVDLVKGTRGLGITIAGYIGEANSDELAGIFIKSIAHGSTAALDGRLRVNDQIIQVGSVSLHGKNNGEAVEILKQTGPVVSLKVARHIPGKHSRPETPHSTPHSPGRQTPQSSHSPRSVTPVVIQPEKSIAVESADAKAEAELQRELQTLDTEAVKQHYQTIIGDNMEILVAEMTKFSPAGGLGISLEGTQYPLDGSM--PWHRIHAVNPEGPVGKNGIIQSGDHLIEVNGVGVLDLGHNEVVTLIQSLPMEFRLVVAR 871          
BLAST of Disks large homolog 1 vs. Ensembl Nematostella
Match: EDO34828 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNC4])

HSP 1 Score: 68.5514 bits (166), Expect = 7.924e-14
Identity = 40/90 (44.44%), Postives = 54/90 (60.00%), Query Frame = 2
Query:  884 QQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            Q FEV LIK   G LG+S+ GG      E    I I +L PGG A + G+LQV D+IL V+ KSL+ +T+ EA++ L+N    V L + R
Sbjct:   40 QPFEVHLIKGPQG-LGMSLTGG------ESGGPIYIKRLVPGGSAALCGQLQVNDVILQVNGKSLDRLTYREALSILRNCPPEVRLLVKR 122          
BLAST of Disks large homolog 1 vs. Ensembl Nematostella
Match: EDO45624 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSE9])

HSP 1 Score: 66.2402 bits (160), Expect = 3.374e-12
Identity = 65/211 (30.81%), Postives = 92/211 (43.60%), Query Frame = 2
Query:  515 KGYGFAVAGGYNKPHYEGDNGIFVTKIITEGA-AEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLF 1144
            +G G  V GG + P      G+   K I  G  AE  G L+  D ++ VND  L  VTH  A++ LKN    + L + R KD                        P+ + +              F V L K S G LGI + GG         + I +  + P GVA  DGR++ GD +L V+ +S  G+TH+E +N L+N  + V LF
Sbjct:    7 QGIGLMVIGGLDTPL-----GMLYIKDIQPGTPAEKCGHLRTGDQLLQVNDECLVGVTHAYALEVLKNTPPLVKLTVARKKD------------------------PDRDSDV-------------FTVELKKDSKGSLGIHVSGGVG------TNCIDVRHVVPLGVAAKDGRIRKGDRVLSVNGRSTKGLTHQEVLNLLQNLPRRVRLF 169          

HSP 2 Score: 49.2914 bits (116), Expect = 1.254e-6
Identity = 30/77 (38.96%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  923 GLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            G+G+ + GG D         + I  + PG  A+  G L+ GD +L V+D+ L GVTH  A+  LKNT   V L +AR
Sbjct:    8 GIGLMVIGGLD----TPLGMLYIKDIQPGTPAEKCGHLRTGDQLLQVNDECLVGVTHAYALEVLKNTPPLVKLTVAR 80          
BLAST of Disks large homolog 1 vs. Ensembl Medaka
Match: dlg3 (discs large MAGUK scaffold protein 3 [Source:NCBI gene;Acc:101169708])

HSP 1 Score: 137.502 bits (345), Expect = 1.839e-34
Identity = 133/387 (34.37%), Postives = 185/387 (47.80%), Query Frame = 2
Query:    8 IRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSLSSAISGNKSPVQPVYNDIIPEAKLEVQETPVXXXXXXXXXXXXXXXXXXXXXXXIASPKPVSKVKSNDNYEPEDYPDYQDPNY-----NQEYEPEANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            + + DTERAV LLK Y++ L   EE++LK ++ K+   L + LF ALLDIQE YEV+L       +S  Q +  +   +++ +V E P      + + +               SP  V +V         D P    P       + +  P  N  D    + Y +I L +G  G GF++AGG + PH   D GIF+TKII  GAA +DGRL ++D ++ VNDV++  V H  AV+ LK AG  + L++RR                 QA P T                         EV L+K    GLG SI GG    +   D+ I I+K+  GG A  DGRLQ GD +L V++  L  V HEEAV  LKNT   V L +A+
Sbjct:    2 VHRYDTERAVGLLKQYQANLTSPEEQALKTSVGKVSAILGSHLFQALLDIQECYEVTL------QQSAEQTIVKE---DSRKDVWEDPEDEGVSRVRVTSSR------------SPHKVERVSGLVVLCHVDMPKANPPPIIVNADSLDAGPYVNGSDAM--YKYEEIILERGNSGLGFSIAGGIDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNDVDVSEVVHSRAVEALKEAGPVVRLLVRRR----------------QAPPET-----------------------ILEVNLLK-GPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIVLQDVRHEEAVAALKNTSDMVYLKVAK 325          

HSP 2 Score: 108.612 bits (270), Expect = 8.074e-25
Identity = 87/244 (35.66%), Postives = 124/244 (50.82%), Query Frame = 2
Query:  476 PWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNL----------HEVVQAT-PNTGYYSPEHEQESY-----HEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLF 1144
            P    +++L KG KG GF++AGG    H  GDN I++TKII  GAA+ DGRL+  D +++VN++ L+ V HE AV  LKN    + L + +     L D Y   + ++           H  + A  P   Y  P+     Y     H    E+   +  +V L K ST GLG +I GG      E+   I +S +  GG AD+ G L+ GD IL V+  +L   THE+A   LK  G+TVT+ 
Sbjct:  235 PETILEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIVLQDVRHEEAVAALKNTSDMVYLKVAKPGPVHLNDMYAPPDYSSTFPTMVDNHVSHNYMGAMEPKPVYPPPQVTPSRYSPVPRHMMGEEDFTREPRKVVLHKGST-GLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTII 471          

