Leucine Rich repeat-containing domain protein

Overview
NameLeucine Rich repeat-containing domain protein
Smed IDSMED30021280
Length (bp)2323
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Leucine Rich repeat-containing domain protein (SMED30021280) t-SNE clustered cells

Violin plots show distribution of expression levels for Leucine Rich repeat-containing domain protein (SMED30021280) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Leucine Rich repeat-containing domain protein (SMED30021280) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Leucine Rich repeat-containing domain protein (SMED30021280) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021280

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30021280SMESG000006503.1 SmedASXL_010352SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30021280SMESG000006503.1 dd_Smed_v4_18031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021280SMESG000006503.1 dd_Smed_v4_18031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30021280SMESG000006503.1 dd_Smed_v4_18031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30021280SMESG000006503.1 dd_Smed_v6_18031_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30021280SMESG000006503.1 SMED30021280smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30021280SMESG000006503.1 OX_Smed_1.0.21279ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Human
Match: LRIT2 (leucine rich repeat, Ig-like and transmembrane domains 2 [Source:HGNC Symbol;Acc:HGNC:23443])

HSP 1 Score: 97.4413 bits (241), Expect = 2.145e-20
Identity = 87/366 (23.77%), Postives = 160/366 (43.72%), Query Frame = 1
Query:  250 VRKQFSLVCIEND-LITFPKSNFIN-KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWFK--------NGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIKI-PSHKDNAID 1314
            + ++F  V IEN  L   P+ +FIN   +  L L+ NNI +++  AL+    L  L L+ NK+  +   AF+    L+ L L+ N +    +       ++L+ L YLDLSSN + ++ +S FL+    ++    +   EI                                    +    + LHDNPW CDCR+R   +++ ++         T+  IL+N + ++C+ P     +   +  LS    KP+       + ++  +NVTL C  ++ P   + W          +G+L   H   + L+ S+G +   +     + + +D G Y C  +N++G  +SN  + + + P+   +A D
Sbjct:   53 LSEEFKQVRIENSPLFEMPQGSFINMSTLEYLWLNFNNISVIHLGALEHLPELRELRLEGNKLCSVPWTAFRATPLLRVLDLKRNKI----DALPELALQFLVSLTYLDLSSNRLTVVSKSVFLNWPAYQKCRQPDCGAEI------------------------------------LSSLVVALHDNPWVCDCRLRGLVQFVKSI---------TLPVILVNSY-LICQGPLSKAGQLFHETELSACM-KPQISTPSANITIRAGQNVTLRCLAQASPSPSIAWTYPLSMWREFDGLLGGKHLTPV-LTSSTGEDTALSELAIPAAHLVDSGNYTCMASNSIG--KSNLVISLHVQPAQALHAPD 364          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Human
Match: LRIT2 (leucine rich repeat, Ig-like and transmembrane domains 2 [Source:HGNC Symbol;Acc:HGNC:23443])

HSP 1 Score: 94.3597 bits (233), Expect = 2.054e-19
Identity = 85/359 (23.68%), Postives = 155/359 (43.18%), Query Frame = 1
Query:  250 VRKQFSLVCIEND-LITFPKSNFIN-KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQ-LSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIKI-PSHKDNAID 1314
            + ++F  V IEN  L   P+ +FIN   +  L L+ NNI +++  AL+    L  L L+ NK+  +   AF+    L+ L L+ N +    +       ++L+ L YLDLSSN + ++ +S FL+    ++    +   EI                                    +    + LHDNPW CDCR+R   +++ ++         T+  IL+N + ++C+ P     +   +  LS    KP+       + ++  +NVTL C  ++ P   + W          W     L+ S+G +   +     + + +D G Y C  +N++G  +SN  + + + P+   +A D
Sbjct:   53 LSEEFKQVRIENSPLFEMPQGSFINMSTLEYLWLNFNNISVIHLGALEHLPELRELRLEGNKLCSVPWTAFRATPLLRVLDLKRNKI----DALPELALQFLVSLTYLDLSSNRLTVVSKSVFLNWPAYQKCRQPDCGAEI------------------------------------LSSLVVALHDNPWVCDCRLRGLVQFVKSI---------TLPVILVNSY-LICQGPLSKAGQLFHETELSACM-KPQISTPSANITIRAGQNVTLRCLAQASPSPSIAW----TYPLSMWREFDVLTSSTGEDTALSELAIPAAHLVDSGNYTCMASNSIG--KSNLVISLHVQPAQALHAPD 354          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Human
Match: LRRC24 (leucine rich repeat containing 24 [Source:HGNC Symbol;Acc:HGNC:28947])

