PBPe domain-containing protein

Overview
NamePBPe domain-containing protein
Smed IDSMED30021286
Length (bp)773
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021286

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30021286SMESG000069544.1 SmedASXL_000133SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 89.7373 bits (221), Expect = 9.149e-20
Identity = 63/243 (25.93%), Postives = 114/243 (46.91%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFAC 712
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++   V   ST    + S  S Y++    ++SR Q   +R  DE    +L     +   + +S++ +YV  RNC+ +  I    +      G  I +PY+  +   I +L + G +     K+W  N       +  N +  AL +  E +GG+FI  A  + LS+ +   E  +    +  ++   C
Sbjct:  625 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVL---TTDYALLMESTSIEYVTQRNCN-LTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN----GCPEEDNKEASALGV--ENIGGIFIVLAAGLVLSVFVAIGEFIYKSRKNNDIEQAFC 857          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 89.7373 bits (221), Expect = 9.361e-20
Identity = 63/243 (25.93%), Postives = 114/243 (46.91%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFAC 712
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++   V   ST    + S  S Y++    ++SR Q   +R  DE    +L     +   + +S++ +YV  RNC+ +  I    +      G  I +PY+  +   I +L + G +     K+W  N       +  N +  AL +  E +GG+FI  A  + LS+ +   E  +    +  ++   C
Sbjct:  640 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVL---TTDYALLMESTSIEYVTQRNCN-LTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN----GCPEEDNKEASALGV--ENIGGIFIVLAAGLVLSVFVAIGEFIYKSRKNNDIEQAFC 872          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 88.1965 bits (217), Expect = 3.050e-19
Identity = 62/230 (26.96%), Postives = 110/230 (47.83%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFW 673
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++   V   ST    + S  S Y++    ++SR Q   +R  DE    +L     +   + +S++ +YV  RNC+ +  I    +      G  I +PY+  +   I +L + G +     K+W  N       +  N +  AL +  E +GG+FI  A  + LS+ +   E  +
Sbjct:  640 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVL---TTDYALLMESTSIEYVTQRNCN-LTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN----GCPEEDNKEASALGV--ENIGGIFIVLAAGLVLSVFVAIGEFIY 859          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 88.1965 bits (217), Expect = 3.266e-19
Identity = 62/230 (26.96%), Postives = 110/230 (47.83%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFW 673
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++   V   ST    + S  S Y++    ++SR Q   +R  DE    +L     +   + +S++ +YV  RNC+ +  I    +      G  I +PY+  +   I +L + G +     K+W  N       +  N +  AL +  E +GG+FI  A  + LS+ +   E  +
Sbjct:  640 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVL---TTDYALLMESTSIEYVTQRNCN-LTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN----GCPEEDNKEASALGV--ENIGGIFIVLAAGLVLSVFVAIGEFIY 859          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 88.1965 bits (217), Expect = 3.436e-19
Identity = 62/230 (26.96%), Postives = 110/230 (47.83%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFW 673
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++   V   ST    + S  S Y++    ++SR Q   +R  DE    +L     +   + +S++ +YV  RNC+ +  I    +      G  I +PY+  +   I +L + G +     K+W  N       +  N +  AL +  E +GG+FI  A  + LS+ +   E  +
Sbjct:  625 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVL---TTDYALLMESTSIEYVTQRNCN-LTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN----GCPEEDNKEASALGV--ENIGGIFIVLAAGLVLSVFVAIGEFIY 844          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-2 (Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10914])

HSP 1 Score: 73.559 bits (179), Expect = 1.264e-14
Identity = 57/241 (23.65%), Postives = 109/241 (45.23%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQEL-NSRVQYIRYIDECPNMILQDNANNLVCIS--------------------DSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCT 661
            D  P A+S R   + WW F +II  +Y+A+L +FLT++     I+++E+L+ +  +   V EG STA   + S   +Y+++ N  V   +   E     + ++ +N + +S                    + + N Y   R       +    N        +I  P +  L+  I  L++ G+++K   K+W  + G  DT   ++  G +  ++L ++ G+F    IL+   +L +CT
Sbjct:  613 DILPRAVSGRIASSCWWFFTLIIVSSYTANLAAFLTLERMTPPIESVEDLANQNKILYGVNEGGSTAAFFEDSIVPLYKKMWNFMVSTTQKQIELEKQSITNSTSNRIFVSSYADGIEKVRTSKGKYAFLLEETTNNYESGRRPCDTMKVGQNLNTLGYGIATKIGNPLRVSLNLAILYLSEKGELKKLENKWW-YDRGQCDT--GTSDGGTSSSLNLSKVAGIFY---ILLAGMVLSMCT 847          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-2 (Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10914])

HSP 1 Score: 73.1738 bits (178), Expect = 1.478e-14
Identity = 57/241 (23.65%), Postives = 109/241 (45.23%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQEL-NSRVQYIRYIDECPNMILQDNANNLVCIS--------------------DSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCT 661
            D  P A+S R   + WW F +II  +Y+A+L +FLT++     I+++E+L+ +  +   V EG STA   + S   +Y+++ N  V   +   E     + ++ +N + +S                    + + N Y   R       +    N        +I  P +  L+  I  L++ G+++K   K+W  + G  DT   ++  G +  ++L ++ G+F    IL+   +L +CT
Sbjct:  682 DILPRAVSGRIASSCWWFFTLIIVSSYTANLAAFLTLERMTPPIESVEDLANQNKILYGVNEGGSTAAFFEDSIVPLYKKMWNFMVSTTQKQIELEKQSITNSTSNRIFVSSYADGIEKVRTSKGKYAFLLEETTNNYESGRRPCDTMKVGQNLNTLGYGIATKIGNPLRVSLNLAILYLSEKGELKKLENKWW-YDRGQCDT--GTSDGGTSSSLNLSKVAGIFY---ILLAGMVLSMCT 916          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-7 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q18591])

HSP 1 Score: 70.8626 bits (172), Expect = 9.166e-14
Identity = 62/257 (24.12%), Postives = 114/257 (44.36%), Query Frame = 2
Query:   11 PYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAII------LQGSNYSVYQELN--------SRVQYI--------------RYIDECPNMILQDNA--------NNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFW 673
            P  +S R V A WW+F  II  +Y+A+L +FLTV   EQ I +L++L+ +  ++   ++G+++         ++ + Y++++E++         R +                RY+ E    +  D A        +    I D++  +Y    NC+ +  +   F+    A  VQ     K  + S I  L +   +E    K+W+ N   V   D+S+       I ++ +GGVFI     I LS++ L  E ++
Sbjct:  348 PKNISGRLVAATWWLFGFIIIASYTANLAAFLTVSRLEQPISSLDDLAKQYKIEYAPIKGSASETYFRRMAEIEETFYNMWKEMSLNESMSPRDRAKLAVWDYPVSDKFTNMWRYMQESKLPVNMDTAVDRVLNSVDGFAFIGDATEIKYAALTNCN-LQQVGTEFSRKPYAIAVQSGHILKDKISSAILMLLNERRLETLKEKWWTDNPNKVSCPDSSDESD---GISIQNIGGVFIVILAGIALSIVTLAFEYYY 600          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-7 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q18591])

HSP 1 Score: 70.8626 bits (172), Expect = 1.152e-13
Identity = 62/257 (24.12%), Postives = 114/257 (44.36%), Query Frame = 2
Query:   11 PYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAII------LQGSNYSVYQELN--------SRVQYI--------------RYIDECPNMILQDNA--------NNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFW 673
            P  +S R V A WW+F  II  +Y+A+L +FLTV   EQ I +L++L+ +  ++   ++G+++         ++ + Y++++E++         R +                RY+ E    +  D A        +    I D++  +Y    NC+ +  +   F+    A  VQ     K  + S I  L +   +E    K+W+ N   V   D+S+       I ++ +GGVFI     I LS++ L  E ++
Sbjct:  562 PKNISGRLVAATWWLFGFIIIASYTANLAAFLTVSRLEQPISSLDDLAKQYKIEYAPIKGSASETYFRRMAEIEETFYNMWKEMSLNESMSPRDRAKLAVWDYPVSDKFTNMWRYMQESKLPVNMDTAVDRVLNSVDGFAFIGDATEIKYAALTNCN-LQQVGTEFSRKPYAIAVQSGHILKDKISSAILMLLNERRLETLKEKWWTDNPNKVSCPDSSDESD---GISIQNIGGVFIVILAGIALSIVTLAFEYYY 814          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-1 (Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot;Acc:P34299])