HSP 3 Score: 52.7582 bits (125), Expect = 6.158e-7
Identity = 40/102 (39.22%), Postives = 59/102 (57.84%), Query Frame = 2
Query:  491 QIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEV 796
            ++ L+KG  G GF + GG      E   GIFV+ I+  G A++ G L+  D I+SVN VNL   THE A   LK AGQ++ +I +   +EY   E + +H++
Sbjct:  395 KVVLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTIIAQYRPEEYSRFE-SKIHDL 489          
BLAST of Disks large homolog 1 vs. Ensembl Medaka
Match: dlg3 (discs large MAGUK scaffold protein 3 [Source:NCBI gene;Acc:101169708])

HSP 1 Score: 137.502 bits (345), Expect = 2.082e-34
Identity = 134/384 (34.90%), Postives = 181/384 (47.14%), Query Frame = 2
Query:   20 DTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSLSSAISGNKSPVQPVYNDIIPE-AKLEVQETPVXXXXXXXXXXXXXXXXXXXXXXXIASPKPVSKVKSNDNYEPEDYPDYQDPNY-----NQEYEPEANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            DTERAV LLK Y++ L   EE++LK ++ K+   L + LF ALLDIQE YEV+L           Q     I+ E ++ +V E P      + + +               SP  V +V         D P    P       + +  P  N  D    + Y +I L +G  G GF++AGG + PH   D GIF+TKII  GAA +DGRL ++D ++ VNDV++  V H  AV+ LK AG  + L++RR                 QA P T                         EV L+K    GLG SI GG    +   D+ I I+K+  GG A  DGRLQ GD +L V++  L  V HEEAV  LKNT   V L +A+
Sbjct:    9 DTERAVGLLKQYQANLTSPEEQALKTSVGKVSAILGSHLFQALLDIQECYEVTLQ----------QSAEQTIVKEDSRKDVWEDPEDEGVSRVRVTSSR------------SPHKVERVSGLVVLCHVDMPKANPPPIIVNADSLDAGPYVNGSDAM--YKYEEIILERGNSGLGFSIAGGIDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNDVDVSEVVHSRAVEALKEAGPVVRLLVRRR----------------QAPPET-----------------------ILEVNLLK-GPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIVLQDVRHEEAVAALKNTSDMVYLKVAK 328          

HSP 2 Score: 108.997 bits (271), Expect = 6.444e-25
Identity = 87/244 (35.66%), Postives = 124/244 (50.82%), Query Frame = 2
Query:  476 PWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNL----------HEVVQAT-PNTGYYSPEHEQESY-----HEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLF 1144
            P    +++L KG KG GF++AGG    H  GDN I++TKII  GAA+ DGRL+  D +++VN++ L+ V HE AV  LKN    + L + +     L D Y   + ++           H  + A  P   Y  P+     Y     H    E+   +  +V L K ST GLG +I GG      E+   I +S +  GG AD+ G L+ GD IL V+  +L   THE+A   LK  G+TVT+ 
Sbjct:  238 PETILEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIVLQDVRHEEAVAALKNTSDMVYLKVAKPGPVHLNDMYAPPDYSSTFPTMVDNHVSHNYMGAMEPKPVYPPPQVTPSRYSPVPRHMMGEEDFTREPRKVVLHKGST-GLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTII 474          

HSP 3 Score: 52.7582 bits (125), Expect = 5.802e-7
Identity = 40/102 (39.22%), Postives = 59/102 (57.84%), Query Frame = 2
Query:  491 QIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEV 796
            ++ L+KG  G GF + GG      E   GIFV+ I+  G A++ G L+  D I+SVN VNL   THE A   LK AGQ++ +I +   +EY   E + +H++
Sbjct:  398 KVVLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTIIAQYRPEEYSRFE-SKIHDL 492          
BLAST of Disks large homolog 1 vs. Ensembl Medaka
Match: dlg3 (discs large MAGUK scaffold protein 3 [Source:NCBI gene;Acc:101169708])

HSP 1 Score: 119.783 bits (299), Expect = 1.792e-28
Identity = 88/223 (39.46%), Postives = 115/223 (51.57%), Query Frame = 2
Query:  485 YFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            Y +I L +G  G GF++AGG + PH   D GIF+TKII  GAA +DGRL ++D ++ VNDV++  V H  AV+ LK AG  + L++RR                 QA P T                         EV L+K    GLG SI GG    +   D+ I I+K+  GG A  DGRLQ GD +L V++  L  V HEEAV  LKNT   V L +A+
Sbjct:  150 YEEIILERGNSGLGFSIAGGIDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNDVDVSEVVHSRAVEALKEAGPVVRLLVRRR----------------QAPPET-----------------------ILEVNLLK-GPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIVLQDVRHEEAVAALKNTSDMVYLKVAK 332          

