TIR domain-containing protein

Overview
NameTIR domain-containing protein
Smed IDSMED30021281
Length (bp)1995
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TIR domain-containing protein (SMED30021281) t-SNE clustered cells

Violin plots show distribution of expression levels for TIR domain-containing protein (SMED30021281) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TIR domain-containing protein (SMED30021281) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TIR domain-containing protein (SMED30021281) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021281

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30021281SMESG000079659.1 SMESG000079651.1 Contig154newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30021281SMESG000079659.1 SMESG000079651.1 Contig154uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30021281SMESG000079659.1 SMESG000079651.1 Contig154newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30021281SMESG000079659.1 SMESG000079651.1 Contig154uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30021281SMESG000079659.1 SMESG000079651.1 Contig154newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30021281SMESG000079659.1 SMESG000079651.1 Contig154uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30021281SMESG000033382.1 Contig154newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30021281SMESG000033382.1 Contig154uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30021281SMESG000033382.1 Contig154newmark_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30021281SMESG000033382.1 Contig154uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30021281SMESG000033382.1 Contig154newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30021281SMESG000033382.1 Contig154uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30021281SMESG000079651.1 dd_Smed_v4_1838_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30021281SMESG000079651.1 dd_Smed_v4_1838_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021281SMESG000079651.1 dd_Smed_v4_1838_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A210QF19 (Vacuolar protein 8 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT22612 PE=4 SV=1)