HSP 1 Score: 70.4774 bits (171), Expect = 1.276e-13
Identity = 52/224 (23.21%), Postives = 103/224 (45.98%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIRYID-ECPNMILQDNANNL----------VCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNT-QGMALPIDLEELGGVFICTAILIG 637
            D  P ++S R   + WW F +II  +Y+A+L +FLT++  +  I+++E+L+ +  +K  +  G STA   + S+  +YQ +       RY++ + P + +   A  +            + +++AN+Y   R       +    N           + +K  ++  I  L + G+++K   K+W         CD   T  G +  ++L ++ G+F    IL+G
Sbjct:  655 DILPRSISGRIASSAWWFFTMIIVSSYTANLAAFLTLEKMQAPIESVEDLAKQSKIKYGIQGGGSTASFFKYSSVQIYQRM------WRYMESQVPPVFVASYAEGIERVRSHKGRYAFLLEATANEYENTRKPCDTMKVGANLNSIGYGIATPFGSDWKDHINLAILALQERGELKKLENKWWY----DRGQCDAGITVDGSSASLNLSKVAGIFY---ILMG 865          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: KaiR1D (gene:FBgn0038837 transcript:FBtr0083987)

HSP 1 Score: 102.834 bits (255), Expect = 1.464e-24
Identity = 62/235 (26.38%), Postives = 115/235 (48.94%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIRYIDECPNMILQDNANNLVCIS----------DSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVD-TCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFW 673
            DF P A+S R V  +WW F +I+  +Y+A+L +FLTV+  +  I++ E+L+ +  +K   ++G STA   + S  S YQ + S ++  R     P++    N   +  ++          +S++ +YV  RNC ++  +    +  +       ++PY+  ++S I KL + G +    TK+W    G      + S +   A  + L  +GGVF+     +G++ +I   E  W
Sbjct:  608 DFLPKALSTRMVAGIWWFFTLIMISSYTANLAAFLTVERMDSPIESAEDLAKQTRIKYGALKGGSTAAFFRDSKISTYQRMWSFMESAR-----PSVFTASNGEGVERVAKGKGSYAFLMESTSIEYVTERNC-ELTQVGGMLDTKSYGIATPPNSPYRTAINSVILKLQEEGKLHILKTKWWKEKRGGGKCRVETSKSSSAANELGLANVGGVFVVLMGGMGVACVIAVCEFVW 836          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: GluRIIE (gene:FBgn0051201 transcript:FBtr0110837)

HSP 1 Score: 88.1965 bits (217), Expect = 1.615e-19
Identity = 65/261 (24.90%), Postives = 126/261 (48.28%), Query Frame = 2
Query:   11 PYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGT-STAIILQGSNYSVYQELNSRVQYIRYIDECPNMILQDNANNL---------VCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFI------CTAILIGLSLLILCTEVFWTHSLDKPL-DSFACQY*QLLDMND 742
            P A+S RTV + WW F +I+  +Y+A+L +FLT++  + LI ++++L+  KD  +   + T ST      S    Y+++N      +++ E P  + +DN   +           + +S++ +Y   R C+ +  I D  +       ++ D P++   ++ + +L + G +EK   K+W+  +G+   C        A P+D+  L GVF       C A+L G+   +L   +   H    PL D+   ++  ++D N+
Sbjct:  617 PKALSTRTVASFWWFFTLIVVSSYTANLAAFLTIEKPQSLINSVDDLADNKDGVVYGAKKTGSTRNFFMTSAEERYKKMN------KFMSENPQYLTEDNMEGVNRVKTNTHYAFLMESTSIEYNTKRECN-LKKIGDALDEKGYGIAMRKDWPHRGKFNNALLELQEQGVLEKMKNKWWN-EVGT-GICATKEDAPDATPLDMNNLEGVFFVLLVGSCCALLYGIISWVLFV-MKKAHHYRVPLRDALKEEFQFVIDFNN 867          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: clumsy (gene:FBgn0026255 transcript:FBtr0110895)

HSP 1 Score: 84.3445 bits (207), Expect = 3.158e-18
Identity = 61/231 (26.41%), Postives = 114/231 (49.35%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQ------YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALP-IDLEELGGVFICTAILIGLSLLILCTEVFW 673
            D  P A S R V  +WW FA+++  +Y+A+L +FLT   Q   I + E+L+ +  +K   + G ST    + SN+S YQ++ + ++      + +  DE    + Q   N    + +S+  +Y V R C  +  I    +  +    +  ++PY+  + + + KL + G + +   K+W    G    C+ S+  G   P + LE +GGVF+   + +  ++++ CTE  W
Sbjct:  610 DILPKAASTRLVTGMWWFFALMMLNSYTANLAAFLTNSRQANSINSAEDLAAQSKIKYGAMAGGSTMGFFRDSNFSTYQKMWTAMESASPSVFTKTNDEGVERV-QKGKNLYAFLMESTTLEYNVERKCD-LVQIGGWLDYKSYGIAMPFNSPYRKQISAAVLKLGELGQLAELKRKWWKEMHGG-GNCEKSDEDGGDTPELGLENVGGVFLVLGLGLLSAMVLGCTEFLW 837          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: GluRIIC (gene:FBgn0046113 transcript:FBtr0336969)

HSP 1 Score: 82.8037 bits (203), Expect = 1.343e-17
Identity = 65/232 (28.02%), Postives = 107/232 (46.12%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIRYIDECPNMILQD----------NANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYW-SINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTE 664
            D  P +   R   A WWIFA+II  +Y+A+L +FLT    E  I  L++LS +K +K   + G ST  +L  SN +VY     R+ +    ++ P+   +D          N  + + + +++  +Y   +NC  +  + + F   + A  V   A Y+  L   I KL++ G++     K+W + N    +  D   T  M      EEL G+F      I ++ LI  TE
Sbjct:  617 DILPRSPQVRMFEATWWIFAIIIANSYTANLAAFLTSSKMEGSIANLKDLSAQKKVKFGTIYGGSTYNLLADSNETVY-----RLAFNLMNNDDPSAYTKDNLEGVDRVRKNRGDYMFLMETTTLEYHREQNCD-LRSVGEKFGEKHYAIAVPFGAEYRSNLSVAILKLSERGELYDLKQKWWKNPNASCFEEPDPDATPDMT----FEELRGIFYTLYAGILIAFLIGITE 838          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0110906)

HSP 1 Score: 77.411 bits (189), Expect = 7.181e-16
Identity = 56/227 (24.67%), Postives = 107/227 (47.14%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIR---YIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFW 673
            D YP AMS R + + W  F++II  +Y+A+L +FLT +     I+  E+L+ + ++    ++  ST    + S    Y+++   +   +   +     + I + N  N   + +S+   Y+V R+C+ +  I    +           +P++  +   I +L + GDI+    K+W  N     T  N++ Q  A  + LE +GGVF+     I ++ ++   E FW
Sbjct:  596 DIYPRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTERMINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRVNQGNYAFLMESTMLDYIVQRDCN-LTQIGGLLDTKGYGIATPKGSPWRDKISLAILELQERGDIQMLYDKWWK-NTDETCTRKNTSKQSKANSLGLESIGGVFVVLIAGIIVAAVVAFFE-FW 819          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: grik4 (glutamate receptor, ionotropic, kainate 4 [Source:ZFIN;Acc:ZDB-GENE-070821-5])

HSP 1 Score: 85.8853 bits (211), Expect = 1.472e-18
Identity = 56/227 (24.67%), Postives = 108/227 (47.58%), Query Frame = 2
Query:   11 PYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQEL------NSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFW 673
            P A+S R V  VWW F +II  +Y+A+L +FLTV+  E  I+++++L+ +  ++   + G ST    Q S Y  YQ +           +++  +E    +L  N   L+   +S+ N+Y   RNC+ +  I    +      G+ + + Y+   D  I +L +   +E    K+W  + G     ++   +G+     +E +GG+F+     + +++ +   E  W
Sbjct:  613 PRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESVDDLADQTAIEYGTMHGGSTMTFFQNSRYQTYQRMWNFMYSKQPSVFVKSTEEGIARVLNSNYAYLL---ESTMNEYYRQRNCN-LTQIGGLLDTKGYGIGMPLGSVYRDEFDLAILRLQEENRLEILKRKWW--DGGKCPKEEDHRAKGLG----MENIGGIFVVLVCGLLVAIFMAVLEFVW 829          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: grik4 (glutamate receptor, ionotropic, kainate 4 [Source:ZFIN;Acc:ZDB-GENE-070821-5])

HSP 1 Score: 85.8853 bits (211), Expect = 1.472e-18
Identity = 56/227 (24.67%), Postives = 108/227 (47.58%), Query Frame = 2
Query:   11 PYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQEL------NSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFW 673
            P A+S R V  VWW F +II  +Y+A+L +FLTV+  E  I+++++L+ +  ++   + G ST    Q S Y  YQ +           +++  +E    +L  N   L+   +S+ N+Y   RNC+ +  I    +      G+ + + Y+   D  I +L +   +E    K+W  + G     ++   +G+     +E +GG+F+     + +++ +   E  W
Sbjct:  613 PRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESVDDLADQTAIEYGTMHGGSTMTFFQNSRYQTYQRMWNFMYSKQPSVFVKSTEEGIARVLNSNYAYLL---ESTMNEYYRQRNCN-LTQIGGLLDTKGYGIGMPLGSVYRDEFDLAILRLQEENRLEILKRKWW--DGGKCPKEEDHRAKGLG----MENIGGIFVVLVCGLLVAIFMAVLEFVW 829          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:556013])