HSP 2 Score: 108.997 bits (271), Expect = 6.522e-25
Identity = 89/248 (35.89%), Postives = 128/248 (51.61%), Query Frame = 2
Query:  476 PWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR-----LKDEYVANETTNL----------HEVVQAT-PNTGYYSPEHEQESY-----HEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIARF 1156
            P    +++L KG KG GF++AGG    H  GDN I++TKII  GAA+ DGRL+  D +++VN++ L+ V HE AV  LKN    + L + +     L D Y   + ++           H  + A  P   Y  P+     Y     H    E+   +  +V L K ST GLG +I GG      E+   I +S +  GG AD+ G L+ GD IL V+  +L   THE+A   LK  G+TVT+ IA++
Sbjct:  242 PETILEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQTGDRLLAVNNIVLQDVRHEEAVAALKNTSDMVYLKVAKPGPVHLNDMYAPPDYSSTFPTMVDNHVSHNYMGAMEPKPVYPPPQVTPSRYSPVPRHMMGEEDFTREPRKVVLHKGST-GLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTI-IAQY 481          

HSP 3 Score: 75.485 bits (184), Expect = 3.958e-14
Identity = 38/94 (40.43%), Postives = 54/94 (57.45%), Query Frame = 2
Query:  872 NDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            +D   ++E  +++R   GLG SI GG D  +  +D  I I+K+ PGG A +DGRL V D +L V+D  ++ V H  AV  LK  G  V L + R
Sbjct:  144 SDAMYKYEEIILERGNSGLGFSIAGGIDNPHIPDDPGIFITKIIPGGAAAMDGRLGVNDCVLRVNDVDVSEVVHSRAVEALKEAGPVVRLLVRR 237          

HSP 4 Score: 53.1434 bits (126), Expect = 4.801e-7
Identity = 40/102 (39.22%), Postives = 59/102 (57.84%), Query Frame = 2
Query:  491 QIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEV 796
            ++ L+KG  G GF + GG      E   GIFV+ I+  G A++ G L+  D I+SVN VNL   THE A   LK AGQ++ +I +   +EY   E + +H++
Sbjct:  402 KVVLHKGSTGLGFNIVGG------EDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQTVTIIAQYRPEEYSRFE-SKIHDL 496          
BLAST of Disks large homolog 1 vs. Ensembl Medaka
Match: dlg4a (disks large homolog 4 [Source:NCBI gene;Acc:101159214])

HSP 1 Score: 115.931 bits (289), Expect = 2.608e-27
Identity = 91/234 (38.89%), Postives = 122/234 (52.14%), Query Frame = 2
Query:  491 QIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANE------TTNLHEVVQATPNTGYY-----------SPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
            +I L KG KG GF++AGG    H  GDN I+VTKII  GAA  DGRL+I D I++VN+V LE V HE AV  LKN  + + L + +  + ++ N       TT  H   + + + GY            SP       H    ++D  ++    LI R + GLG +I GG      E+   I IS +  GG AD+ G L  GD IL V+   L   THE+A   LKN G+TVT+
Sbjct:  143 EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNNVCLEDVMHEDAVGALKNTAEVVYLRVAKPNNLFLTNSYNPPDLTTYSHMDTELS-HPGYLGSDYPQALTPTSPSRFSPVLHGMMGDDDIPREPRRILIHRGSTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELHKGDQILSVNGVDLRMATHEQAAAALKNAGQTVTI 369          

HSP 2 Score: 68.5514 bits (166), Expect = 5.718e-12
Identity = 54/158 (34.18%), Postives = 72/158 (45.57%), Query Frame = 2
Query:  680 VTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            VTH  AV+ LK AG  + L + R K                         P  E+ +              E+ LIK    GLG SI GG    +   D+ I ++K+  GG A  DGRLQ+GD IL V++  L  V HE+AV  LKNT + V L +A+
Sbjct:  111 VTHSQAVEALKEAGAIVRLYVLRRK-------------------------PAAEKVT--------------EIKLIK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNNVCLEDVMHEDAVGALKNTAEVVYLRVAK 228          

HSP 3 Score: 62.003 bits (149), Expect = 7.522e-10
Identity = 49/153 (32.03%), Postives = 76/153 (49.67%), Query Frame = 2
Query:  377 SNDNYEPEDYPDYQDPNYNQEYEP--EANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYS 829
            S+  Y   DYP    P     + P     + D++ P    +I +++G  G GF + GG      E   GIF++ I+  G A++ G L   D I+SVN V+L   THE A   LKNAGQ++ ++ +   DEY   E   +H++ +   N+   S
Sbjct:  254 SHPGYLGSDYPQALTPTSPSRFSPVLHGMMGDDDIPREPRRILIHRGSTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELHKGDQILSVNGVDLRMATHEQAAAALKNAGQTVTIVAQYRPDEYSRFE-AKIHDLREQLMNSSMGS 399          
BLAST of Disks large homolog 1 vs. Ensembl Medaka
Match: dlg4a (disks large homolog 4 [Source:NCBI gene;Acc:101159214])

HSP 1 Score: 115.931 bits (289), Expect = 3.310e-27
Identity = 89/234 (38.03%), Postives = 120/234 (51.28%), Query Frame = 2
Query:  491 QIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANE------TTNLHEVVQATPNTGYY-----------SPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTL 1141
            +I L KG KG GF++AGG    H  GDN I+VTKII  GAA  DGRL+I D I++VN+V LE V HE AV  LKN  + + L + +  + ++ N       T+    +     + GY            SP       H    ++D  ++    LI R + GLG +I GG      E+   I IS +  GG AD+ G L  GD IL V+   L   THE+A   LKN G+TVT+
Sbjct:  213 EIKLIKGPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNNVCLEDVMHEDAVGALKNTAEVVYLRVAKPNNLFLTNSYNPPDLTSTYSHMDTELSHPGYLGSDYPQALTPTSPSRFSPVLHGMMGDDDIPREPRRILIHRGSTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELHKGDQILSVNGVDLRMATHEQAAAALKNAGQTVTI 440          