HSP 1 Score: 219.164 bits (557), Expect = 3.089e-58
Identity = 153/585 (26.15%), Postives = 299/585 (51.11%), Query Frame = 3
Query:  168 FEEPQIIEYLNEVIKILEDNKNEIDINIAGDLLNRIICAYFNWDNHVDKICQLFIEKNLLETLYLYLKHFLLE--FQLDDERLDA--LLKSLMNFSDASVEFAHKIYCSEILKFLIDQCIEKKVITDETKE----FVRCCVIVISNVARDLGNQIDYKANELKESLIEFIKIGNE-DKLAVQSMLMLSYIIKDSEVNLLVEGSNTVNGILMLIKKTASFNKRK-GNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIENSIKLYENHVNPVIKKYHDGIMWEIRGXXXXXXXXXXXXXXXFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSI------------NEKIKNWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNL 1856
             +E +++    E++K+L    +  +  +   L+  +   Y+ +  H  KI     E    E     LK    +  F+ D     A   L +L NF+DAS+  A  +  S+ ++F    C  +  +T+   +     V+  + +I N+AR+      +K N+  + +++F++   E + L + +ML LS+I+++ E + L++ + ++ G +  I K     +R+   ++  ELM GL +++ N+  K+KI + G +P+ + +L +    E  +T   I+ L F++E+ QK+++  ++  S++      +  ++K  +G ++ ++G+N++ ++    KK++  VF+SY+   K  V++I   LK   + +WID E+M GS L AMA  +EN+   ++ +S  Y++SPNCR EAEY +Q +K  IP+++  +++P+GWLG I G K+Y++ S +   E+    L   L+ G+G       S     PG    +  +   S             +      +T +  +WL   KL      L   DGKLL  +  ++ ++P+++  +L+K+  M  +E+L F  AL+ L
Sbjct:  131 LKESEVLVRTKEIVKVLA-GLDTYENGLGMKLVKSLGDTYWGYRPHRKKIGDSMAEAGFGEVAMKMLKSLNAKGIFKTDSIWFPAYYTLNTLWNFTDASLRLAKTVAESDGVRFFTVNCSHEPFLTNLDNKNVYYIVKSSMSIIHNIARNPDVIHFFKENKTTDVMLKFVRSYEEHEMLKIMAMLTLSHIVEEEENDKLMDDTGSIEGTIKYIDKAIEDERRRYRGFTPQELMDGLGKLAVNDNNKKKIVEAGALPVFMKMLKSDSAEEQTVTARAIWTLSFDKEVSQKIVEHPDMMTSLEKLRESSDSDVRKNVNGALFVLKGENDVSRRPRSGKKNKGHVFISYSWNEKEIVLKIRERLKAEGVEVWIDIERMGGSTLTAMAEAVENAAVVLLCMSEKYKQSPNCRLEAEYTFQLRKDYIPLMMQKKYRPDGWLGAILGAKLYFDFSGKYPFEKPWNGLQKELR-GIGR-----LSTPSATPGKDVTDGPIMATSACTAASSPGSLSTSSHAHKMTTEDVGNWLCQVKLDGCVPSLAQFDGKLLVQLQRMKVEAPEFYYASLEKKLNMNLVEILTFTEALDKL 708          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: W4XMC6 (TIR domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 1.539e-52
Identity = 125/453 (27.59%), Postives = 246/453 (54.30%), Query Frame = 3
Query:  570 VISNVARDLGNQIDYKANELKESLIEFIKIGNEDKLAVQSMLMLSYIIKDSEVNLLVE-GSNTVNGILMLIKKTA-SFNKRKGNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIENSIKLYENHVNPVIKKYHDGIMWEI----------RGXXXXXXXXXXXXXXXFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSINEKIK-----------NWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGM-KFMEVLKFHNALNNL 1856
            ++ N+A+  GN+  Y+  ++ ES+  F++   +  L   SM+ L+YI+++ +  +L E G+NT+  ++ ++K    S +KR    S+ E+   L R++ ++  K KI + GG+P++I +LH +     E +   ++NL F+ ++ +KL    +   +++      +  + K  +G +W I          +   +         + +  + +SY    +  V+++ + L K    IW+D + M GS L+AMA  IEN+   ++ +S  Y++SPNCR+EAEYA+Q +K IIP+++   ++P+GWLG I G K Y + S R ++EE M  L+  ++    +     K +        TD+  +   SI+  ++           +WS ++   WL +++L HL+  + + +GKLL  +  +R ++PD+F  ++K++FG+ K +++L+F  AL++L
Sbjct:   41 ILHNLAKAPGNKHVYREEKVVESMEPFLE--GDPYLKAVSMMTLAYIVEEGQEEILAEKGTNTIEYLVEILKDAQNSKDKRCQGLSVEEVTAALGRLAVHDNNKYKIVEAGGLPLMISMLHDESVETQEASAHAVWNLAFSDDVSEKLRSNTDCMMALQDLSTSSSSEVAKAANGALWVINKEGEKKDLVKENEDDTGLGHSLSRKQPHIMLSYQWGCQPLVLKMRDVLAKAGYNIWVDVDCMYGSTLQAMAEAIENACAIVMCMSERYKESPNCRTEAEYAFQLRKRIIPVMMEEYYQPDGWLGIILGAKFYMDFSGRLDIEEEMNKLLKEVQMHSAEAKIIYKDD--------TDDGVLVGASISFPLESAGISIKMESLDWSASQVQDWLIENELEHLRPLMAEYNGKLLNQLYKMRQEAPDFFYLSIKEDFGLKKLIDILRFTEALDSL 483          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: W4XJB9 (TIR domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 4.197e-50
Identity = 148/581 (25.47%), Postives = 296/581 (50.95%), Query Frame = 3
Query:  174 EPQIIEYLNEVIKILEDNKNEIDINIAGDLLNRIICAYFNWDNHVDKICQLFIEKNLLETLYLYLKHF----LLEFQLDDERLDALLKSLMNFSDASVEFAHKIYCSEILKFLIDQCIE--KKVITDETKEFVRCCVIVISNVARDLGNQIDYKANELKESLIEFIKIGNEDKLAVQSMLMLSYIIKDSEVNLLVEG-SNTVNGILMLIKKTA-SFNKRKGNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLIDEFE----IENSIKLYENHVNPVIKKYHDGIMWEI-RGXXXXXXXXXXXXXXXFD------VFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSINEKIKNWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGM-KFMEVLKFHNALNNL 1856
            E   I+ + +++ +L+        + A  L  ++  AY+   + + K CQ F + +  E L   L  F    L + +   E    +   L N S+AS+  + ++    ++K      ++   K+   +    +R  + ++ N++   GN+  ++   + E +  ++K   +  L    M+ L+YII++ + + L+E  ++T+  ++ +++    S NKR       E+ L L R++ ++  K KI + GG+P+++ +L  K  +  E    TI+NL F+++ +QK+ +  +    +E+  +  E+HV    K    G +W I +G+ +  +KE +++  + +      + +SY   ++  V+ I + LK    ++W+D + M GS L+AMA  +E S   ++ IS  Y++SPNCR+EAEY ++  K IIP+++   ++P+GWLG I G K+Y + S + +  E M+ L+  ++T   D G+  K    KE    T  +   N     ++ +WS  +   WL +S L   +  L + DG  L+ +  +R ++P++F  +++ + G+ K  E+ KF  AL  +
Sbjct:    2 ESNQIDKMRDILDVLKKTDTSWASSEAALLCEQMDAAYWKSPDKI-KFCQEFCDYDGAELLVSALIKFEEDGLFKVKGAWETAFVIYNHLCNLSEASLVLSIQMGEKGMVKLCSSNIVKYRGKMSIRDILSLIRVSLGILCNMSTTPGNRHLFREEGVAEKMQPYLK--GDPFLKTICMITLAYIIEEGQEDSLIEKETDTIEYLVGILRDAVKSPNKRFQGLCDREIALALGRLAVHDSSKCKILKAGGLPLLVKMLEDKSADTQEAAANTIWNLAFSEDGRQKIAENKDCLKLLESLTQCSESHVADAAK----GALWVITQGQAKQVEKEVEAEGMQGEEKSYSHIMISYQWGSQPVVLTIRDALKAAGYQVWLDVDHMHGSTLQAMAEAVEKSYVVLMCISEGYKESPNCRTEAEYTFKLGKCIIPVMMEEYYQPDGWLGIILGSKLYMDFSGKLDQTEEMKKLLREVQTNHADAGDTVKRAEVKEVKLLTQLSTQPNTP--SQVLSWSNEQVQDWLKNSGLDKWRPSLQEYDGTFLFNLHKLRLEAPEFFYSSIQDDQGLQKLREIFKFTAALETV 573          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A2B4RLI9 (U-box domain-containing protein 4 OS=Stylophora pistillata OX=50429 GN=PUB4 PE=4 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 1.564e-49
Identity = 144/510 (28.24%), Postives = 272/510 (53.33%), Query Frame = 3
Query:  417 LLKSLMNFSDASVEFAHKIYCSEI--------------------LKFLIDQCIEKKVITDETKEFVRCCVIVISNVARDLGNQIDYKANELKESLIEFIKIGNEDKLAVQSMLMLSYIIKDSEVNLLVEGSNTVNGILMLIKKTASFN-KRKGNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDILH-AKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIENSIKLYENHVNPVIKKYHDGIMWEIRGXXXXX--XXXXXXXXXXFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSINEKIKNWSTAETASWLDDSKLGHLKKRLND-----LDGKLLYVMLDIRSKSPDYFNKTLKKEFGM-KFMEVLKFHNALNNL 1856
             L +L+N+SD   EF   + C+E+                    +K++  +    K  T   K   R   I + N+++ +  + ++ + +   SL+  +        + +S+L+L+Y+I +   +L++  +  +N ++ L++K    +  R   +S  E+  GL +I+ N+  K+ I + G IPI++++L  AK + E      T++ L F++E K+ + ++      ++      N  +KK   G +WEI GK +    K++S  K     V +SY    +  V++I N+L+    ++W+D ++M GS LE+MAR +EN+   ++ +S  Y++SPNCRSEAEY YQ  K IIP+++  +++P+GWLGFI G K + + SE+  ++  ++ LV  L       G +GK E  +E         V + S    I++W++++  +WL D  +G LK RL+      L+G++L  + D+R +SP++F  +++ +F +    +VL+F +AL+ L
Sbjct:  238 FLGTLLNYSDLHDEFC--LECNEVGMVQLFVEMSKKLQDSIPHNVKYVEPKTQRLKKFTVRGKMLSRSLGI-LHNLSKRVPTRTNFASAQAVNSLLLPLLKAEITFYSAKSLLVLAYLIDEQNNHLIMADAEPINFLIRLLRKAIGTDYHRYLGFSAREIAEGLTQIAVNDNNKKTIVKCGAIPILVNMLQNAKDDEERVNACNTLWTLAFDEENKKNIKEDEHACAELRKLLTSNNREVKKAAAGALWEIEGKEKHAEDKQQSVKKSDAKHVMISYQWDVQKLVIQIKNKLQSDGFKVWMDIDEMGGSTLESMARAVENASVVLVCVSQKYKESPNCRSEAEYTYQLHKDIIPLMMDGKYRPDGWLGFIVGSKFWIDFSEKHKLDSNVDKLVKEL-------GTRGKIE-LQENAMKATVMDVVDASPQSTIRSWTSSDVKAWLMD--VG-LKDRLDSNTLKRLNGQILLRLQDLRKESPEFFYSSVRTDFKLGTVFDVLEFVDALDKL 733          
BLAST of TIR domain-containing protein vs. TrEMBL
Match: A0A0L8HV44 (TIR domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22006151mg PE=4 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 7.029e-48
Identity = 128/504 (25.40%), Postives = 261/504 (51.79%), Query Frame = 3
Query:  426 SLMNFSDASVEFAHKIYCSEILKFLIDQCIEKKVI----TDETKEFVRCCVIVISNVARDLGNQIDYKANELKESLIEFIKIGNEDKLAVQSMLMLSYIIKDSEVNLLVEGSNTVNGILMLIKKTASFNKRKGNYSIP-ELMLGLFRISANNEIKEKINQNGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLI-DEFEIENSIKLYENHVNPVIKKYHDGIMWEIRGXXXXXX--XXXXXXXXXFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKT----GMGDNGEQGKSEHFKEPGPHTDENAVANKSINEKIK---------------NWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNL 1856
            ++ NFSDAS + A  +  S+ ++ L   C  K  +    +      ++  + ++ N+AR+   +  +K  +  E +  FI   +E    V SM+ ++YI+++ +   L+E + ++  +L  + K    NKR+     P E++ GL +++  +  K KI   G + ++  +L      E       ++ L F++ ++++LI DE  +   ++  +++ + ++     G++W + G  ++ +  KE+   +++  VF+SY+  +K  V  I + LK+   ++WID + M  S L+AMA GIEN+   +I +S  Y++SP+CR+EAEY ++ +K  IPM++  ++ P+GWLG + G K++++ S +   E+    L+  L+       GD    G  +   + G  T+ +    +S ++KI                  +  E ASWL   KL    +  +  DGK+L+ + +++ ++P+YF + ++K+  M  ++ L+F  AL ++
Sbjct:  122 TMWNFSDASAQLALSLAESDAVRLLTCNCGHKPYLNAIHSKNVHYIIKASLSILHNIARNPSIKHYFKEQKTSEVIQTFISSKDE-MFKVLSMMTMAYIVEEEDNQTLIEETGSILCMLQWLDKALDCNKRRYKGFTPYEIVQGLEKLAVTDSNKLKIVDGGILSMLSRMLQFDDVREQCSAARILWTLMFDENVRERLINDEQALVTLLESLKDNKDKLVSANVKGVLWLLNGATQVTEVDKETVRARAKTHVFISYSVVDKESVWRIRDRLKEEGYQLWIDVDCMGPSNLQAMASGIENAAVVLICMSEKYKQSPSCRTEAEYTFRLRKDYIPMMMQKKYNPDGWLGTMLGAKLFFDFSGKYPFEKSFGGLIKELRGRGQYSPGDAQVDGAEDQTNKAGTSTENSGNEQQSPSKKISIDHLVNDIGALSPIVEMTNDEIASWLHYHKLAEYSEAFSQFDGKMLFQLSEMKKEAPEYFYQCMEKKMNMSLVDTLRFTAALASI 624          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO45030 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU69])