HSP 1 Score: 83.1889 bits (204), Expect = 5.678e-16
Identity = 81/340 (23.82%), Postives = 136/340 (40.00%), Query Frame = 1
Query:  316 INKDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHL-ENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQ-----------------SSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLII 1281
            I      L L  NNI  L   AL     L  L L +N +  +   AF+ + +L  L+L +N L        S  F  L +L  L L+ N +  + +  FL L  L+EL+L+E   E+   +          L              L+       L+ L L +NPW CDC + W   W   + +    L ++ +  +      +C  P  L  + L D+  S   C P ++ +    +  +L E++ ++CQ   +P+  V W K   + Q    R +                     SG  +++N+T+  +      G Y CE +N  G+AR  + L++
Sbjct:   48 IPPGTQTLFLQDNNIARLEPGALAPLAALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRL----RGLRSGAFVGLAQLRVLYLAGNQLARLLDFTFLHLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISREALQ---PLASLQVLRLTENPWRCDCALHWLGAW---IKEGGQRLLTSRDRKI------MCAEPPRLALQSLLDVSHSSLICIPPSVHVQPLELTANLGEDLRVACQASGYPQPLVTWRK---VPQPREGRPRAQAQLEGGLLGLGGHSASDTGSGMLFLSNITLAHA------GKYECEASNAGGAARVPFRLLV 362          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Human
Match: LRFN5 (leucine rich repeat and fibronectin type III domain containing 5 [Source:HGNC Symbol;Acc:HGNC:20360])

HSP 1 Score: 78.5666 bits (192), Expect = 1.327e-14
Identity = 95/349 (27.22%), Postives = 146/349 (41.83%), Query Frame = 1
Query:  253 RKQFSLVCIENDLITFPKSNFIN-KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLE-----------TLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTL-RLGKTLVVKHLENVTLSCQFESFPKSYVKWFK-NGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSA 1257
            R+   L   +N +    + +F N   +  L LS+N I  +   A  D  NL  L L+SN++ KITN+ F   S L +L L NN L + ++T    VF     LE LDLS N +  IP      + +L  L L+  M +  I KG FS+L  +  L +  N    LP   +  FQ  Q+             L    NP  C+C + W +R    L++ +D     +E          C +P  L  +    +P  +F C+P  + R    + V   +  TL C+    P+  + W    G LI +    +        N   ++ I + K   D G + C  +N  G A
Sbjct:   51 RRTVELRLADNFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFSGLSNLHHLILNNNQLTLISSTAFDDVF----ALEELDLSYNNLETIPWDAVEKMVSLHTLSLDHNMID-NIPKGTFSHLHKMTRLDVTSNKLQKLPP--DPLFQRAQVLATSGIISPSTFALSFGGNPLHCNCELLWLRR----LSREDD-----LET---------CASPPLLTGRYFWSIPEEEFLCEPPLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYD-----NGTLDILITTVK---DTGAFTCIASNPAGEA 366          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Human
Match: LRFN5 (leucine rich repeat and fibronectin type III domain containing 5 [Source:HGNC Symbol;Acc:HGNC:20360])