HSP 1 Score: 84.7297 bits (208), Expect = 3.178e-18
Identity = 59/239 (24.69%), Postives = 114/239 (47.70%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLD 700
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++  VVE  ST    + +  S Y +    ++SR     ++ I+E    +L    ++   + +S+  ++V  RNC+ +  I    +      G  + +PY+  +   I +L + G +     K+W  N       +  N +  AL +  + +GG+FI  A  + LS+ +   E  +    +  L+
Sbjct:  625 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSIEEGIERVL---TSDYAFLMESTTIEFVTQRNCN-LTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN----GCPEEENKEASALGV--QNIGGIFIVLAAGLVLSVFVAVGEFLYKSKQNAQLE 853          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:556013])

HSP 1 Score: 84.7297 bits (208), Expect = 3.178e-18
Identity = 59/239 (24.69%), Postives = 114/239 (47.70%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLD 700
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++  VVE  ST    + +  S Y +    ++SR     ++ I+E    +L    ++   + +S+  ++V  RNC+ +  I    +      G  + +PY+  +   I +L + G +     K+W  N       +  N +  AL +  + +GG+FI  A  + LS+ +   E  +    +  L+
Sbjct:  625 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSIEEGIERVL---TSDYAFLMESTTIEFVTQRNCN-LTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN----GCPEEENKEASALGV--QNIGGIFIVLAAGLVLSVFVAVGEFLYKSKQNAQLE 853          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: grik1a (glutamate receptor, ionotropic, kainate 1a [Source:ZFIN;Acc:ZDB-GENE-030131-6502])

HSP 1 Score: 79.7221 bits (195), Expect = 1.859e-16
Identity = 53/231 (22.94%), Postives = 110/231 (47.62%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQEL---NSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTE-VFWTHS 682
            +  P A+S R +  +WW F +II  +Y+A+L +FLTV+  +  I + ++L+ +  ++   V   ST    + S  S Y+++    S  +    +    + I +    +   + +S++ +Y+  RNC+ +  +    +      G  I +PY+  +   I +L + G +     K+W  N      C   +++  A  + +E +GG+FI  A  + LS+ +   E ++ +H 
Sbjct:  605 ELMPKALSTRILGGIWWFFTLIIISSYTANLAAFLTVERMDSPIDSADDLAKQTRIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRKNTALVKNSKDGITRVLTTDYALLMESTSIEYITQRNCN-LTQVGGLIDSKGYGVGTPIGSPYRDKVTIAILQLQEEGKLHMMKEKWWRGN-----GCPEEDSK-EASALGVENIGGIFIVLAAGLVLSVFVAIGEFIYKSHK 828          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: GRIK1 (glutamate receptor, ionotropic, kainate 1 [Source:NCBI gene;Acc:100493949])

HSP 1 Score: 88.9669 bits (219), Expect = 1.548e-19
Identity = 62/244 (25.41%), Postives = 116/244 (47.54%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFACQ 715
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++   V   ST    + S  S Y++    ++SR Q   ++  DE    +L     +   + +S++ +YV  RNC+ +  I    +      G  I +PY+  +   I +L + G +     K+W  N      C   +++  A  + +E +GG+FI  A  + LS+ +   E  +    +  ++  A Q
Sbjct:  615 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVKNNDEGIQRVL---TTDYALLMESTSIEYVTQRNCN-LTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN-----GCPEEDSKE-ASALGVENIGGIFIVLAAGLVLSVFVAIGEFIYKSRKNSDIEQVASQ 848          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: GRIK4 (glutamate receptor, ionotropic, kainate 4 [Source:NCBI gene;Acc:100490768])

HSP 1 Score: 87.8113 bits (216), Expect = 4.105e-19
Identity = 55/228 (24.12%), Postives = 113/228 (49.56%), Query Frame = 2
Query:   11 PYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQ------YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWT 676
            P A+S R V  VWW F +II  +Y+A+L +FLTV+  +  I+++++L+ +  ++   + G S+    Q S Y  YQ + + +       +++  +E    +L  N   L+   +S+ N+Y   RNC+ +  +    +      G+ + + ++   D  I +L ++  +E    K+W  + G     ++   +G+     +E +GG+F+     + +++LI   E  WT
Sbjct:  321 PRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLADQTTIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMHSKQPSVFVKSTEEGIARVLNSNYAFLL---ESTMNEYYRQRNCN-LTQVGGLLDTKGYGIGMPVGSAFRDEFDLAILQLQENNCLEDLKRKWW--DGGKCPKEEDHRAKGLG----MENIGGIFVVLICGLIVAILIAMLEFLWT 538          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: GRIK4 (glutamate receptor, ionotropic, kainate 4 [Source:NCBI gene;Acc:100490768])

HSP 1 Score: 87.8113 bits (216), Expect = 4.126e-19
Identity = 55/228 (24.12%), Postives = 113/228 (49.56%), Query Frame = 2
Query:   11 PYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQ------YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWT 676
            P A+S R V  VWW F +II  +Y+A+L +FLTV+  +  I+++++L+ +  ++   + G S+    Q S Y  YQ + + +       +++  +E    +L  N   L+   +S+ N+Y   RNC+ +  +    +      G+ + + ++   D  I +L ++  +E    K+W  + G     ++   +G+     +E +GG+F+     + +++LI   E  WT
Sbjct:  578 PRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLADQTTIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMHSKQPSVFVKSTEEGIARVLNSNYAFLL---ESTMNEYYRQRNCN-LTQVGGLLDTKGYGIGMPVGSAFRDEFDLAILQLQENNCLEDLKRKWW--DGGKCPKEEDHRAKGLG----MENIGGIFVVLICGLIVAILIAMLEFLWT 795          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: GRIK4 (glutamate receptor, ionotropic, kainate 4 [Source:NCBI gene;Acc:100490768])

HSP 1 Score: 87.8113 bits (216), Expect = 4.363e-19
Identity = 55/228 (24.12%), Postives = 113/228 (49.56%), Query Frame = 2
Query:   11 PYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQ------YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWT 676
            P A+S R V  VWW F +II  +Y+A+L +FLTV+  +  I+++++L+ +  ++   + G S+    Q S Y  YQ + + +       +++  +E    +L  N   L+   +S+ N+Y   RNC+ +  +    +      G+ + + ++   D  I +L ++  +E    K+W  + G     ++   +G+     +E +GG+F+     + +++LI   E  WT
Sbjct:  612 PRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLADQTTIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMHSKQPSVFVKSTEEGIARVLNSNYAFLL---ESTMNEYYRQRNCN-LTQVGGLLDTKGYGIGMPVGSAFRDEFDLAILQLQENNCLEDLKRKWW--DGGKCPKEEDHRAKGLG----MENIGGIFVVLICGLIVAILIAMLEFLWT 829          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: GRIK1 (glutamate receptor, ionotropic, kainate 1 [Source:NCBI gene;Acc:100493949])

HSP 1 Score: 87.8113 bits (216), Expect = 4.585e-19
Identity = 61/243 (25.10%), Postives = 115/243 (47.33%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFAC 712
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++   V   ST    + S  S Y++    ++SR Q   ++  DE    +L     +   + +S++ +YV  RNC+ +  I    +      G  I +PY+  +   I +L + G +     K+W  N      C   +++  A  + +E +GG+FI  A  + LS+ +   E  +    +  ++   C
Sbjct:  554 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVKNNDEGIQRVL---TTDYALLMESTSIEYVTQRNCN-LTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN-----GCPEEDSK-EASALGVENIGGIFIVLAAGLVLSVFVAIGEFIYKSRKNSDIEQAFC 786          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 88.1965 bits (217), Expect = 2.671e-19
Identity = 61/243 (25.10%), Postives = 115/243 (47.33%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFAC 712
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++   V   ST    + S  S Y++    ++SR Q   ++  DE    +L     +   + +S++ +YV  RNC+ +  I    +      G  I +PY+  +   I +L + G +     K+W  N      C   +++  A  + +E +GG+FI  A  + LS+ +   E  +    +  ++   C
Sbjct:  625 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVL---TTDYALLMESTSIEYVTQRNCN-LTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN-----GCPEEDSK-EASALGVENIGGIFIVLAAGLVLSVFVAIGEFIYKSRKNNDIEQAFC 857          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 88.1965 bits (217), Expect = 2.690e-19
Identity = 61/243 (25.10%), Postives = 115/243 (47.33%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFAC 712
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++   V   ST    + S  S Y++    ++SR Q   ++  DE    +L     +   + +S++ +YV  RNC+ +  I    +      G  I +PY+  +   I +L + G +     K+W  N      C   +++  A  + +E +GG+FI  A  + LS+ +   E  +    +  ++   C
Sbjct:  554 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVL---TTDYALLMESTSIEYVTQRNCN-LTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN-----GCPEEDSK-EASALGVENIGGIFIVLAAGLVLSVFVAIGEFIYKSRKNNDIEQAFC 786          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Grik4 (glutamate receptor, ionotropic, kainate 4 [Source:MGI Symbol;Acc:MGI:95817])