HSP 1 Score: 186.422 bits (472), Expect = 6.456e-50
Identity = 120/401 (29.93%), Postives = 229/401 (57.11%), Query Frame = 3
Query:  672 KLAVQSMLMLSYIIKDSEVNLLVEGSNTVNGILMLIKKTASFNK-RKGNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDIL-HAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIENSIKLYENHVNPVIKKYHDGIMWEIRGXXXXXXXXXXXXXXXFD-VFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSINEKIKNWSTAETASWLD--DSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFM-EVLKFHNALNNL 1856
            + A +++L+L+Y+  +S  +L++     +  ++ ++ K+ S N  R   ++  EL  GL +I+ N+  K+ I Q+G IPI++D+L +AK + +       ++ L F+ E K+ ++        +K  ++  +  +KK   G++WEI GK     KES + +   + V +SY    +  ++++ ++L+    R+W+D EQM GS L+AMA  +EN+   ++ +S  Y++SPNCRSEAEYA+Q +K I+P+++   ++P+GWLG I G K++ + S+++ +   ++D    L+  +G  G +G+  +  E      ++ V +      I  WS  +  +W++    +LG+     + L GKLL  +  +RS+SP++F  ++K++FG   + EVL F + LN L
Sbjct:  432 QFAAKALLILAYLTDESNNSLIMASEEPIQFLIHILSKSCSSNSNRYLGFTNSELAEGLSQIAVNDSNKKLIGQHGAIPILVDMLANAKNDEQRRCGAEALWVLAFDNENKEAILTTPNAVELLKELQHSEDDSVKKAAAGVLWEIEGKESHTVKESTADEPLRNHVMISYQWDVQPTMIQVKSKLQAAGYRVWMDLEQMGGSTLQAMANAVENAEVVLMCVSQKYKESPNCRSEAEYAFQLRKDIVPLMMEKSYRPDGWLGMIMGAKLWIDFSDKQTLR--VDDSFEKLQKEIGMRG-RGRG-NVVESKLVAVQHDVVDVFPKIDISKWSKDDVMNWMNGFGLRLGNDSTIASHLSGKLLQRLAKLRSESPEFFYSSVKQDFGFAHLQEVLLFVDELNKL 828          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO41008 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5P1])