HSP 1 Score: 78.5666 bits (192), Expect = 1.333e-14
Identity = 95/349 (27.22%), Postives = 146/349 (41.83%), Query Frame = 1
Query:  253 RKQFSLVCIENDLITFPKSNFIN-KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLE-----------TLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTL-RLGKTLVVKHLENVTLSCQFESFPKSYVKWFK-NGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSA 1257
            R+   L   +N +    + +F N   +  L LS+N I  +   A  D  NL  L L+SN++ KITN+ F   S L +L L NN L + ++T    VF     LE LDLS N +  IP      + +L  L L+  M +  I KG FS+L  +  L +  N    LP   +  FQ  Q+             L    NP  C+C + W +R    L++ +D     +E          C +P  L  +    +P  +F C+P  + R    + V   +  TL C+    P+  + W    G LI +    +        N   ++ I + K   D G + C  +N  G A
Sbjct:   51 RRTVELRLADNFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFSGLSNLHHLILNNNQLTLISSTAFDDVF----ALEELDLSYNNLETIPWDAVEKMVSLHTLSLDHNMID-NIPKGTFSHLHKMTRLDVTSNKLQKLPP--DPLFQRAQVLATSGIISPSTFALSFGGNPLHCNCELLWLRR----LSREDD-----LET---------CASPPLLTGRYFWSIPEEEFLCEPPLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYD-----NGTLDILITTVK---DTGAFTCIASNPAGEA 366          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Celegans
Match: lron-2 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:Q23580])

HSP 1 Score: 55.0694 bits (131), Expect = 1.813e-7
Identity = 40/135 (29.63%), Postives = 69/135 (51.11%), Query Frame = 1
Query:  283 NDLITFPKSNFINK--DIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKG 681
            N L + P S  +N+   +  L+L  N+I  +   ALD F  L +L+L+ N I  I   AF+    L++L +  N       ++   +FRY+ +L+ L +   PI +IP + F+ + NL  L + E   +  I++G
Sbjct:  196 NSLTSIPSSALVNQRNTLTNLNLGLNSINEVPVGALD-FPVLSSLSLEFNGITVIPPQAFQGVPNLQFLYMTGNKF----PSWAPEMFRYITQLKTLGIGETPISVIPNNAFMHIPNLIRLEMSEAAVDT-IERG 324          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Celegans
Match: lron-2 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:Q23580])

HSP 1 Score: 55.0694 bits (131), Expect = 1.813e-7
Identity = 40/135 (29.63%), Postives = 69/135 (51.11%), Query Frame = 1
Query:  283 NDLITFPKSNFINK--DIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKG 681
            N L + P S  +N+   +  L+L  N+I  +   ALD F  L +L+L+ N I  I   AF+    L++L +  N       ++   +FRY+ +L+ L +   PI +IP + F+ + NL  L + E   +  I++G
Sbjct:  196 NSLTSIPSSALVNQRNTLTNLNLGLNSINEVPVGALD-FPVLSSLSLEFNGITVIPPQAFQGVPNLQFLYMTGNKF----PSWAPEMFRYITQLKTLGIGETPISVIPNNAFMHIPNLIRLEMSEAAVDT-IERG 324          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Fly
Match: kek1 (gene:FBgn0015399 transcript:FBtr0346702)