HSP 1 Score: 87.0409 bits (214), Expect = 6.774e-19
Identity = 57/241 (23.65%), Postives = 113/241 (46.89%), Query Frame = 2
Query:   11 PYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQEL------NSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFACQ 715
            P A+S R V  VWW F +II  +Y+A+L +FLTV+  E  I+++++L+ +  ++   + G S+    Q S Y  YQ +           +++  +E    +L  N   L+   +S+ N+Y   RNC+ +  I    +      G+ + + ++   D  I +L ++  +E    K+W    G     ++   +G+     +E +GG+F+     + +++ +   E  WT    +  +   CQ
Sbjct:  613 PRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESVDDLADQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAFLL---ESTMNEYYRQRNCN-LTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILKRKWW--EGGKCPKEEDHRAKGLG----MENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEASEVSVCQ 843          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Grik4 (glutamate receptor, ionotropic, kainate 4 [Source:MGI Symbol;Acc:MGI:95817])

HSP 1 Score: 87.0409 bits (214), Expect = 6.774e-19
Identity = 57/241 (23.65%), Postives = 113/241 (46.89%), Query Frame = 2
Query:   11 PYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQEL------NSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFACQ 715
            P A+S R V  VWW F +II  +Y+A+L +FLTV+  E  I+++++L+ +  ++   + G S+    Q S Y  YQ +           +++  +E    +L  N   L+   +S+ N+Y   RNC+ +  I    +      G+ + + ++   D  I +L ++  +E    K+W    G     ++   +G+     +E +GG+F+     + +++ +   E  WT    +  +   CQ
Sbjct:  613 PRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESVDDLADQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAFLL---ESTMNEYYRQRNCN-LTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILKRKWW--EGGKCPKEEDHRAKGLG----MENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEASEVSVCQ 843          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 86.6557 bits (213), Expect = 7.647e-19
Identity = 60/230 (26.09%), Postives = 111/230 (48.26%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFW 673
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++   V   ST    + S  S Y++    ++SR Q   ++  DE    +L     +   + +S++ +YV  RNC+ +  I    +      G  I +PY+  +   I +L + G +     K+W  N      C   +++  A  + +E +GG+FI  A  + LS+ +   E  +
Sbjct:  640 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVL---TTDYALLMESTSIEYVTQRNCN-LTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN-----GCPEEDSK-EASALGVENIGGIFIVLAAGLVLSVFVAIGEFIY 859          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|P39086|GRIK1_HUMAN (Glutamate receptor ionotropic, kainate 1 OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 4.496e-19
Identity = 63/243 (25.93%), Postives = 114/243 (46.91%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFAC 712
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++   V   ST    + S  S Y++    ++SR Q   +R  DE    +L     +   + +S++ +YV  RNC+ +  I    +      G  I +PY+  +   I +L + G +     K+W  N       +  N +  AL +  E +GG+FI  A  + LS+ +   E  +    +  ++   C
Sbjct:  640 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVL---TTDYALLMESTSIEYVTQRNCN-LTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN----GCPEEDNKEASALGV--ENIGGIFIVLAAGLVLSVFVAIGEFIYKSRKNNDIEQAFC 872          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|Q38PU4|GRIK1_MACFA (Glutamate receptor ionotropic, kainate 1 OS=Macaca fascicularis OX=9541 GN=GRIK1 PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 4.581e-19
Identity = 63/243 (25.93%), Postives = 114/243 (46.91%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFAC 712
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++   V   ST    + S  S Y++    ++SR Q   +R  DE    +L     +   + +S++ +YV  RNC+ +  I    +      G  I +PY+  +   I +L + G +     K+W  N       +  N +  AL +  E +GG+FI  A  + LS+ +   E  +    +  ++   C
Sbjct:  640 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVL---TTDYALLMESTSIEYVTQRNCN-LTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN----GCPEEDNKEASALGV--ENIGGIFIVLAAGLVLSVFVAIGEFIYKSRKNNDIEQAFC 872          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8BMF5|GRIK4_MOUSE (Glutamate receptor ionotropic, kainate 4 OS=Mus musculus OX=10090 GN=Grik4 PE=2 SV=2)

HSP 1 Score: 87.0409 bits (214), Expect = 4.739e-18
Identity = 57/241 (23.65%), Postives = 113/241 (46.89%), Query Frame = 2
Query:   11 PYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQEL------NSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFACQ 715
            P A+S R V  VWW F +II  +Y+A+L +FLTV+  E  I+++++L+ +  ++   + G S+    Q S Y  YQ +           +++  +E    +L  N   L+   +S+ N+Y   RNC+ +  I    +      G+ + + ++   D  I +L ++  +E    K+W    G     ++   +G+     +E +GG+F+     + +++ +   E  WT    +  +   CQ
Sbjct:  613 PRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESVDDLADQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAFLL---ESTMNEYYRQRNCN-LTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILKRKWW--EGGKCPKEEDHRAKGLG----MENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEASEVSVCQ 843          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|Q01812|GRIK4_RAT (Glutamate receptor ionotropic, kainate 4 OS=Rattus norvegicus OX=10116 GN=Grik4 PE=1 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 5.111e-18
Identity = 57/241 (23.65%), Postives = 113/241 (46.89%), Query Frame = 2
Query:   11 PYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQEL------NSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFACQ 715
            P A+S R V  VWW F +II  +Y+A+L +FLTV+  E  I+++++L+ +  ++   + G S+    Q S Y  YQ +           +++  +E    +L  N   L+   +S+ N+Y   RNC+ +  I    +      G+ + + ++   D  I +L ++  +E    K+W    G     ++   +G+     +E +GG+F+     + +++ +   E  WT    +  +   CQ
Sbjct:  613 PRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESVDDLADQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAFLL---ESTMNEYYRQRNCN-LTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILKRKWW--EGGKCPKEEDHRAKGLG----MENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEASEVSVCQ 843          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|P22756|GRIK1_RAT (Glutamate receptor ionotropic, kainate 1 OS=Rattus norvegicus OX=10116 GN=Grik1 PE=1 SV=3)