HSP 1 Score: 178.718 bits (452), Expect = 5.992e-47
Identity = 117/419 (27.92%), Postives = 217/419 (51.79%), Query Frame = 3
Query:  639 LIEFIKIGNEDKLAVQSMLMLSYIIKDSEVNLLVEGSNTVNGILMLIKKTASFNKRKG-NYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDIL-HAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIENSIKLYENHVNPVIKKYHDGIMWEIRGXXXXXXXXXXXXXXXFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISER--RNVEEVMEDLVHTLKTGMG--------DNGEQGKSEHFKEPGPHTDENAVANKSINEKIKNWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMK-FMEVLKFHNALNNL 1856
            L+ F+K G      + ++L L+Y++ +   +L++     +  +L ++    S ++R+   ++  E+  G+ R+++N++ K  I ++ G+ I+  ++  AK + E    L  +Y L F+ E K+ L  +    N ++  +   +  ++K   GI+WEI GK    + E   +     + +SY   N+  ++ +   LK+   ++W+D EQM GS LEAMAR +EN+   +I +S  Y+ SPNCRSEAEYA+QR+K I+P+++   ++P+GWLG I G K++ +  E     +  +M++L +     +         D      S   KE GP    + V    +++    W   + A WL D  L    K    LDG +L ++  ++ +SP+++  ++KK+      +EVL+F   L  L
Sbjct:  843 LLLFMKCG-VTYFVMNALLCLAYLVDERNNDLIMADEEPITFLLRMLSSAISDSRRQHLGFAAWEIACGIGRVASNDKNKRLIGRHDGVSILSTLVKEAKNDAERVYGLQALYMLSFDGENKKILCKDKATVNLLRNLKQSGHKEVQKAAVGILWEIEGKVGRDRNEDSQQH----IMISYQWDNQKAMLAVNKRLKEAGHKVWMDVEQMGGSTLEAMARAVENASVILIAMSQRYQDSPNCRSEAEYAFQRRKKIVPLMMEQDYRPDGWLGMILGAKLWMDFRESVDTGIVHLMKELQYNQTAALQQPHDPVTVDTTTVISSPPDKEDGPPGPTDVVDRPDVSK----WKKEDVAKWLSDIGLSSSNKVRKKLDGSMLILLYRLKQESPEFYYASVKKDMDFPTVIEVLQFTEELRKL 1252          

HSP 2 Score: 113.62 bits (283), Expect = 5.350e-26
Identity = 52/136 (38.24%), Postives = 84/136 (61.76%), Query Frame = 3
Query: 1161 VFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGK 1568
            V +SY    +  V+++ +EL+    ++WID EQM GS LEAMA  +EN+   ++ +S  Y++SPNCRSEAEY++Q +K IIP+++  ++KP+GWLG I G K++ +   +      ++ L+  L    G  G   K
Sbjct:  555 VMLSYQWGYQDVVLKVRDELRAAGYKVWIDVEQMEGSTLEAMASAVENAAAVLMCVSRAYKESPNCRSEAEYSFQLRKDIIPLMMEPQYKPDGWLGIIVGAKLWMDFRSKDATSSAVQGLIKEL----GQRGRPAK 686          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO33720 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRG5])

HSP 1 Score: 78.5666 bits (192), Expect = 4.026e-18
Identity = 36/75 (48.00%), Postives = 51/75 (68.00%), Query Frame = 3
Query: 1260 MTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEIS 1484
            M GS LEAMA  +ENS   ++  S  Y+ S N RSEAEYAY ++K I+P+++   +KP+GWLG I G K+Y+  +
Sbjct:    1 MGGSTLEAMANAVENSAVVLMCASRKYKDSVNYRSEAEYAYTQKKPIVPLMMENGYKPDGWLGMIMGSKLYFNFA 75          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO39316 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAI7])

HSP 1 Score: 67.0106 bits (162), Expect = 4.788e-12
Identity = 35/138 (25.36%), Postives = 70/138 (50.72%), Query Frame = 3
Query: 1161 VFVSYAHQNKSKVMEIFNELKKWNIRIWID-KEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKT----IIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGE 1559
            V +SY    +  V ++++ L+ + IR+W+D    + G +  +MA+G++ +      +S  Y +S NC+ E  YA  +       I+P++    FK +GWLG I    ++ +  +  N E  ++ L   +   +GD+ +
Sbjct:    4 VMLSYQWDIQDLVKKVYDGLRAYGIRVWMDIHGGIRGDINGSMAKGVDGAAILCCFMSTKYSESKNCKKELSYADGKTGCEEVIIVPVMCEKGFKAKGWLGIITAGLLWIDFRDEANFENSVKSLAQEIMHAVGDSSD 141          
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Match: EDO33105 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST59])

HSP 1 Score: 54.6842 bits (130), Expect = 9.336e-8
Identity = 30/84 (35.71%), Postives = 49/84 (58.33%), Query Frame = 3
Query: 1155 FDVFVSYAHQNKSKVMEIFNELKKWNIRIWID-KEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTII 1403
            FD+ +SY    +S V E++ EL +   + W+D    M G++ EAMA  +ENS   +  ++  Y++S NC  E +YA  ++K II
Sbjct:  411 FDIMLSYNWGIQSFVREVYMELSQQTFQTWMDIWGGMQGNINEAMATAVENSTMLVAFLTEKYQQSVNCNLELKYATMKEKPII 494          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000079659.1 (SMESG000079659.1)