HSP 1 Score: 101.293 bits (251), Expect = 1.392e-21
Identity = 88/346 (25.43%), Postives = 148/346 (42.77%), Query Frame = 1
Query:  274 CIENDLITFPKSNFINKDIAILDLSKNNIRILYEDAL--DDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDH-----WDRIQ-LSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIKI 1287
            CI+  LI  P+   I+ +  +LD+S N ++ L  +     +  NL  L L + KI +I    FK  + L  L L +N L+    T  S    ++  L  L L+SN I  I    F +  +L +L L     +    +          L          LP  +E      +L  + LHDNPW CDCR+R  K WL+              NI   + P+    P+ +  +   DL + +F C+P+ L +   +     EN +++C+  + P + + W+ NG L+ ++     + RI  L Q  G     +  + ++    D   + C   N  G A +N+TL + +
Sbjct:  107 CIDRHLIQIPE--HIDPNTQVLDMSGNKLQTLSNEQFIRANLLNLQKLYLRNCKIGEIERETFKGLTNLVELDLSHNLLV----TVPSLALGHIPSLRELTLASNHIHKIESQAFGNTPSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIE---TLSRLHGIELHDNPWLCDCRLRDTKLWLMK------------RNIPYPVAPVCSGGPERIIDRSFADLHVDEFACRPEMLPISHYVEAAMGENASITCRARAVPAANINWYWNGRLLANNSAFTAYQRIHMLEQVEGGFEKRSKLVLTNAQETDSSEFYCVAENRAGMAEANFTLHVSM 431          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Fly
Match: kek1 (gene:FBgn0015399 transcript:FBtr0332210)

HSP 1 Score: 101.293 bits (251), Expect = 1.392e-21
Identity = 88/346 (25.43%), Postives = 148/346 (42.77%), Query Frame = 1
Query:  274 CIENDLITFPKSNFINKDIAILDLSKNNIRILYEDAL--DDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDH-----WDRIQ-LSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIKI 1287
            CI+  LI  P+   I+ +  +LD+S N ++ L  +     +  NL  L L + KI +I    FK  + L  L L +N L+    T  S    ++  L  L L+SN I  I    F +  +L +L L     +    +          L          LP  +E      +L  + LHDNPW CDCR+R  K WL+              NI   + P+    P+ +  +   DL + +F C+P+ L +   +     EN +++C+  + P + + W+ NG L+ ++     + RI  L Q  G     +  + ++    D   + C   N  G A +N+TL + +
Sbjct:  107 CIDRHLIQIPE--HIDPNTQVLDMSGNKLQTLSNEQFIRANLLNLQKLYLRNCKIGEIERETFKGLTNLVELDLSHNLLV----TVPSLALGHIPSLRELTLASNHIHKIESQAFGNTPSLHKLDLSHCDIQTISAQAFGGLQGLTLLRLNGNKLSELLPKTIE---TLSRLHGIELHDNPWLCDCRLRDTKLWLMK------------RNIPYPVAPVCSGGPERIIDRSFADLHVDEFACRPEMLPISHYVEAAMGENASITCRARAVPAANINWYWNGRLLANNSAFTAYQRIHMLEQVEGGFEKRSKLVLTNAQETDSSEFYCVAENRAGMAEANFTLHVSM 431          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Fly
Match: kek3 (gene:FBgn0028370 transcript:FBtr0300848)

HSP 1 Score: 79.7221 bits (195), Expect = 6.095e-15
Identity = 87/359 (24.23%), Postives = 138/359 (38.44%), Query Frame = 1
Query:  265 SLVCIENDLITFPKSNFINKDIAILDLSKNNIRILYEDALDDFE--NLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEE-MMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWFKNGILI----------QDHWDRIQLSQSSGRNYV-------ANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLII 1281
            S++C+  +L   P+   ++    +LDLS N I+++ +D+    +  NL  + L    +  I  +AF+    L  L L  N L    +   S    ++  L  L LS NPI  +P+  F  +  L +L L +  +  I ++  A        L              +        L  L L  N W C C +R  + W++             +NI   I P  CE+P  L  +    L +  F C P+ +    T       N+T+SC  E  P+  VKW     LI           D   R   +    + YV       +NLTI ++    D G Y C   N  G   ++ TL +
Sbjct:   93 SVLCLNANLTHIPQP--LDAGTQLLDLSGNEIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLL----SAIPSLALYHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEVRSGTIT---SLASLHGLELARNTWNCSCSLRPLRAWMLQ------------QNIPSGIPPT-CESPPRLSGRAWDKLDVDDFACVPQIVATDTTAHGVEGRNITMSCYVEGVPQPAVKWLLKNRLIANLSAGGDGDSDSEPRTAAATQGRKTYVVNMLRNASNLTILTADM-QDAGIYTCAAENKAGKVEASVTLAV 428          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Fly
Match: kek3 (gene:FBgn0028370 transcript:FBtr0080752)