HSP 2 Score: 113.62 bits (283), Expect = 1.803e-26
Identity = 86/223 (38.57%), Postives = 115/223 (51.57%), Query Frame = 2
Query:  485 YFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            Y +I L +G  G GF++AGG + PH   D  IF+TKII  GAA  DGRL ++D I+ VNDV++  VTH  AV+ LK AG  + L + R K                         P  E+ +              E+ LIK    GLG SI GG    +   D+ I ++K+  GG A  DGRLQ+GD IL V++  L  V HE+AV  LKNT + V L +A+
Sbjct:  116 YEEITLERGNSGLGFSIAGGTDNPHVGDDPSIFITKIIPGGAAAQDGRLSVNDCILFVNDVDVREVTHSQAVEALKEAGAIVRLYVLRRK-------------------------PAAEKVT--------------EIKLIK-GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIEGGAAHKDGRLQIGDKILAVNNVCLEDVMHEDAVGALKNTAEVVYLRVAK 298          

HSP 3 Score: 74.3294 bits (181), Expect = 1.103e-13
Identity = 39/89 (43.82%), Postives = 52/89 (58.43%), Query Frame = 2
Query:  887 QFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            ++E   ++R   GLG SI GG D  +  +D  I I+K+ PGG A  DGRL V D IL V+D  +  VTH +AV  LK  G  V L++ R
Sbjct:  115 EYEEITLERGNSGLGFSIAGGTDNPHVGDDPSIFITKIIPGGAAAQDGRLSVNDCILFVNDVDVREVTHSQAVEALKEAGAIVRLYVLR 203          

HSP 4 Score: 61.6178 bits (148), Expect = 8.802e-10
Identity = 49/153 (32.03%), Postives = 76/153 (49.67%), Query Frame = 2
Query:  377 SNDNYEPEDYPDYQDPNYNQEYEP--EANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYS 829
            S+  Y   DYP    P     + P     + D++ P    +I +++G  G GF + GG      E   GIF++ I+  G A++ G L   D I+SVN V+L   THE A   LKNAGQ++ ++ +   DEY   E   +H++ +   N+   S
Sbjct:  325 SHPGYLGSDYPQALTPTSPSRFSPVLHGMMGDDDIPREPRRILIHRGSTGLGFNIVGG------EDGEGIFISFILAGGPADLSGELHKGDQILSVNGVDLRMATHEQAAAALKNAGQTVTIVAQYRPDEYSRFE-AKIHDLREQLMNSSMGS 470          
BLAST of Disks large homolog 1 vs. Planmine SMEST
Match: SMESG000020502.1 (SMESG000020502.1)

HSP 1 Score: 674.855 bits (1740), Expect = 0.000e+0
Identity = 418/418 (100.00%), Postives = 418/418 (100.00%), Query Frame = 2
Query:    2 MDIRKDDTERAVNLLKFYXXXXXXXXXXXXXXAMEKLIDTLETPLFSALLDIQEFYEVSLSSAISGNKSPVQPVYNDIIPEAKLEVQETPVXXXXXXXXXXXXXXXXXXXXXXXIASPKPVSKVKSNDNYEPEDYPDYQDPNYNQEYEPEANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIARFXXXXXXXXXXXXXXXXXXXXXXXXXXHRRDREE 1255
            MDIRKDDTERAVNLLKFYKSKLNKSEEKSLKKAMEKLIDTLETPLFSALLDIQEFYEVSLSSAISGNKSPVQPVYNDIIPEAKLEVQETPVKLKKEKSKKSKRHQKSEEEQSEEIASPKPVSKVKSNDNYEPEDYPDYQDPNYNQEYEPEANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKIDDVIVSVNDVNLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIARFIPETVEQEPEPEEPIVEKTEKKKKKKHRRDREE
Sbjct:    1 MDIRKDDTERAVNLLKFYKSKLNKSEEKSLKKAMEKLIDTLETPLFSALLDIQEFYEVSLSSAISGNKSPVQPVYNDIIPEAKLEVQETPVKLKKEKSKKSKRHQKSEEEQSEEIASPKPVSKVKSNDNYEPEDYPDYQDPNYNQEYEPEANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKIDDVIVSVNDVNLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIARFIPETVEQEPEPEEPIVEKTEKKKKKKHRRDREE 418          
BLAST of Disks large homolog 1 vs. Planmine SMEST
Match: SMESG000020500.1 (SMESG000020500.1)