HSP 1 Score: 1131.32 bits (2925), Expect = 0.000e+0
Identity = 572/578 (98.96%), Postives = 573/578 (99.13%), Query Frame = 3
Query:  132 MEKLPDESDCAEFEEPQIIEYLNEVIKILEDNKNEIDINIAGDLLNRIICAYFNWDNHVDKICQLFIEKNLLETLYLYLKHFLLEFQLDDERLDALLKSLMNFSDASVEFAHKIYCSEILKFLIDQCIEKKVITDETKEFVRCCVIVISNVARDLGNQIDYKANELKESLIEFIKIGNEDKLAVQSMLMLSYIIKDSEVNLLVEGSNTVNGILMLIKKTASFNKRKGNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIENSIKLYENHVNPVIKKYHDGIMWEIRGXXXXXXXXXXXXXXXFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSINEKIKNWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNLAYI 1865
            MEKLPDESDCAEFEEPQIIEYLNEVIKILEDNKNEIDINIAGDLLNRIICAYFNWDNHVDKICQLFIEKNLLETLYLYLKHFLLEFQLDDERLDALLKSLMNFSDASVEFAHKIYCSEILKFLIDQCIEKKVITDETKEFVRCCVIVISNVARDLGNQIDYKANELKESLIEFIKIGNEDKLAVQSMLMLSYIIKDSEVNLLVEGSNTVN ILMLIKKTASFNKRKGNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIE SIKLYENHVNPVIKKYHDGIMWEIRGKNEIKKK SDSKKSEFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKE GPHTDENAVANKSINEKIKNWSTAETASWLDDSKLG+LKKRLNDLDGKLLYVM DIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNLAYI
Sbjct:    1 MEKLPDESDCAEFEEPQIIEYLNEVIKILEDNKNEIDINIAGDLLNRIICAYFNWDNHVDKICQLFIEKNLLETLYLYLKHFLLEFQLDDERLDALLKSLMNFSDASVEFAHKIYCSEILKFLIDQCIEKKVITDETKEFVRCCVIVISNVARDLGNQIDYKANELKESLIEFIKIGNEDKLAVQSMLMLSYIIKDSEVNLLVEGSNTVNSILMLIKKTASFNKRKGNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIEKSIKLYENHVNPVIKKYHDGIMWEIRGKNEIKKKGSDSKKSEFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEAGPHTDENAVANKSINEKIKNWSTAETASWLDDSKLGYLKKRLNDLDGKLLYVMFDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNLAYI 578          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000079651.1 (SMESG000079651.1)

HSP 1 Score: 936.791 bits (2420), Expect = 0.000e+0
Identity = 481/582 (82.65%), Postives = 522/582 (89.69%), Query Frame = 3
Query:  132 MEKLPDESDCAEFEEPQIIEYLNEVIKILEDNKNEIDINIAGDLLNRIICAYFNWDNHVDKICQLFIEKNLLETLYLYLKHFLLEFQLDDERLDALLKSLMNFSDASVEFAHKIYCSEILKFLIDQCIEKKVITD----ETKEFVRCCVIVISNVARDLGNQIDYKANELKESLIEFIKIGNEDKLAVQSMLMLSYIIKDSEVNLLVEGSNTVNGILMLIKKTASFNKRKGNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIENSIKLYENHVNPVIKKYHDGIMWEIRGXXXXXXXXXXXXXXXFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSINEKIKNWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNLAYI 1865
            M  LP+ S C +F E +II+YL  VI IL++N+  +D+    D+L RI  +YF+W+NH++KICQLFIEK+LL+T+Y+YL +F  +  + D+ ++ L   L NFSDASVEFA  +  S++L F+IDQC +K+ I D      KE +  CV+VISNVARDLGNQI+YK  ELKESLIEFIK+GNEDKLA+QSML LSYII DSEVNLLVEGSNTVNGILMLIK+T S   R+GNYSIPELMLGLFRISANNEIKEKI +NGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIE SIKLYENHVNP IKKYHDGIMWEIRGKNEIKKK SDSKKSEFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEV+EDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSINEKIKNWSTAETASWLDDSKLG+LKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNLAYI
Sbjct:    1 MNNLPERSICLKFSEAEIIDYLTTVITILDNNRENVDV--INDMLIRICNSYFDWENHINKICQLFIEKHLLDTVYIYLDYFHRKLNIKDKLVNYLYTLLTNFSDASVEFAQNLNSSKVLPFIIDQCTKKEFINDIHDENIKEHLENCVLVISNVARDLGNQIEYKEKELKESLIEFIKLGNEDKLAIQSMLTLSYIINDSEVNLLVEGSNTVNGILMLIKETCSIEGREGNYSIPELMLGLFRISANNEIKEKIYKNGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIEKSIKLYENHVNPEIKKYHDGIMWEIRGKNEIKKKGSDSKKSEFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVIEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSINEKIKNWSTAETASWLDDSKLGYLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNLAYI 580          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000035587.1 (SMESG000035587.1)