HSP 1 Score: 79.7221 bits (195), Expect = 6.095e-15
Identity = 87/359 (24.23%), Postives = 138/359 (38.44%), Query Frame = 1
Query:  265 SLVCIENDLITFPKSNFINKDIAILDLSKNNIRILYEDALDDFE--NLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEE-MMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWFKNGILI----------QDHWDRIQLSQSSGRNYV-------ANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLII 1281
            S++C+  +L   P+   ++    +LDLS N I+++ +D+    +  NL  + L    +  I  +AF+    L  L L  N L    +   S    ++  L  L LS NPI  +P+  F  +  L +L L +  +  I ++  A        L              +        L  L L  N W C C +R  + W++             +NI   I P  CE+P  L  +    L +  F C P+ +    T       N+T+SC  E  P+  VKW     LI           D   R   +    + YV       +NLTI ++    D G Y C   N  G   ++ TL +
Sbjct:   93 SVLCLNANLTHIPQP--LDAGTQLLDLSGNEIQLIPDDSFATAQLLNLQKVYLARCHLRLIERHAFRKLINLVELDLSQNLL----SAIPSLALYHVSELRELRLSGNPILRVPDDAFGHVPQLVKLELSDCRLSHIAVRAFAGLESSLEWLKLDGNRLSEVRSGTIT---SLASLHGLELARNTWNCSCSLRPLRAWMLQ------------QNIPSGIPPT-CESPPRLSGRAWDKLDVDDFACVPQIVATDTTAHGVEGRNITMSCYVEGVPQPAVKWLLKNRLIANLSAGGDGDSDSEPRTAAATQGRKTYVVNMLRNASNLTILTADM-QDAGIYTCAAENKAGKVEASVTLAV 428          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Fly
Match: kek5 (gene:FBgn0031016 transcript:FBtr0074707)

HSP 1 Score: 75.0998 bits (183), Expect = 1.775e-13
Identity = 72/323 (22.29%), Postives = 123/323 (38.08%), Query Frame = 1
Query:  337 LDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQ-LETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWDRI-------QLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLII 1281
            LDLS N IR L+       E L N+ +++N+I  + N+ F N S L  +  RNN                  RL  + L      +   +  L   +L +  L  + KE                                  F+++Q L  L L  N W C C ++ F+ + I+       LY+          P  C+ P  L+ K   ++P   F C+P+ L   ++ +  + +N++L C+    P+  V W  N   +Q +  R+       Q+ +   +   + L I   +   D G Y C   N  G A + + L++
Sbjct:  128 LDLSGNRIRELHPGTFAGLEKLRNVIINNNEIEVLPNHLFVNLSFLSRIEFRNN------------------RLRQVQLH-----VFAGTMALSAISLEQNRLSHLHKET---------------------------------FKDLQKLMHLSLQGNAWNCSCELQDFRDFAIS-----KRLYTP---------PTDCQEPPQLRGKLWSEVPSENFACRPRILGSVRSFIEANHDNISLPCRIVGSPRPNVTWVYNKRPLQQYDPRVRVLTSVEQMPEQPSQVLTSELRIVGVRAS-DKGAYTCVADNRGGRAEAEFQLLV 379          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Zebrafish
Match: lrrc24 (leucine rich repeat containing 24 [Source:ZFIN;Acc:ZDB-GENE-060503-496])