HSP 1 Score: 86.6557 bits (213), Expect = 5.451e-18
Identity = 60/230 (26.09%), Postives = 111/230 (48.26%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFW 673
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++   V   ST    + S  S Y++    ++SR Q   ++  DE    +L     +   + +S++ +YV  RNC+ +  I    +      G  I +PY+  +   I +L + G +     K+W  N      C   +++  A  + +E +GG+FI  A  + LS+ +   E  +
Sbjct:  640 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVL---TTDYALLMESTSIEYVTQRNCN-LTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN-----GCPEEDSK-EASALGVENIGGIFIVLAAGLVLSVFVAIGEFLY 859          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A1I8IYQ8 (PBPe domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 1.451e-38
Identity = 87/234 (37.18%), Postives = 128/234 (54.70%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDK-PLD 700
            DFYP+ MS+RTVLA WW+F VII+ +Y+ DLT+ LTV   +  IKTL++L  +  +K  V  GT+   +L  SN  +Y+++   +  I   +ECP+   + +     C++D S    +  +NCS+ Y+  + FN A +AF    DA Y    +  ++KL +SG I++W   YW     S DT         A  I+LE +GG FI    L    LLIL  E+ WT+   K PLD
Sbjct:   16 DFYPFCMSSRTVLAFWWLFTVIIYASYTGDLTAHLTVTVTDYPIKTLQDLVSQTAIKPYVSVGTNLHTLLAQSNSGIYKQMADMMVEIGPYEECPSFPRKADEG---CMNDYSFLLAIAMKNCSEYYVADELFNTATLAFMFPEDAYYADSFNFQLQKLHESGQIQRWFEFYW-----SSDTVCTVGKSAEADAINLEGVGGCFIIALSLFVAGLLILTIELIWTNLAKKQPLD 241          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A267FSX5 (PBPe domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017883g2 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 4.545e-34
Identity = 88/234 (37.61%), Postives = 127/234 (54.27%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDK-PLD 700
            DFYP+AMS R VLA WW+F VII+G Y+ DLT+ LT+   +  IKTL +L  +  +K +V EGT+   +L  S   VY+++  +   +   D  P  I Q       C++D +A  YV   NCSK+Y+  + FN A +AF    DA +   +D   +K+ ++G ++K    YW     S D   +S +   A  I+LE  GG FI      GL LL L  E+ WT +L + PLD
Sbjct:  342 DFYPFAMSPRAVLAFWWMFTVIIYGTYTGDLTAHLTISFTDLPIKTLSDLVAQSAVKPLVPEGTNLDTLLSSSTGGVYRQVADK---MLMSDTLPGCIEQTFQGKEACLTDYTALLYVARANCSKVYIADEIFNTATVAFMYPEDAYFGANIDFQFQKMHETGIMQKLFNTYW-----SSDAVCSSGSSTEADSINLEGSGGCFIVALAFYGLGLLTLLVELLWTKALKRHPLD 567          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A267H134 (PBPe domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017883g1 PE=3 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 7.897e-34
Identity = 88/234 (37.61%), Postives = 127/234 (54.27%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDK-PLD 700
            DFYP+AMS R VLA WW+F VII+G Y+ DLT+ LT+   +  IKTL +L  +  +K +V EGT+   +L  S   VY+++  +   +   D  P  I Q       C++D +A  YV   NCSK+Y+  + FN A +AF    DA +   +D   +K+ ++G ++K    YW     S D   +S +   A  I+LE  GG FI      GL LL L  E+ WT +L + PLD
Sbjct:  540 DFYPFAMSPRAVLAFWWMFTVIIYGTYTGDLTAHLTISFTDLPIKTLSDLVAQSAVKPLVPEGTNLDTLLSSSTGGVYRQVADK---MLMSDTLPGCIEQTFQGKEACLTDYTALLYVARANCSKVYIADEIFNTATVAFMYPEDAYFGANIDFQFQKMHETGIMQKLFNTYW-----SSDAVCSSGSSTEADSINLEGSGGCFIVALAFYGLGLLTLLVELLWTKALKRHPLD 765          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A1I8I240 (PBPe domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 132.494 bits (332), Expect = 1.977e-33
Identity = 81/237 (34.18%), Postives = 121/237 (51.05%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGM---ALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDK-PLD 700
            DFYPYAMS R V+  WW+F VII+GAY+ DLTS LTV      I++ E++     L  I+  GT+   + +G+   VY+++  ++     I +C   +       LVC+SD +    V N NC K+Y+  +  N A   F    +A +  +LD ++R L   G   +  TKY+     + D  D S + GM   A  I++E +GG  I T       L++L  E+ WT  L K P D
Sbjct:   59 DFYPYAMSPRAVMVFWWLFTVIIYGAYTGDLTSALTVSVTSLPIQSFEDMLADGSLTPIMPRGTTIHNVFKGAQSGVYKQITDQMLLADTIPDCAQAVFD---KGLVCLSDYTFLLNVANNNCEKVYLAKERANVAPCGFAYPKNAYFSELLDEHLRNLDIIGANSRLFTKYF-----TNDAPDQSCSVGMSTEADSINMEGVGGALIITGAFYVAGLILLACELVWTRLLRKTPFD 287          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A1I8HAM9 (CCHC-type domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.145e-33
Identity = 87/234 (37.18%), Postives = 127/234 (54.27%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDK-PLD 700
            DFYP+AMS R VLA WW+F VII+G Y+ DLT+ LT+   +  IKTL +L  +  +K +V EGT+   +L  S   VY+++  ++Q    I EC     Q       C++D +A  Y    NCSK+Y+  + FN A +AF    DA +   +D   +K+ ++G ++K    YW     S D   ++ +   A  I+LE  GG FI    L  L LL L  E+ WT +L + PLD
Sbjct: 1118 DFYPFAMSPRAVLAFWWMFTVIIYGTYTGDLTAHLTISFTDLPIKTLSDLVAQSAVKPLVPEGTNLYNLLTTSTGGVYRQVADKLQISDTIPECIEQTFQGKE---ACLTDYTALLYAARANCSKVYIADEIFNSATVAFMYPEDAYFGANIDFQFQKMHETGIMQKLFNTYW-----SSDAVCSTGSFAEADSINLEGSGGCFIVALALYSLGLLTLLVELLWTKALKRHPLD 1343          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000004586.2 (glutamate receptor ionotropic, kainate 2-like [Source:NCBI gene;Acc:103044887])

HSP 1 Score: 87.0409 bits (214), Expect = 4.074e-19
Identity = 59/230 (25.65%), Postives = 112/230 (48.70%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFW 673
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  +   VVE  ST    + +  S Y +    +NSR Q   ++ ++E    +L    ++   + +S+  ++V  RNC+ +  I    +      G  + +PY+  +   I +L + G +     K+W  N      C    ++  A  + ++ +GG+FI  A  + LS+ +   EV +
Sbjct:  627 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIPYGVVEDGSTMAFFKKTKISTYDKMWEFMNSRRQSVMVKSVEEGIQRVL---TSDYAFLMESTTIEFVTQRNCN-LTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN-----GCPEEESK-EASALGVQNIGGIFIVLAAGLVLSVFVAVGEVLY 846          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:103047375])

HSP 1 Score: 83.9593 bits (206), Expect = 5.879e-18
Identity = 57/245 (23.27%), Postives = 115/245 (46.94%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFACQY 718
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++  VVE  ST    + +  S Y +    ++SR     ++ ++E    +L    ++   + +S+  ++V  RNC+ +  I    +      G  + +PY+  +   I +L + G +     K+W  N      C    ++  A  + ++ +GG+FI  A  + LS+ +   E  +    +  L+     +
Sbjct:  626 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSVEEGIQRVL---TSDYAFLMESTTIEFVTQRNCN-LTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN-----GCPEEESK-EASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKQNAQLEKVKKHF 860          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:103047375])

HSP 1 Score: 83.5741 bits (205), Expect = 7.255e-18
Identity = 57/239 (23.85%), Postives = 114/239 (47.70%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLD 700
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++  VVE  ST    + +  S Y +    ++SR     ++ ++E    +L    ++   + +S+  ++V  RNC+ +  I    +      G  + +PY+  +   I +L + G +     K+W  N      C    ++  A  + ++ +GG+FI  A  + LS+ +   E  +    +  L+
Sbjct:  626 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSVEEGIQRVL---TSDYAFLMESTTIEFVTQRNCN-LTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN-----GCPEEESK-EASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKQNAQLE 854          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:103047375])

HSP 1 Score: 83.5741 bits (205), Expect = 7.811e-18
Identity = 57/239 (23.85%), Postives = 114/239 (47.70%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLD 700
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++  VVE  ST    + +  S Y +    ++SR     ++ ++E    +L    ++   + +S+  ++V  RNC+ +  I    +      G  + +PY+  +   I +L + G +     K+W  N      C    ++  A  + ++ +GG+FI  A  + LS+ +   E  +    +  L+
Sbjct:  626 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSVEEGIQRVL---TSDYAFLMESTTIEFVTQRNCN-LTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN-----GCPEEESK-EASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKQNAQLE 854          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:103047375])

HSP 1 Score: 83.5741 bits (205), Expect = 8.128e-18
Identity = 57/239 (23.85%), Postives = 114/239 (47.70%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLD 700
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++  VVE  ST    + +  S Y +    ++SR     ++ ++E    +L    ++   + +S+  ++V  RNC+ +  I    +      G  + +PY+  +   I +L + G +     K+W  N      C    ++  A  + ++ +GG+FI  A  + LS+ +   E  +    +  L+
Sbjct:  594 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSVEEGIQRVL---TSDYAFLMESTTIEFVTQRNCN-LTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN-----GCPEEESK-EASALGVQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKQNAQLE 822          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 1.236e-16
Identity = 52/213 (24.41%), Postives = 100/213 (46.95%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQEL-----NSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTA 625
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++   V   ST    + S  S Y+++     + +   I+  +E    +L     +   + +S+  +YV  RNC+ +  I    +      G  + +PY+  +   I +L + G +     K+W  N      C   ++   A  + ++ +GG+FI  A
Sbjct:  125 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPISSADDLAKQTRIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQTALIKNNEEGIQRVL---TTDYAMLMESTNIEYVTQRNCN-LTQIGGLIDNKGYGIGTPLGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN-----GCPEEDSN-EASALGVQNIGGIFIVLA 327          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: gria1b (glutamate receptor, ionotropic, AMPA 1b [Source:ZFIN;Acc:ZDB-GENE-020125-2])