HSP 1 Score: 338.961 bits (868), Expect = 8.160e-108
Identity = 210/583 (36.02%), Postives = 337/583 (57.80%), Query Frame = 3
Query:  129 KMEKLPDESDCAEFEEPQIIEYLNEVIKILEDNKNEIDINIAGDLLNRIICAYFNWDNH-VDKICQLFIEKNLLETLYLYLKHFLLEFQLDDERLDALLKSLMNFSDASVEFAHKIYCSEILKFLIDQCIEKKVIT----DETKEFVRCCVIVISNVARDLGNQIDYKANELKESLIEFIKIGNEDKLAVQSMLMLSYIIKDSEVNLLVEGSNTVNGILMLIKKTASFNKRKGNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDILHAKV-ENEIELTLGTIYNLCFNQEIKQKLIDEFEIENSIKLYENHVNPVIKKYHDGIMWEIRGXXXXXXX-XXXXXXXXFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSINEKIKNWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNL 1856
            K++ LPDE+ C        I+YL++VI  LE  K   + NI  +L+ RI  A++++ N  +DK+C  F ++NL+  ++ +L++        +  +  +   L NFS+   EFA  +  S  + ++ID+ ++          E K F +  + +I N A    ++I+Y+ +E+K++ +  + +  +D   + S++ LSY+I ++E+NL     N V  ++  IK       R   ++I EL+ GL R+SAN+EIK  I+   GI ++IDIL++   EN IE TL  I  LCFN +IK KLI+ ++I  ++  + NH N  I ++++GI+W +  K E   K  ++     FD F+SY+  NK KV+EI + LK +N+ +WID+E+M  S LEAMA GIENS+  +I  S  Y+ S NCR EAEYA + +K IIP+++  ++KP  WLG + G K+Y E S+RRN  E ++ L+  +K  +    +  +       G     N+     + +++KNWS      WLD   +G+LK++   +DG ++ VMLDIR  S DYFN  LK EF M F+EV+KFH ALN+L
Sbjct:    9 KLKILPDETMCKILNLENAIKYLSDVIDFLEKIKIADEYNIY-NLILRISNAFYDYYNKFIDKVCYEFKKRNLVNLIHFFLQNQNKISSQKENTIYLMYIILANFSEHDYEFAGMLESSNTINYIIDKYLQFDSSNIKNCKENKNF-KSLITIIHNFASHKLDKINYRVDEIKKTFLNIVNLNCDDYYGLISLVTLSYLIDENEINLFDGHENIVKELIKKIKLINENKLRSEGFTIKELIHGLRRLSANDEIKTIIDTENGIQVLIDILNSTNNENVIEPTLDVIKQLCFNNDIKIKLINHYKIGETLTKFSNHSNAKICQHYNGILWILDNKLESLPKGNTEKTAIVFDAFMSYSWANKDKVLEICSILKSYNVNVWIDQEEMISSTLEAMATGIENSKVVVIAASTAYKNSSNCRLEAEYAQKIKKPIIPLVMEHKYKPSNWLGILFGTKVYIEFSDRRNANEQVQQLIKNIKFHLNRPVKLAEKIDL-NAGEKNRSNSRTRIVLVDEVKNWSCENVGDWLDKFGIGYLKEKFIGVDGSMIEVMLDIRINSGDYFNNCLKNEFKMNFIEVVKFHKALNDL 588          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000015387.1 (SMESG000015387.1)

HSP 1 Score: 329.331 bits (843), Expect = 4.025e-104
Identity = 201/599 (33.56%), Postives = 337/599 (56.26%), Query Frame = 3
Query:  126 IKMEKLPDESDCAEFEEPQIIEYLNEVIKILEDNKNEIDINIAGDLLNRIICAYFNWDNHVDKICQLFIEKNLLETLYLYLKHFLLE--FQLDDERLDAL--LKSLMNFSDASVEFAHKIYCSEILKFLIDQCIEKKVITDETKE----FVRCCVIVISNVARDLGNQIDYKANELKESLIEFIKIGNEDKLAVQSMLMLSYIIKDSEVNLLVEGSNTVNGILMLIKKTASFNKRKGN-YSIPELMLGLFRISANNEIKEKINQNGGIPIIIDIL-HAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIENSIKLYENHVNPVIKKYHDGIMWEIRG---------XXXXXXXXXXXXXXXFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSINE--KIKNWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNLA 1859
            + + ++PD      F EPQ ++Y+ + ++ L++ ++ ++ NI   +   I  +YF+  +H++ +  + +    +     Y+  F  E  F  DD        L SL N+ D   E A++I  +++ ++LI   + +  + +         ++  + +I N+ R  GN+  ++  ELK  L+  IK  + D + + SML LS ++ +SE++LL EG N++  ++M I+     + +K N ++I EL+ GL  +SAN+ +K+ I    GI +I DIL +   +N+IE  LG ++NLCF+++IK  L+++F+++  I  ++NH    IK+ ++GI+W I              + K ++     +FDVF+SY   NK  V+ I + L + NI+IWID +QM GS LEAMA GIENS  FI+ IS  Y  SPNCR+EAEYA+   K IIP+I+  ++KP  WLG I G KMYYE S+RRN EE +  L+  + T +  N E+        P    +    ++    +   + +WS      WL  + LGH+K R  + DGKLL+ ++D+++KS  Y    LK E+GMKF+++LK H+A+N + 
Sbjct:    1 MSLHEVPDYE--KSFTEPQAVDYMKKALEKLKELQDSLNFNIIYKIFKGISQSYFDLKSHLNALSNVLLNLKYVSITSNYVGKFSKEGYFVNDDVWFATYYALNSLWNYCDGFQEIANEIVVTDLPQYLIANLLHRPYLDNMKNTNIFYLIKASISIIHNIVRCPGNEEKFQIIELKNVLVGLIKRNDSDFIVLISMLTLSCLVNESELHLLDEGKNSIKALIMKIRTAFENDSKKVNGFAIWELVNGLKCVSANDNVKKTIVTENGIKLIFDILKNPTCDNDIEKCLGVLWNLCFDKDIKAILVNDFDLKLFINRFKNHKLSTIKRCYNGILWLIDEKIQSKERILSAHLSKVKASKTHWKFDVFISYCWANKQMVLSIRDFLVQSNIKIWIDLDQMKGSTLEAMADGIENSNIFIMAISEAYRTSPNCRTEAEYAFSLNKPIIPLIVEMKYKPTSWLGIIMGSKMYYEFSKRRNFEESIHSLLANVNT-IIQNVERKIVTEIIVPVAQNESYQSSDGGTPKILSVHSWSNKIVEKWLVKNGLGHVKSRFMNFDGKLLFSLIDVKNKSRKYLIDALKVEYGMKFIDLLKLHSAINEIC 596          
BLAST of TIR domain-containing protein vs. Planmine SMEST
Match: SMESG000035607.1 (SMESG000035607.1)