HSP 1 Score: 84.7297 bits (208), Expect = 1.697e-16
Identity = 73/264 (27.65%), Postives = 116/264 (43.94%), Query Frame = 1
Query:  316 INKDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKT-LVVKHLENVTLSCQFESFPKSYVKWFK 1104
            I +    + L  N I  + +  L D   L  L L +N I  +   AF++   L  L+L  N +    +   + VFR L  L  L L+ N I  + +  F  L+ L+EL+L+E + E+   +          L     N     P  L+     + L+ L + DNPW CDC + W + W   +N+    L S+ E        MLC  P  L    L ++P +   C P  ++L  + L V+  E++ +SCQ   +P+  V W K
Sbjct:   28 ITQGTQTIFLQDNAIGQIRQRDLSDLGQLHYLYLQNNSISTLEPGAFRSLGLLLELALNGNRI----HLITADVFRGLDHLRILYLAGNQINRLEDYTFRGLQRLQELHLQENVLEVLGDQALVGLSSLALLDLSRNNLRTLSPASLK---PLVSLQVLRVTDNPWRCDCALHWLRGW---INEEGQRLLSSAERR------MLCAEPPRLSHLSLVEVPPNSLVCIPPVVQLEPSHLTVRLGESLRVSCQASGYPQPQVTWRK 275          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 79.7221 bits (195), Expect = 6.513e-15
Identity = 104/364 (28.57%), Postives = 155/364 (42.58%), Query Frame = 1
Query:  322 KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNAL--------------------------IISNNTFLSSV-FRYL----------------IRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFEC-KPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWF-KNGILIQDHWDRIQLSQ-SSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTL 1275
            + + IL LSKN IR +   A +   NL  L L  N++  + + AF+  SKL+ L LRNN +                           IS+  F+  +  RYL                +RLE L+LS N + II    F  L +LR+L+L      + I++ AF +L NL+ L+L+ N+  SLP+ L    Q  +LE + L+ NPW C+C + W   WL     +N    +             C  P YL+ K + +L  S F C  P  +     L V       L C+  +   S V W   NG L+     R+++S    G     N+T+       D G Y C  TN+ G+  +   L
Sbjct:  100 RHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTLVPSQAFEYLSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSV-IERNAFDDLKNLEELNLSHNSLHSLPHDLFTPLQ--KLERVHLNHNPWVCNCDVLWLSWWLKETVPSNTTCCAR------------CHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTS-VNWITPNGTLMTHGSYRVRISVLHDGTLNFTNVTLR------DTGQYTCMVTNSAGNTTATAVL 441          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 79.7221 bits (195), Expect = 6.513e-15
Identity = 104/364 (28.57%), Postives = 155/364 (42.58%), Query Frame = 1
Query:  322 KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNAL--------------------------IISNNTFLSSV-FRYL----------------IRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFEC-KPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWF-KNGILIQDHWDRIQLSQ-SSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTL 1275
            + + IL LSKN IR +   A +   NL  L L  N++  + + AF+  SKL+ L LRNN +                           IS+  F+  +  RYL                +RLE L+LS N + II    F  L +LR+L+L      + I++ AF +L NL+ L+L+ N+  SLP+ L    Q  +LE + L+ NPW C+C + W   WL     +N    +             C  P YL+ K + +L  S F C  P  +     L V       L C+  +   S V W   NG L+     R+++S    G     N+T+       D G Y C  TN+ G+  +   L
Sbjct:  100 RHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTLVPSQAFEYLSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSV-IERNAFDDLKNLEELNLSHNSLHSLPHDLFTPLQ--KLERVHLNHNPWVCNCDVLWLSWWLKETVPSNTTCCAR------------CHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTS-VNWITPNGTLMTHGSYRVRISVLHDGTLNFTNVTLR------DTGQYTCMVTNSAGNTTATAVL 441          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 79.337 bits (194), Expect = 8.386e-15
Identity = 104/364 (28.57%), Postives = 155/364 (42.58%), Query Frame = 1
Query:  322 KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNAL--------------------------IISNNTFLSSV-FRYL----------------IRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFEC-KPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWF-KNGILIQDHWDRIQLSQ-SSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTL 1275
            + + IL LSKN IR +   A +   NL  L L  N++  + + AF+  SKL+ L LRNN +                           IS+  F+  +  RYL                +RLE L+LS N + II    F  L +LR+L+L      + I++ AF +L NL+ L+L+ N+  SLP+ L    Q  +LE + L+ NPW C+C + W   WL     +N    +             C  P YL+ K + +L  S F C  P  +     L V       L C+  +   S V W   NG L+     R+++S    G     N+T+       D G Y C  TN+ G+  +   L
Sbjct:   93 RHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTLVPSQAFEYLSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSV-IERNAFDDLKNLEELNLSHNSLHSLPHDLFTPLQ--KLERVHLNHNPWVCNCDVLWLSWWLKETVPSNTTCCAR------------CHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTS-VNWITPNGTLMTHGSYRVRISVLHDGTLNFTNVTLR------DTGQYTCMVTNSAGNTTATAVL 434          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 79.337 bits (194), Expect = 8.386e-15
Identity = 104/364 (28.57%), Postives = 155/364 (42.58%), Query Frame = 1
Query:  322 KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNAL--------------------------IISNNTFLSSV-FRYL----------------IRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFEC-KPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWF-KNGILIQDHWDRIQLSQ-SSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTL 1275
            + + IL LSKN IR +   A +   NL  L L  N++  + + AF+  SKL+ L LRNN +                           IS+  F+  +  RYL                +RLE L+LS N + II    F  L +LR+L+L      + I++ AF +L NL+ L+L+ N+  SLP+ L    Q  +LE + L+ NPW C+C + W   WL     +N    +             C  P YL+ K + +L  S F C  P  +     L V       L C+  +   S V W   NG L+     R+++S    G     N+T+       D G Y C  TN+ G+  +   L
Sbjct:   93 RHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTLVPSQAFEYLSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSV-IERNAFDDLKNLEELNLSHNSLHSLPHDLFTPLQ--KLERVHLNHNPWVCNCDVLWLSWWLKETVPSNTTCCAR------------CHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTS-VNWITPNGTLMTHGSYRVRISVLHDGTLNFTNVTLR------DTGQYTCMVTNSAGNTTATAVL 434          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Xenopus
Match: ENSXETT00000026364.1 (leucine rich repeat and Ig domain containing 3 [Source:NCBI gene;Acc:100497438])