HSP 1 Score: 70.4774 bits (171), Expect = 3.186e-14
Identity = 50/232 (21.55%), Postives = 102/232 (43.97%), Query Frame = 2
Query:   11 PYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIRYIDECPNMILQDNANNLVCIS----------DSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYW----SINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTE 664
            P ++S R V  VWW F +II  +Y+A+L +FLTV+     I++ ++L+ + ++    ++  ST    Q S   VY+++     ++   D  P + ++ NA+ +  +           +S+ N+Y   R       +    +           +  +  ++  + KL + G ++K   K+W        G  D+ D ++       + L  + GVF      +GL++L+   E
Sbjct:  254 PRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFQRSKIGVYEKM-----WLFMKDAEPKVFVRTNADGVSRVRKSKGKYAYLLESTTNEYTEQRKPCDTMKVGGNLDSKGYGIATPKGSALRDAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSA------LSLSNVAGVFYILVGGLGLAMLVALIE 474          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002503.1 (pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:ENSPMAG00000002286.1 transcript:ENSPMAT00000002503.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 1.413e-10
Identity = 33/128 (25.78%), Postives = 64/128 (50.00%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCS 373
            +  P A+S R V  +WW F +I+  +Y+A+L +FLTV+  E  I + ++L+ +  ++   V   ST    + S  S Y++    ++SR Q    +      I +    +   + +S+  ++V  R C+
Sbjct:   42 ELMPRALSTRIVGGIWWFFTLILISSYTANLAAFLTVERMESPIGSADDLAKQTKIEYGAVRDGSTMTFFKKSRISTYEKMWAFMSSRHQ-TALVKNNEEGIHRALTTDFAMLMESTTIEHVTQRYCN 168          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007790.1 (pep scaffold:Pmarinus_7.0:GL476616:796957:798868:-1 gene:ENSPMAG00000007047.1 transcript:ENSPMAT00000007790.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 4.513e-7
Identity = 45/231 (19.48%), Postives = 94/231 (40.69%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIRYIDECPNMIL-QDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDK 691
            D  P +M+ + ++  WW F +++   Y+A+L +FLT + Q   I++L++L+ + D +     G      L  S    Y  +   ++  R +   P   L Q      + I ++SA  +   ++   + +    F    +A      +     +   + +L DSG + + + + W    G      ++  Q     I++++  GVF    + I     +   E  W    D+
Sbjct:  102 DPLPLSMAGKIIVYTWWCFVLVVCSTYTANLAAFLTAEGQTS-IRSLKDLTRQMDARYGTYSGYRIVGFLNSSARDPYMTVWRHIRDNRTMVASPKKGLEQAEKAGYIFIGEASA-VFTAKKDHCDLIISDRRFFRHRLALPFPPGSRLAAEVSRAVTELEDSGQLAE-LERQWFAQEGQECVGLSNEHQ-----IEMKDFKGVFYFLMMGIAAGCGVCFVECLWFKRRDE 324          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010716.1 (pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1 gene:ENSPMAG00000009705.1 transcript:ENSPMAT00000010716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.2098 bits (108), Expect = 4.917e-6
Identity = 45/235 (19.15%), Postives = 99/235 (42.13%), Query Frame = 2
Query:   11 PYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIR---YIDECPNMILQDNANNLVC------ISDSSANQYVVNRN--CSKIYM-IPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTH 679
            P   +++ +++VW  FAVI   +Y+A+L +F+  +D    +  L +   +  L+        +     G+  +   E N R  Y++   Y+ +     ++D   +L        I D++   Y+  ++  C  + +     F        +Q  + +K  +D  + +    G++++ +   W   I     C       M+  +D++ + GVF    + +GLS ++   E F+ H
Sbjct:  562 PRGTTSKFMVSVWAFFAVIFLASYTANLAAFMIQEDYIDQVSGLSDKKFQSPLE-------HSPPFRFGTVPNGSTERNIRNNYLQMHGYMSKFHQKSVEDALMSLKAGKLDAFIYDAAVLNYMAGKDEGCRLVTIGSGKVFVATGYGIALQKSSRWKRAIDLALLQFIGDGEMDE-LEMIWLTGI-----CHGERNDVMSSQLDIDNMAGVFYMLLVAMGLSFIVFVCEHFFYH 783          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO41293 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J7])

HSP 1 Score: 77.411 bits (189), Expect = 8.139e-17
Identity = 51/227 (22.47%), Postives = 107/227 (47.14%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQ----YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCD--NSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTE 664
            D  P + S R + A +W+F +I+   Y+A+L +F T ++ +  I +LE+L  +   K  V +G S     + S   +Y+++  ++     +++  DE  N   +        ++D  +  Y   R      ++ +  +  + A G+Q ++ +   +   I +L + G++E+   K+W     ++  C+  ++      + ++L  L GVFI      G+SL+IL  E
Sbjct:   72 DNTPRSGSGRVLAASFWLFTLILISTYTANLAAFFTAQNSKSTINSLEDLVAQDVFKYGVQQGGSLFSFFEKSKVRIYKKMFGKMSTLNTFVKGTDEGVN---RSRTTPFAYLTDQPSLDYYNQRKPCNTMLVKNLLDAKSYALGLQRNSEWTDGISVAILQLREEGEVERIRYKWWD----AMSECNLKDAVVSNQPMSLELHHLAGVFIILGGGAGISLVILLME 291          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO30203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G4])

HSP 1 Score: 76.2554 bits (186), Expect = 8.378e-16
Identity = 55/230 (23.91%), Postives = 105/230 (45.65%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIRY----IDECPNMILQDNANNLVCISDSSANQYVVNR--NCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFW 673
              +P + S R  +AV+W   +I+   Y+A+L +FLT+K     I ++++L+ +KD+    V  +      + ++   +  +    QY+RY    ++     I +    N   I DS+  ++V +   +C  +      F      FG+  D+PY   L + I +L  +G +E    K+   N    +  + + ++     +  E+L GVFI     IG+S ++L  E  W
Sbjct:  646 HLHPVSSSGRITVAVYWFAMLIVMSTYTANLAAFLTIKRFTSPISSVDDLARQKDISYGTVLNSQPQAFFESASVPSFVTM---WQYMRYHHTFVNNSAEGIEKVMNENYAFIWDSAVLEFVAHNQISCGTLITSGSVFGRIGYGFGLAKDSPYTKQLSNAILQLRHAGYMEFLDRKWLKANDKCAEAAEKAKSENQ---LTFEDLSGVFIVLIAGIGVSCVVLVLEWIW 869          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO46633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPU4])

HSP 1 Score: 72.0182 bits (175), Expect = 2.014e-14
Identity = 63/229 (27.51%), Postives = 102/229 (44.54%), Query Frame = 2
Query:    8 YPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIRYID-ECPNMILQDNANNLVCISDSSANQYVVNRN-CSKIYMIPD----TFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELG-----GVFI--CTAILIGLSLLIL 655
            +P + S R  +AVWW    I+   Y+A++ +FLT    +  I+ +E+LS + ++    VE + T    Q S+   YQ +   ++  R +  +    I +        I D+   +Y+  +  C +I +I      TF  A+  F +   +PY  +L   I KL  SG I K + + W I        D +  Q  A   D  ++G     GVFI     I IG  LL+L
Sbjct:  580 HPVSASGRAAVAVWWFVITILGATYTANMAAFLTTTRMQTPIRRIEDLSSQTEIAYGCVENSLTQNFFQSSSVQRYQMMWEYMKLRRSLQPDTYTAIERTLKGKYAFIHDAPILEYLARKTYCGRIKLIGGYDTRTFGNAHYGFALPKKSPYTNLLSVEILKLVQSG-IAKTMIEEWMIERTPCAPLDEAEEQD-AKSSDTSKMGINNMLGVFIFMVAGIAIGGVLLLL 806          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO41291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J5])

HSP 1 Score: 60.8474 bits (146), Expect = 8.498e-11
Identity = 47/223 (21.08%), Postives = 99/223 (44.39%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLT-VKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIR-YIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTE 664
            D  P + S R + A +W+F +I+   Y+A+L ++ T  +     I +LE+L  +  +K  V EG S       S   +Y  +  +++    +++     +L+        ++D  +  Y   R      ++ +  +  + A  ++ ++ +  ++   I +L + G+IEK   ++W     S +     +T      ++L  L GVFI       +SL++L  E
Sbjct:  189 DNTPRSTSGRVLAAAFWLFTLILISTYTANLAAYFTGERGIRSKINSLEDLVSQSTVKYGVQEGGSLFTFFSESKVDIYATMFQQMKSQETFVNGTQYGVLKARTQPFAYLTDQPSLDYYNMRKPCNTMLVKNLLDAKSYALAMRRNSEWTNLISVAILELREEGEIEKSRLRWWD---DSSECPTGPSTDSSPQRLELHSLAGVFIILGGGATISLVLLLVE 408          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:NCBI gene;Acc:101172189])

HSP 1 Score: 89.3521 bits (220), Expect = 7.969e-20
Identity = 62/261 (23.75%), Postives = 116/261 (44.44%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQ---ELNSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWT------------HSLDKPLDSFACQY*QLLDMN 739
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++  VVE  ST    + +  S Y    E  S  ++   +    + I +   ++   +++S+  ++V  RNC+ +  I    +      G  + +PY+  +   I +L + G +     K+W  N    +    +N  G      ++ +GG+FI  A  + LS+ +   E  +                DK  + F C +   LD N
Sbjct:  624 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKVEYGVVEDGSTMSFFKKTKISTYDKMWEFMSSRRHSVMVGSVEDGIHRVLTSDYAFLTESTTIEFVTQRNCN-LTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEANALG------VQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKQSAQLEKAQWRQRDKKREEFCCHHGAKLDFN 877          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: grik4 (glutamate ionotropic receptor kainate type subunit 4 [Source:NCBI gene;Acc:101170037])