HSP 1 Score: 178.718 bits (452), Expect = 1.088e-52
Identity = 110/232 (47.41%), Postives = 153/232 (65.95%), Query Frame = 2
Query:  467 ENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKD-EYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLAN-NEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIARF 1156
            E + W++ ++ L KGRKG+GFA     ++  +  D+ I +TKI+ EG A+ DGRLKI D+IVSVNDV+ + V +E A+ TL+N G ++ + +RRLK+  Y ++E  +++      PN    S   E +   E       FQQ EV L+KR+ GGLGI+I+GGY+  N +EED+YI ISKL   GVA  DGRLQVGD+IL VD +S +G+TH EAV  LKN GK VT+F+ RF
Sbjct:   48 EGHEWIFIKVHLKKGRKGFGFAFIN--DRSIHREDDAISITKIVHEGVAQQDGRLKIGDIIVSVNDVDFDEVPYEKAISTLRNIGPNLTMTVRRLKEYCYESDENDDMN-----PPNAYEISDSFESDDQPE-------FQQLEVNLVKRAVGGLGINIEGGYNTENEDEEDNYIRISKLAVNGVAANDGRLQVGDIILQVDLQSFDGLTHYEAVEILKNCGKEVTIFVGRF 265          
BLAST of Disks large homolog 1 vs. Planmine SMEST
Match: SMESG000034854.1 (SMESG000034854.1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.107e-21
Identity = 86/257 (33.46%), Postives = 123/257 (47.86%), Query Frame = 2
Query:  506 KGRKGYGFAVAGGYNKPHYE-GDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILII----------------RRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEE-------------------NAENDNFQQFE-----VTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            KG  G+GF+VAGG + P++   D GI+VTKI   G+ ++ G L IDD I+SVN +N+ Y+THE AV  LK AG  + L+I                RR      A+  ++  +  QA  ++   SPE+ + + H                      + N +F   +     ++LIK    GLG SI GG    +   D  I I+K+   G A   G +  GD ++ V+D  L  VTHEEAV  L N G  V L I +
Sbjct:  193 KGSTGFGFSVAGGIDNPYFHLNDPGIYVTKITPGGSVDLSGSLNIDDQILSVNGINMTYLTHEAAVSALKEAGDELHLVIQRDPTLKHRMSGLGYMRRKNASLTASTISDSRQDSQAEKSSSQVSPEYIKTNSHSSVWVTSSKASSVPSNLSQGIKSSNSSFVSLKSRIVTISLIK-GERGLGFSIGGGRGNEHYVGDPGIYITKVMDKGAAATCGLISEGDKLVQVNDYLLTDVTHEEAVKILCNVGSKVELKILK 448          

HSP 2 Score: 97.8265 bits (242), Expect = 2.403e-21
Identity = 79/240 (32.92%), Postives = 114/240 (47.50%), Query Frame = 2
Query:  494 IDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEE------NAENDN----FQQFEVTLIKRS-----------TGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIA 1150
            I L KG +G GF++ GG    HY GD GI++TK++ +GAA   G +   D +V VND  L  VTHE AV  L N G  + L I +       N T    E     P +   S +   ES          N  ++N    F + +   I +S           T G G +I GG      E++  I +S + P G+AD +G + VGD I  V+   ++  TH+EA + LK +GKT+ L + 
Sbjct:  364 ISLIKGERGLGFSIGGGRGNEHYVGDPGIYITKVMDKGAAATCGLISEGDKLVQVNDYLLTDVTHEEAVKILCNVGSKVELKILKPNSGVSNNVTEQFEE-----PFSNCQSSKDLSESLSNNDSPVRLNGSDNNHDIFFDEVDSNFINKSPRIVVLSRPNETVGFGFNIVGG------EDEDGIFVSFIIPSGIADKNGNIFVGDRIWQVNGTDISIATHDEAASLLKGSGKTLELLLT 592          
BLAST of Disks large homolog 1 vs. Planmine SMEST
Match: SMESG000034854.1 (SMESG000034854.1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.132e-21
Identity = 86/257 (33.46%), Postives = 123/257 (47.86%), Query Frame = 2
Query:  506 KGRKGYGFAVAGGYNKPHYE-GDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILII----------------RRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEE-------------------NAENDNFQQFE-----VTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            KG  G+GF+VAGG + P++   D GI+VTKI   G+ ++ G L IDD I+SVN +N+ Y+THE AV  LK AG  + L+I                RR      A+  ++  +  QA  ++   SPE+ + + H                      + N +F   +     ++LIK    GLG SI GG    +   D  I I+K+   G A   G +  GD ++ V+D  L  VTHEEAV  L N G  V L I +
Sbjct:  181 KGSTGFGFSVAGGIDNPYFHLNDPGIYVTKITPGGSVDLSGSLNIDDQILSVNGINMTYLTHEAAVSALKEAGDELHLVIQRDPTLKHRMSGLGYMRRKNASLTASTISDSRQDSQAEKSSSQVSPEYIKTNSHSSVWVTSSKASSVPSNLSQGIKSSNSSFVSLKSRIVTISLIK-GERGLGFSIGGGRGNEHYVGDPGIYITKVMDKGAAATCGLISEGDKLVQVNDYLLTDVTHEEAVKILCNVGSKVELKILK 436          

HSP 2 Score: 97.8265 bits (242), Expect = 2.690e-21
Identity = 79/240 (32.92%), Postives = 114/240 (47.50%), Query Frame = 2
Query:  494 IDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEE------NAENDN----FQQFEVTLIKRS-----------TGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIA 1150
            I L KG +G GF++ GG    HY GD GI++TK++ +GAA   G +   D +V VND  L  VTHE AV  L N G  + L I +       N T    E     P +   S +   ES          N  ++N    F + +   I +S           T G G +I GG      E++  I +S + P G+AD +G + VGD I  V+   ++  TH+EA + LK +GKT+ L + 
Sbjct:  352 ISLIKGERGLGFSIGGGRGNEHYVGDPGIYITKVMDKGAAATCGLISEGDKLVQVNDYLLTDVTHEEAVKILCNVGSKVELKILKPNSGVSNNVTEQFEE-----PFSNCQSSKDLSESLSNNDSPVRLNGSDNNHDIFFDEVDSNFINKSPRIVVLSRPNETVGFGFNIVGG------EDEDGIFVSFIIPSGIADKNGNIFVGDRIWQVNGTDISIATHDEAASLLKGSGKTLELLLT 580          
BLAST of Disks large homolog 1 vs. Planmine SMEST
Match: SMESG000030959.1 (SMESG000030959.1)