HSP 1 Score: 327.405 bits (838), Expect = 6.694e-104
Identity = 210/559 (37.57%), Postives = 323/559 (57.78%), Query Frame = 3
Query:  270 RIICAYFNWDNH-VDKICQLFIEKNLLETLYLYLKHFLLEFQLDDERLDALLKSLMNFSDASVEFAHKIYCSEILKFLIDQCIEKKVITDE---TKEFVRCCVIVISNVARDLGNQIDYKANELKESLIEFIKIGNEDKLAVQSMLMLSYIIKDSEVNLLVEGSNTVNGILMLIKKTASFNKRKGNYSIPELMLGLFRISANNEIKEKINQNGGIPIIIDIL--HAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIENSIKLYENHVNPVIKKYHDGIMWEIRGXXXXXXXXXXXXXXXFDVFVSYAHQNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGISPYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEISERRNVEEVMEDLVHTLKTGMG--DNGEQGKSEHFKEPGPHTD--------ENAVANKSINE-------------KIKNWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYFNKTLKKEFGMKFMEVLKFHNALNNLA 1859
            R+  +YF++ N  +DK+C+ +I K ++  LY      LL+   ++  +D +L  L+NFS+ S   A +I  SEILK++ID+     +   E   +    +  V +I N  R   N+ +YK +++K+S  + I++ ++D   + SML+LSY+I   EV++L++G N ++ +L  IK T++  KR   +++ ELM GL  I+AN+ +K++I  + GI I+I+++  H   ++ IE TLG I +LCF+ EIK KLI+  +I+N IK Y    +  IK+ +DGI+WE+    +    ++ S   +FDVF+SY   NK ++ EI   LK   IR WIDKEQM+GS +EAMA+GIENS  FIIG+S  Y+KS NCR EAEYA++ +K IIP+I+  ++KP  WLGF+ G K+Y+E S+RRN  E ++ L+  +   +   DN  Q KS   K      D        +N   NK I++             KIK W+  +   WLD  ++   K    DL G  L  M +I  K P      LKK F M  +E++KF  AL NL+
Sbjct:    2 RLSNSYFDYYNKFIDKVCEHYISKCIITNLY----RLLLKLT-NESTIDYILTFLVNFSEHSEIMACEIGSSEILKYVIDKYFGMNLSDPEECKSSRIFKLYVTIIHNFFRYPHNRSEYKIDDIKQSFFKMIQLDSDDYFGIISMLILSYVIDGKEVDMLIKGQNILHNLLQKIKFTSTSTKRIEGFNLQELMHGLRFIAANDTMKKRI-YDEGIEILINVIKFHKDDKDVIESTLGVIEHLCFDNEIKLKLINSCKIKNLIKPYAKCKSVKIKEIYDGILWEL--DKKSVDLKTKSDNMKFDVFISYCWANKEQIEEILESLKIHKIRAWIDKEQMSGSSIEAMAKGIENSAVFIIGVSSSYKKSCNCRHEAEYAFRIKKPIIPLIMEMKYKPTEWLGFLLGNKIYFEFSDRRNPNEEVKGLIVEINRNLHPIDNEVQSKSNSVKNTQKSHDLPNSNSETKNEDCNKVISKSNFPVPSDSDTLGKIKMWTNEDVLKWLDKIQMSGFKTHFKDLSGSHLLTMQEICLKDPSLIRDDLKKTFNMNIIEIVKFETALKNLS 552          
The following BLAST results are available for this feature:
BLAST of TIR domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210QF193.089e-5826.15Vacuolar protein 8 OS=Mizuhopecten yessoensis OX=6... [more]
W4XMC61.539e-5227.59TIR domain-containing protein OS=Strongylocentrotu... [more]
W4XJB94.197e-5025.47TIR domain-containing protein OS=Strongylocentrotu... [more]
A0A2B4RLI91.564e-4928.24U-box domain-containing protein 4 OS=Stylophora pi... [more]
A0A0L8HV447.029e-4825.40TIR domain-containing protein OS=Octopus bimaculoi... [more]
back to top
BLAST of TIR domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO450306.456e-5029.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410085.992e-4727.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337204.026e-1848.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO393164.788e-1225.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331059.336e-835.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TIR domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TIR domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079659.10.000e+098.96SMESG000079659.1[more]
SMESG000079651.10.000e+082.65SMESG000079651.1[more]
SMESG000035587.18.160e-10836.02SMESG000035587.1[more]
SMESG000015387.14.025e-10433.56SMESG000015387.1[more]
SMESG000035607.16.694e-10437.57SMESG000035607.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021281 ID=SMED30021281|Name=TIR domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1995bp
TTCTTAACTAATTTACAAAACATTAAATTAGTGATAAATCTTTAAATAAT
AAAAAATTATCAAAGTTTGATTTATAAATTATTTCCAATGGCCTTGAAGA
TTTAATTGTTAGAAAAATTTATGCAATAAAAATGGAGAAGCTTCCAGATG
AATCGGATTGTGCTGAGTTTGAGGAACCACAGATTATTGAATATCTCAAT
GAAGTTATAAAAATATTGGAAGACAATAAAAATGAAATTGACATAAATAT
TGCGGGTGACTTGTTGAATAGAATTATATGTGCTTATTTTAATTGGGATA
ATCACGTTGATAAAATTTGTCAACTGTTCATTGAAAAAAATTTATTGGAA
ACACTTTACTTGTATTTAAAACATTTTCTTCTCGAATTCCAACTCGATGA
TGAAAGACTCGATGCTTTGCTAAAGTCTTTGATGAATTTTTCTGACGCTT
CTGTTGAATTCGCTCATAAAATTTATTGTTCCGAAATTCTAAAATTCCTC
ATTGATCAATGTATAGAGAAAAAAGTAATTACTGATGAAACTAAAGAGTT
TGTTCGTTGTTGTGTAATTGTTATCAGTAATGTTGCTAGAGATTTGGGAA
ATCAGATTGATTATAAAGCAAATGAGCTGAAGGAAAGTTTGATTGAGTTT
ATTAAAATTGGAAATGAAGATAAATTAGCTGTTCAATCAATGTTGATGTT
GTCATATATTATAAAGGATAGTGAAGTAAATTTATTAGTCGAGGGTTCAA
ATACCGTAAATGGCATATTAATGTTAATAAAGAAAACAGCCAGTTTTAAT
AAACGAAAAGGAAATTATTCCATTCCAGAATTAATGCTGGGTTTATTCCG
TATTTCCGCTAACAATGAAATAAAAGAAAAAATCAATCAAAATGGCGGAA
TTCCAATTATAATTGATATTCTTCATGCAAAAGTGGAAAATGAAATTGAG
TTGACTTTAGGAACGATTTATAATTTATGCTTCAATCAGGAAATAAAACA
GAAATTAATTGACGAATTTGAAATAGAAAATTCAATTAAATTGTATGAAA
ATCACGTAAACCCAGTGATCAAAAAGTACCACGATGGAATTATGTGGGAA
ATCAGGGGTAAAAATGAAATTAAGAAAAAAGAAAGTGATTCGAAAAAATC
GGAATTTGACGTGTTTGTAAGTTATGCACACCAGAATAAATCGAAAGTCA
TGGAAATATTTAATGAACTGAAAAAGTGGAACATTCGAATTTGGATTGAT
AAAGAACAAATGACCGGATCGGTTCTTGAAGCGATGGCTCGTGGGATAGA
AAATTCTCGCTTCTTCATTATTGGGATATCGCCGTATTACGAGAAGAGTC
CAAATTGTCGCAGTGAAGCGGAATATGCGTATCAACGACAGAAAACGATT
ATTCCGATGATATTGGCATGTCGATTCAAGCCGGAAGGTTGGCTGGGATT
TATTCGGGGAATGAAAATGTATTACGAAATCAGCGAGAGAAGAAATGTCG
AAGAAGTAATGGAAGATTTGGTACATACGTTAAAAACGGGAATGGGAGAC
AATGGAGAGCAGGGTAAATCAGAACATTTCAAAGAGCCTGGACCACACAC
AGATGAAAACGCAGTTGCCAACAAGTCGATAAATGAGAAGATCAAAAATT
GGAGTACTGCTGAAACTGCTTCGTGGTTAGACGATTCGAAACTAGGTCAT
TTGAAGAAGCGATTGAATGATCTTGACGGAAAATTGCTCTATGTGATGCT
TGATATCAGATCGAAGTCGCCGGATTATTTTAATAAAACTCTGAAAAAAG
AATTCGGAATGAAATTTATGGAAGTATTGAAATTTCACAATGCTCTCAAT
AATTTGGCATATATTTGATTACCATTGCTAGTCCTTTAATTTATTGATTT
TTATCACCATAATTTACAATTAATTACTATATTTCATACTGTTTTATTAT
TTTATTTTCATTTTGACATTTTTTATAAAATATAAACATTTTGTC
back to top