HSP 1 Score: 88.9669 bits (219), Expect = 1.033e-19
Identity = 58/227 (25.55%), Postives = 111/227 (48.90%), Query Frame = 2
Query:   11 PYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQ------YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFW 673
            P A+S R V  VWW F +II  +Y+A+L +FLTV+  E  I+++++L+ +  ++   + G ST    Q S Y  YQ + + +       +++  +E    +L  N   L+   +S+ N+Y   RNC+ +  I    +      G+ + + Y+   D  I KL +   +E    K+W  + G     ++   +G+     +E +GG+F+     + +++L+   E  W
Sbjct:  613 PRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESVDDLADQTSIEYGTMHGGSTMTFFQNSRYQTYQRMWNFMHSKQPSVFVKSTEEGIARVLNSNYAYLL---ESTMNEYYHQRNCN-LTQIGGLLDTKGYGVGMPLGSVYRDEFDLAILKLQEENRLEILKRKWW--DGGKCPKEEDHRAKGLG----MENIGGIFVVLVCGLLVAILMAVLEFVW 829          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:101173029])

HSP 1 Score: 86.6557 bits (213), Expect = 5.910e-19
Identity = 59/239 (24.69%), Postives = 115/239 (48.12%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQE----LNSRVQ--YIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLD 700
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  +   VVE  +T    + +  S Y +    +NSR Q   ++ ++E    +L    ++   + +S+  ++V  RNC+ +  I    +      G  + +PY+  +   I +L + G +     K+W  N      C    ++  A  + ++ +GG+FI  A  + LS+ +   EV +    +  L+
Sbjct:  628 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIPYGVVEDGATMTFFKKTKISTYDKMWEFMNSRRQSVMVKNVEEGIQRVL---TSDYAFLMESTTIEFVTQRNCN-LTQIGGLIDSRAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGN-----GCPEEESK-EASALGVQNIGGIFIVLAAGLVLSVFVAVGEVLYKSKQNAQLE 856          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:NCBI gene;Acc:101172189])

HSP 1 Score: 83.1889 bits (204), Expect = 8.632e-18
Identity = 56/236 (23.73%), Postives = 109/236 (46.19%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQ---ELNSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLD 700
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++  VVE  ST    + +  S Y    E  S  ++   +    + I +   ++   +++S+  ++V  RNC+ +  I    +      G  + +PY+  +   I +L + G +     K+W  N    +    +N  G      ++ +GG+FI  A  + LS+ +   E  +       L+
Sbjct:  612 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKVEYGVVEDGSTMSFFKKTKISTYDKMWEFMSSRRHSVMVGSVEDGIHRVLTSDYAFLTESTTIEFVTQRNCN-LTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEANALG------VQNIGGIFIVLAAGLVLSVFVAVGEFLYKSKQSAQLE 840          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:NCBI gene;Acc:101172189])

HSP 1 Score: 83.1889 bits (204), Expect = 8.784e-18
Identity = 55/227 (24.23%), Postives = 107/227 (47.14%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQ---ELNSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFW 673
            +  P A+S R V  +WW F +II  +Y+A+L +FLTV+  E  I + ++L+ +  ++  VVE  ST    + +  S Y    E  S  ++   +    + I +   ++   +++S+  ++V  RNC+ +  I    +      G  + +PY+  +   I +L + G +     K+W  N    +    +N  G      ++ +GG+FI  A  + LS+ +   E  +
Sbjct:  624 ELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKVEYGVVEDGSTMSFFKKTKISTYDKMWEFMSSRRHSVMVGSVEDGIHRVLTSDYAFLTESTTIEFVTQRNCN-LTQIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEANALG------VQNIGGIFIVLAAGLVLSVFVAVGEFLY 843          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000069544.1 (SMESG000069544.1)

HSP 1 Score: 405.601 bits (1041), Expect = 1.862e-145
Identity = 207/233 (88.84%), Postives = 207/233 (88.84%), Query Frame = 2
Query:   20 MSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFACQY 718
            MSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQ S                        ILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQG ALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFACQY
Sbjct:    1 MSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQVS------------------------ILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGTALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFACQY 209          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000069544.1 (SMESG000069544.1)

HSP 1 Score: 404.445 bits (1038), Expect = 5.601e-145
Identity = 206/233 (88.41%), Postives = 206/233 (88.41%), Query Frame = 2
Query:   20 MSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFACQY 718
            MSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQ                          ILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQG ALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFACQY
Sbjct:    1 MSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQ--------------------------ILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGTALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFACQY 207          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000069527.1 (SMESG000069527.1)

HSP 1 Score: 249.21 bits (635), Expect = 5.494e-82
Identity = 127/232 (54.74%), Postives = 173/232 (74.57%), Query Frame = 2
Query:   20 MSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFACQ 715
            MS+RTVLAVWW+F V+IF AYSADLTS+LTV+ + Q IK+ +ELS RK++KI++ EG +TAI LQ SNYSV+ EL SR  +++ +D+CPN+I QDN  NL CI+D+S   YV  R+CSK+Y IP+TF+ ++ +F VQ+DAPYKPILD YIRKL D+G IEKW+TKYWS +  + D+C  S++   A  I LE++ G++I    LI +S+ +L  E+FW   L KPL+SF  Q
Sbjct:    1 MSSRTVLAVWWMFTVVIFSAYSADLTSYLTVQSEGQTIKSFQELSNRKEIKIVLAEGAATAISLQSSNYSVFLELFSRAMFVKTVDDCPNLIYQDNGTNLACITDTSLVVYVAKRHCSKMYTIPETFDSSSTSFIVQMDAPYKPILDMYIRKLVDTGQIEKWVTKYWSTSDINADSCMGSSSSDSAPSITLEDVAGIYIFIIALIIISISLLILEIFWYKVLKKPLNSFCFQ 232          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000018611.1 (SMESG000018611.1)

HSP 1 Score: 214.927 bits (546), Expect = 1.451e-67
Identity = 108/235 (45.96%), Postives = 148/235 (62.98%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEELGGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSF 706
            DFYP+ +S+R VLA+WWI A+IIF AYSADLTSFLTV+++   I  + EL+ RKDL IIV +GT+    L  S+ +VYQELN R   I  +D+CP  IL  ++ NLVCISD S  +YV N NC  +YM+P+ FN A + F ++ D+PYK ++DSYI+ L ++G I KW+ KYW  +  +   CD +     A PID E + G+ I T  L    LL    E+ W  +    +D F
Sbjct:  168 DFYPFCISSRIVLAIWWIHALIIFSAYSADLTSFLTVQEKNNFISDINELANRKDLYIIVPKGTNIDSSLAESHNAVYQELNRRKITIDNVDDCPKKILLPSSTNLVCISDRSGMRYVTNMNCKDVYMVPEIFNIAALGFVLEKDSPYKNMIDSYIQILVENGLITKWVRKYWEDDEVTSRNCDGTEGDNSAEPIDFEGIFGICILTCSLFVCGLLFFIIELLWVKTFKNSVDKF 402          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000069533.1 (SMESG000069533.1)