HSP 1 Score: 84.7297 bits (208), Expect = 4.930e-17
Identity = 63/214 (29.44%), Postives = 111/214 (51.87%), Query Frame = 2
Query:  515 KGYGFAVAGGYNKPHYEGDN-GIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRRLKDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIAR 1153
            +G+GF +     +    G + G ++ K+I    A+  G L++ D I+SVN  ++  + HE  V T+KN G+++ L I  + +E   +  T+++    +   +   S      SY + +  +     F+VTL  R + G G SI+GG D         + + ++   G A  DGRL+VGD IL ++ KS  G+TH +A+N ++  GK++ L + R
Sbjct: 1162 EGFGFVIVTSMTR---SGSHVGEYIGKLIENSPAQKCGLLRVGDRILSVNGNSVSRMRHEKIVQTIKNCGRNVTLRISPVPEEGGHSGPTSINSYESSDQGSSIRS---SNASYQKSDTNSSGDVDFDVTL-NRGSKGFGFSIRGGQDF----NKMPLFVLRIADDGPAKQDGRLKVGDKILQINGKSTTGMTHNQAINIIQAGGKSIRLLVRR 1364          

HSP 2 Score: 57.7658 bits (138), Expect = 1.546e-8
Identity = 33/89 (37.08%), Postives = 56/89 (62.92%), Query Frame = 2
Query:  488 FQIDLNKGRKGYGFAVAGG--YNKPHYEGDNGIFVTKIITEGAAEVDGRLKXXXXXXXXXXXXLEYVTHETAVDTLKNAGQSMILIIRR 748
            F + LN+G KG+GF++ GG  +NK        +FV +I  +G A+ DGRLK+ D I+ +N  +   +TH  A++ ++  G+S+ L++RR
Sbjct: 1282 FDVTLNRGSKGFGFSIRGGQDFNK------MPLFVLRIADDGPAKQDGRLKVGDKILQINGKSTTGMTHNQAINIIQAGGKSIRLLVRR 1364          