protein sequence of SMED30021281-orf-1

>SMED30021281-orf-1 ID=SMED30021281-orf-1|Name=SMED30021281-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=579bp
MEKLPDESDCAEFEEPQIIEYLNEVIKILEDNKNEIDINIAGDLLNRIIC
AYFNWDNHVDKICQLFIEKNLLETLYLYLKHFLLEFQLDDERLDALLKSL
MNFSDASVEFAHKIYCSEILKFLIDQCIEKKVITDETKEFVRCCVIVISN
VARDLGNQIDYKANELKESLIEFIKIGNEDKLAVQSMLMLSYIIKDSEVN
LLVEGSNTVNGILMLIKKTASFNKRKGNYSIPELMLGLFRISANNEIKEK
INQNGGIPIIIDILHAKVENEIELTLGTIYNLCFNQEIKQKLIDEFEIEN
SIKLYENHVNPVIKKYHDGIMWEIRGKNEIKKKESDSKKSEFDVFVSYAH
QNKSKVMEIFNELKKWNIRIWIDKEQMTGSVLEAMARGIENSRFFIIGIS
PYYEKSPNCRSEAEYAYQRQKTIIPMILACRFKPEGWLGFIRGMKMYYEI
SERRNVEEVMEDLVHTLKTGMGDNGEQGKSEHFKEPGPHTDENAVANKSI
NEKIKNWSTAETASWLDDSKLGHLKKRLNDLDGKLLYVMLDIRSKSPDYF
NKTLKKEFGMKFMEVLKFHNALNNLAYI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR035897Toll_tir_struct_dom_sf
IPR011989ARM-like
IPR000157TIR_dom
IPR016024ARM-type_fold
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 6..316
e-value: 6.9E-8
score: 33.5
IPR035897Toll/interleukin-1 receptor homology (TIR) domain superfamilyGENE3DG3DSA:3.40.50.10140coord: 333..469
e-value: 2.0E-20
score: 74.8
IPR035897Toll/interleukin-1 receptor homology (TIR) domain superfamilySUPERFAMILYSSF52200Toll/Interleukin receptor TIR domaincoord: 335..467
IPR000157Toll/interleukin-1 receptor homology (TIR) domainPFAMPF13676TIR_2coord: 344..435
e-value: 7.5E-19
score: 68.5
IPR000157Toll/interleukin-1 receptor homology (TIR) domainPROSITEPS50104TIRcoord: 340..417
score: 8.932
NoneNo IPR availablePANTHERPTHR46270:SF2coord: 82..575
NoneNo IPR availablePANTHERPTHR46270FAMILY NOT NAMEDcoord: 82..575
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 21..314