HSP 1 Score: 216.853 bits (551), Expect = 1.024e-66
Identity = 97/153 (63.40%), Postives = 127/153 (83.01%), Query Frame = 2
Query:    2 DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEELSLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIRYIDECPNMILQDNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKPILD 460
            DFYPY+MS+RTVLA+WWIF V+IF  Y+ADLTSFLTVK  E  I +LEEL+ RKDLKIIV +GTSTAI LQ SNY+V++EL SR+QYIR IDECP +I++ N+ +LVCI+D+S+  YV+ + CS+IY++P+TF+  NI F VQ DAP+KP++D
Sbjct:  422 DFYPYSMSSRTVLAIWWIFTVVIFSTYTADLTSFLTVKTDEHYIHSLEELASRKDLKIIVEDGTSTAIFLQNSNYTVFKELYSRIQYIRAIDECPKLIMEGNSTHLVCIADTSSLTYVIRQFCSQIYIVPETFDSGNIGFPVQNDAPFKPLMD 574          
The following BLAST results are available for this feature:
BLAST of PBPe domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK19.149e-2025.93glutamate ionotropic receptor kainate type subunit... [more]
GRIK19.361e-2025.93glutamate ionotropic receptor kainate type subunit... [more]
GRIK13.050e-1926.96glutamate ionotropic receptor kainate type subunit... [more]
GRIK13.266e-1926.96glutamate ionotropic receptor kainate type subunit... [more]
GRIK13.436e-1926.96glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glr-21.264e-1423.65Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot... [more]
glr-21.478e-1423.65Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot... [more]
glr-79.166e-1424.12GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-71.152e-1324.12GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-11.276e-1323.21Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KaiR1D1.464e-2426.38gene:FBgn0038837 transcript:FBtr0083987[more]
GluRIIE1.615e-1924.90gene:FBgn0051201 transcript:FBtr0110837[more]
clumsy3.158e-1826.41gene:FBgn0026255 transcript:FBtr0110895[more]
GluRIIC1.343e-1728.02gene:FBgn0046113 transcript:FBtr0336969[more]
Ekar7.181e-1624.67gene:FBgn0039916 transcript:FBtr0110906[more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grik41.472e-1824.67glutamate receptor, ionotropic, kainate 4 [Source:... [more]
grik41.472e-1824.67glutamate receptor, ionotropic, kainate 4 [Source:... [more]
GRIK23.178e-1824.69glutamate receptor, ionotropic, kainate 2 [Source:... [more]
GRIK23.178e-1824.69glutamate receptor, ionotropic, kainate 2 [Source:... [more]
grik1a1.859e-1622.94glutamate receptor, ionotropic, kainate 1a [Source... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK11.548e-1925.41glutamate receptor, ionotropic, kainate 1 [Source:... [more]
GRIK44.105e-1924.12glutamate receptor, ionotropic, kainate 4 [Source:... [more]
GRIK44.126e-1924.12glutamate receptor, ionotropic, kainate 4 [Source:... [more]
GRIK44.363e-1924.12glutamate receptor, ionotropic, kainate 4 [Source:... [more]
GRIK14.585e-1925.10glutamate receptor, ionotropic, kainate 1 [Source:... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grik12.671e-1925.10glutamate receptor, ionotropic, kainate 1 [Source:... [more]
Grik12.690e-1925.10glutamate receptor, ionotropic, kainate 1 [Source:... [more]
Grik46.774e-1923.65glutamate receptor, ionotropic, kainate 4 [Source:... [more]
Grik46.774e-1923.65glutamate receptor, ionotropic, kainate 4 [Source:... [more]
Grik17.647e-1926.09glutamate receptor, ionotropic, kainate 1 [Source:... [more]
back to top
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P39086|GRIK1_HUMAN4.496e-1925.93Glutamate receptor ionotropic, kainate 1 OS=Homo s... [more]
sp|Q38PU4|GRIK1_MACFA4.581e-1925.93Glutamate receptor ionotropic, kainate 1 OS=Macaca... [more]
sp|Q8BMF5|GRIK4_MOUSE4.739e-1823.65Glutamate receptor ionotropic, kainate 4 OS=Mus mu... [more]
sp|Q01812|GRIK4_RAT5.111e-1823.65Glutamate receptor ionotropic, kainate 4 OS=Rattus... [more]
sp|P22756|GRIK1_RAT5.451e-1826.09Glutamate receptor ionotropic, kainate 1 OS=Rattus... [more]
back to top
BLAST of PBPe domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IYQ81.451e-3837.18PBPe domain-containing protein OS=Macrostomum lign... [more]
A0A267FSX54.545e-3437.61PBPe domain-containing protein (Fragment) OS=Macro... [more]
A0A267H1347.897e-3437.61PBPe domain-containing protein (Fragment) OS=Macro... [more]
A0A1I8I2401.977e-3334.18PBPe domain-containing protein OS=Macrostomum lign... [more]
A0A1I8HAM95.145e-3337.18CCHC-type domain-containing protein OS=Macrostomum... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000004586.24.074e-1925.65glutamate receptor ionotropic, kainate 2-like [Sou... [more]
GRIK25.879e-1823.27glutamate receptor ionotropic, kainate 2 [Source:N... [more]
GRIK27.255e-1823.85glutamate receptor ionotropic, kainate 2 [Source:N... [more]
GRIK27.811e-1823.85glutamate receptor ionotropic, kainate 2 [Source:N... [more]
GRIK28.128e-1823.85glutamate receptor ionotropic, kainate 2 [Source:N... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005084.11.236e-1624.41pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
gria1b3.186e-1421.55glutamate receptor, ionotropic, AMPA 1b [Source:ZF... [more]
ENSPMAT00000002503.11.413e-1025.78pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:E... [more]
ENSPMAT00000007790.14.513e-719.48pep scaffold:Pmarinus_7.0:GL476616:796957:798868:-... [more]
ENSPMAT00000010716.14.917e-619.15pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO412938.139e-1722.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302038.378e-1623.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466332.014e-1427.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412918.498e-1121.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK27.969e-2023.75glutamate ionotropic receptor kainate type subunit... [more]
grik41.033e-1925.55glutamate ionotropic receptor kainate type subunit... [more]
GRIK25.910e-1924.69glutamate receptor ionotropic, kainate 2 [Source:N... [more]
GRIK28.632e-1823.73glutamate ionotropic receptor kainate type subunit... [more]
GRIK28.784e-1824.23glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069544.11.862e-14588.84SMESG000069544.1[more]
SMESG000069544.15.601e-14588.41SMESG000069544.1[more]
SMESG000069527.15.494e-8254.74SMESG000069527.1[more]
SMESG000018611.11.451e-6745.96SMESG000018611.1[more]
SMESG000069533.11.024e-6663.40SMESG000069533.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021286 ID=SMED30021286|Name=PBPe domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=773bp
AGATTTTTATCCTTATGCAATGTCAGCAAGGACAGTGCTTGCGGTTTGGT
GGATATTCGCTGTGATAATATTCGGTGCCTATTCAGCTGACCTAACATCA
TTTTTAACCGTGAAGGATCAAGAACAATTAATAAAAACCTTAGAGGAATT
ATCCCTGAGGAAAGATCTTAAAATAATAGTAGTTGAAGGAACTAGTACTG
CTATTATACTTCAAGGATCCAATTATTCAGTTTACCAAGAACTTAATTCT
AGGGTTCAATATATTCGGTATATTGATGAATGTCCAAATATGATTCTCCA
AGACAATGCCAATAATTTAGTTTGTATTAGTGATTCCTCGGCTAACCAAT
ACGTGGTAAACAGAAATTGCTCAAAGATTTACATGATTCCGGACACTTTC
AATCCAGCTAACATTGCCTTTGGGGTTCAAATAGACGCTCCTTACAAACC
TATTTTAGATTCGTATATTCGAAAATTAACTGATTCCGGAGATATAGAGA
AATGGATCACAAAATATTGGTCAATAAATATTGGTTCTGTGGACACATGC
GACAACTCTAATACCCAAGGTATGGCTCTTCCAATTGATCTGGAGGAATT
GGGAGGAGTTTTTATTTGTACCGCAATTTTAATCGGCCTCTCACTGCTGA
TTCTTTGCACAGAAGTTTTTTGGACTCATTCTCTAGATAAACCTTTGGAC
TCATTTGCTTGTCAATATTGACAACTTTTAGACATGAATGATATTTGTGT
TCAATAAAATATATGTGTTAGGG
back to top

protein sequence of SMED30021286-orf-1

>SMED30021286-orf-1 ID=SMED30021286-orf-1|Name=SMED30021286-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=240bp
DFYPYAMSARTVLAVWWIFAVIIFGAYSADLTSFLTVKDQEQLIKTLEEL
SLRKDLKIIVVEGTSTAIILQGSNYSVYQELNSRVQYIRYIDECPNMILQ
DNANNLVCISDSSANQYVVNRNCSKIYMIPDTFNPANIAFGVQIDAPYKP
ILDSYIRKLTDSGDIEKWITKYWSINIGSVDTCDNSNTQGMALPIDLEEL
GGVFICTAILIGLSLLILCTEVFWTHSLDKPLDSFACQY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0038023signaling receptor activity
GO:0004970ionotropic glutamate receptor activity
GO:0004872receptor activity
GO:0005216ion channel activity
GO:0005234extracellular-glutamate-gated ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001320Iontro_rcpt
IPR006665OmpA-like
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0045202synapse
GO:0045211postsynaptic membrane
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0034220ion transmembrane transport
GO:0035235ionotropic glutamate receptor signaling pathway
GO:0060079excitatory postsynaptic potential
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 139..193
e-value: 8.1E-44
score: 151.8
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 4..221
e-value: 8.1E-44
score: 151.8
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 42..138
e-value: 8.1E-44
score: 151.8
NoneNo IPR availablePANTHERPTHR42643:SF13IONOTROPIC RECEPTOR 40A-RELATEDcoord: 2..225
NoneNo IPR availablePANTHERPTHR42643FAMILY NOT NAMEDcoord: 2..225
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 27..175
NoneNo IPR availableTMHMMTMhelixcoord: 202..224
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 4..209
e-value: 2.1E-16
score: 60.1