HSP 3 Score: 55.8398 bits (133), Expect = 6.385e-8
Identity = 33/89 (37.08%), Postives = 50/89 (56.18%), Query Frame = 2
Query:  893 EVTLIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDLILHVDDKSLNGVTHEEAVNFLK--NTGKTVTLFIAR 1153
              TLIK S  G G +I GG D +  E   ++ I  + PGG A VDGRL+ GD++++VD   + G  H + V   +  + G+ VTL + +
Sbjct:  575 RTTLIK-SPRGFGFTIIGGSDRSRPE---FLQIKHVMPGGPAAVDGRLETGDVLVYVDHTLVLGFLHADIVELFQCISIGQHVTLTVCK 659          
The following BLAST results are available for this feature:
BLAST of Disks large homolog 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DLG11.623e-3932.54discs large MAGUK scaffold protein 1 [Source:HGNC ... [more]
DLG11.349e-3732.54discs large MAGUK scaffold protein 1 [Source:HGNC ... [more]
DLG11.349e-3732.54discs large MAGUK scaffold protein 1 [Source:HGNC ... [more]
DLG11.664e-3732.54discs large MAGUK scaffold protein 1 [Source:HGNC ... [more]
DLG11.704e-3732.54discs large MAGUK scaffold protein 1 [Source:HGNC ... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlg-13.344e-3036.33Disks large homolog 1 [Source:UniProtKB/Swiss-Pro... [more]
dlg-12.595e-2635.10Disks large homolog 1 [Source:UniProtKB/Swiss-Pro... [more]
dlg-12.595e-2635.10Disks large homolog 1 [Source:UniProtKB/Swiss-Pro... [more]
mpz-12.326e-1327.60Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-13.157e-1327.60Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlg17.881e-2837.93gene:FBgn0001624 transcript:FBtr0073484[more]
dlg11.490e-2737.93gene:FBgn0001624 transcript:FBtr0301288[more]
dlg12.098e-2737.93gene:FBgn0001624 transcript:FBtr0308088[more]
dlg12.177e-2738.08gene:FBgn0001624 transcript:FBtr0330390[more]
dlg12.189e-2738.08gene:FBgn0001624 transcript:FBtr0073485[more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlg32.977e-2839.46discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
dlg33.035e-2839.46discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
dlg33.104e-2839.46discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
dlg1l6.290e-2836.71discs, large (Drosophila) homolog 1, like [Source:... [more]
dlg28.493e-2837.67discs, large homolog 2 (Drosophila) [Source:NCBI g... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pinx11.414e-3734.28PIN2 (TERF1) interacting telomerase inhibitor 1 [S... [more]
pinx13.190e-2939.57PIN2 (TERF1) interacting telomerase inhibitor 1 [S... [more]
hmmr4.342e-2937.13hyaluronan-mediated motility receptor (RHAMM) [Sou... [more]
hmmr4.876e-2937.13hyaluronan-mediated motility receptor (RHAMM) [Sou... [more]
hmmr4.976e-2937.13hyaluronan-mediated motility receptor (RHAMM) [Sou... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dlg11.383e-2835.69discs large MAGUK scaffold protein 1 [Source:MGI S... [more]
Dlg11.707e-2838.12discs large MAGUK scaffold protein 1 [Source:MGI S... [more]
Dlg11.828e-2838.12discs large MAGUK scaffold protein 1 [Source:MGI S... [more]
Dlg11.828e-2838.12discs large MAGUK scaffold protein 1 [Source:MGI S... [more]
Dlg11.870e-2838.12discs large MAGUK scaffold protein 1 [Source:MGI S... [more]
back to top
BLAST of Disks large homolog 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6R005|DLG4_DANRE3.733e-3031.51Disks large homolog 4 OS=Danio rerio OX=7955 GN=dl... [more]
sp|G5ECY0|DLG1_CAEEL4.253e-2936.33Disks large homolog 1 OS=Caenorhabditis elegans OX... [more]
sp|Q811D0|DLG1_MOUSE1.278e-2738.12Disks large homolog 1 OS=Mus musculus OX=10090 GN=... [more]
sp|Q12959|DLG1_HUMAN2.022e-2738.57Disks large homolog 1 OS=Homo sapiens OX=9606 GN=D... [more]
sp|Q5PYH7|DLG2_DANRE6.686e-2737.67Disks large homolog 2 OS=Danio rerio OX=7955 GN=dl... [more]
back to top
BLAST of Disks large homolog 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2P1GIU41.407e-3535.24DLG OS=Oscarella lobularis OX=121494 PE=2 SV=1[more]
A0A4W4FCC09.851e-3533.92Uncharacterized protein OS=Electrophorus electricu... [more]
W5KTN92.097e-3431.33Discs, large homolog 1 (Drosophila) OS=Astyanax me... [more]
F7CY762.220e-3434.28PIN2 (TERF1) interacting telomerase inhibitor 1 OS... [more]
A0A2K5KXB52.269e-3432.54Discs large MAGUK scaffold protein 1 OS=Cercocebus... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlg17.943e-3831.33disks large homolog 1 [Source:NCBI gene;Acc:103021... [more]
dlg31.177e-3433.16discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
dlg31.645e-2838.67discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
dlg32.025e-2838.67discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
dlg33.338e-2839.01discs, large homolog 3 (Drosophila) [Source:ZFIN;A... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scrib2.503e-1731.02scribble planar cell polarity protein [Source:NCBI... [more]
ENSPMAT00000004677.12.750e-1127.98pep scaffold:Pmarinus_7.0:GL479538:28591:32639:-1 ... [more]
ENSPMAT00000006056.19.278e-1130.23pep scaffold:Pmarinus_7.0:GL477535:225:55869:1 gen... [more]
lin7a1.044e-1045.33lin-7 homolog A (C. elegans) [Source:ZFIN;Acc:ZDB-... [more]
LIN7B5.772e-1042.67lin-7 homolog B, crumbs cell polarity complex comp... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Disks large homolog 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO460591.014e-2836.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334322.321e-2134.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337068.556e-1832.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348287.924e-1444.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456243.374e-1230.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Disks large homolog 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dlg31.839e-3434.37discs large MAGUK scaffold protein 3 [Source:NCBI ... [more]
dlg32.082e-3434.90discs large MAGUK scaffold protein 3 [Source:NCBI ... [more]
dlg31.792e-2839.46discs large MAGUK scaffold protein 3 [Source:NCBI ... [more]
dlg4a2.608e-2738.89disks large homolog 4 [Source:NCBI gene;Acc:101159... [more]
dlg4a3.310e-2738.03disks large homolog 4 [Source:NCBI gene;Acc:101159... [more]
back to top
BLAST of Disks large homolog 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020502.10.000e+0100.00SMESG000020502.1[more]
SMESG000020500.11.088e-5247.41SMESG000020500.1[more]
SMESG000034854.11.107e-2133.46SMESG000034854.1[more]
SMESG000034854.11.132e-2133.46SMESG000034854.1[more]
SMESG000030959.14.930e-1729.44SMESG000030959.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021297 ID=SMED30021297|Name=Disks large homolog 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1364bp
AATGGATATCAGGAAGGATGACACTGAAAGAGCTGTGAATTTACTTAAAT
TCTATAAATCAAAACTCAATAAATCAGAAGAAAAGTCCTTAAAAAAAGCA
ATGGAGAAATTAATTGACACTTTGGAAACCCCACTTTTTTCAGCTTTACT
GGATATTCAAGAGTTCTACGAAGTTTCACTATCTAGCGCTATTTCTGGAA
ATAAATCTCCTGTCCAACCCGTCTATAATGATATAATTCCCGAGGCTAAA
TTAGAAGTTCAAGAAACACCAGTCAAGCTAAAGAAAGAAAAATCTAAAAA
ATCAAAACGGCATCAAAAATCCGAGGAAGAACAGTCTGAGGAAATTGCGT
CACCGAAACCTGTTTCTAAAGTAAAGTCAAATGATAATTATGAACCTGAA
GACTATCCTGATTATCAAGATCCAAATTACAATCAAGAATATGAACCGGA
AGCGAATTTGGAAGATGAAAATAATCCTTGGTTGTATTTCCAAATTGATT
TGAATAAAGGCCGAAAAGGTTATGGATTTGCCGTAGCGGGAGGTTACAAT
AAACCACACTATGAAGGAGATAATGGAATTTTTGTTACCAAGATTATAAC
AGAGGGAGCAGCAGAAGTTGATGGCAGACTTAAAATTGATGATGTAATTG
TTTCGGTAAATGATGTCAATCTCGAATATGTTACTCACGAAACCGCTGTC
GACACTTTAAAAAATGCTGGCCAGTCAATGATTCTAATTATACGTCGTTT
GAAAGATGAGTATGTTGCTAATGAAACCACAAACCTTCATGAGGTGGTAC
AGGCTACACCAAATACCGGCTATTATTCACCTGAACACGAACAGGAATCA
TATCACGAGGAGAATGCTGAGAATGACAATTTCCAACAATTTGAAGTTAC
TTTGATTAAAAGATCAACTGGCGGTCTAGGAATTAGTATTCAAGGAGGTT
ATGATCTTGCTAACAACGAAGAGGATTCTTACATATCAATTTCTAAATTA
ACACCAGGCGGAGTTGCAGATGTAGATGGTAGACTTCAAGTTGGAGATTT
AATTTTACACGTCGATGATAAGTCGCTTAACGGTGTTACTCACGAGGAAG
CTGTAAACTTCTTAAAAAACACTGGGAAAACTGTAACACTCTTTATTGCT
AGATTTATTCCAGAAACTGTTGAACAAGAACCAGAACCCGAGGAACCTAT
TGTAGAAAAAACTGAAAAGAAAAAGAAAAAGAAGCACAGACGAGACCGTG
AAGAATGAGTATCAATGTTATTCTTGAATATTTAAACAATATTTATTTAA
TTTATCATAATCTATGGCTGTGTAAGAAATTTTATAGTTTTCAATAAATG
TATTTTATGTTTTC
back to top

protein sequence of SMED30021297-orf-1

>SMED30021297-orf-1 ID=SMED30021297-orf-1|Name=SMED30021297-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=419bp
MDIRKDDTERAVNLLKFYKSKLNKSEEKSLKKAMEKLIDTLETPLFSALL
DIQEFYEVSLSSAISGNKSPVQPVYNDIIPEAKLEVQETPVKLKKEKSKK
SKRHQKSEEEQSEEIASPKPVSKVKSNDNYEPEDYPDYQDPNYNQEYEPE
ANLEDENNPWLYFQIDLNKGRKGYGFAVAGGYNKPHYEGDNGIFVTKIIT
EGAAEVDGRLKIDDVIVSVNDVNLEYVTHETAVDTLKNAGQSMILIIRRL
KDEYVANETTNLHEVVQATPNTGYYSPEHEQESYHEENAENDNFQQFEVT
LIKRSTGGLGISIQGGYDLANNEEDSYISISKLTPGGVADVDGRLQVGDL
ILHVDDKSLNGVTHEEAVNFLKNTGKTVTLFIARFIPETVEQEPEPEEPI
VEKTEKKKKKKHRRDREE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0016324apical plasma membrane
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0014069postsynaptic density
GO:0016020membrane
GO:0016323basolateral plasma membrane
GO:0030054cell junction
GO:0045211postsynaptic membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR036892L27_dom_sf
IPR001478PDZ
IPR015143L27_1
IPR004172L27_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004385guanylate kinase activity
GO:0035255ionotropic glutamate receptor binding
Vocabulary: biological process
TermDefinition
GO:0007268chemical synaptic transmission
GO:0007399nervous system development
GO:0043113receptor clustering
GO:0045197establishment or maintenance of epithelial cell apical/basal polarity
GO:0046037GMP metabolic process
GO:0046710GDP metabolic process
GO:0097120receptor localization to synapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 400..418
NoneNo IPR availableGENE3DG3DSA:1.10.287.470coord: 4..54
e-value: 1.1E-16
score: 62.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 102..116
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 90..142
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 391..418
NoneNo IPR availablePANTHERPTHR23119DISCS LARGEcoord: 280..388
coord: 13..257
NoneNo IPR availablePANTHERPTHR23119:SF51DISKS LARGE 1 TUMOR SUPPRESSOR PROTEINcoord: 280..388
coord: 13..257
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 163..248
e-value: 1.7341E-17
score: 74.9106
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 297..383
e-value: 2.11932E-22
score: 88.3926
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 307..386
e-value: 7.1E-21
score: 85.3
coord: 172..251
e-value: 1.8E-18
score: 77.4
IPR001478PDZ domainPFAMPF00595PDZcoord: 164..247
e-value: 6.1E-18
score: 64.9
coord: 299..382
e-value: 8.3E-20
score: 70.9
IPR001478PDZ domainPROSITEPS50106PDZcoord: 164..251
score: 20.827
IPR001478PDZ domainPROSITEPS50106PDZcoord: 298..386
score: 22.636
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 274..393
e-value: 3.6E-28
score: 99.9
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 144..249
e-value: 3.1E-27
score: 96.6
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 159..250
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 292..385
IPR015143L27-1PFAMPF09058L27_1coord: 3..60
e-value: 6.4E-20
score: 70.9
IPR004172L27 domainPROSITEPS51022L27coord: 4..64
score: 10.479
IPR036892L27 domain superfamilySUPERFAMILYSSF101288L27 domaincoord: 4..60