HSP 1 Score: 80.1073 bits (196), Expect = 7.152e-15
Identity = 94/340 (27.65%), Postives = 141/340 (41.47%), Query Frame = 1
Query:  301 PKSNFINKDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWK-ITNNAFKNKSKLKYLSLRNNALIISNNTFL-SSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYL-EEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEM-QLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLP----LSKFECKPKTLRLGKT--LVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYG--IDDGCYVCETTNNVGSARSNYTLIIK 1284
            P+S    + + +L L    I  L E       NL  L L+S  + + + N AF+       L+L + ++  +N T + S+  R ++ LEYL+LS NPI II    F DL  L EL++    +  +  Q         L  +S      L      E  FQ +  LETL + DNP ACDCR+ W  +   TLN +N              H  +C +P  +Q   L D P       F C+   +R  K   +     + V+  C+ +  P   + W            R+  S+S GR+ V        +Y    D G Y+C  TN  G+     TL +K
Sbjct:  196 PESLSYLQGLEVLRLRYLGINSLEEQNFQKLYNLKELELESWPLLEDVCNTAFQG------LNLTSLSITYTNLTSVPSAALRNMVYLEYLNLSFNPIRIIQRGAFKDLVRLLELHIVGAFLSTVESQAFLGLRQIRLLNVSNNLLATLE-----ESAFQSVNTLETLRVDDNPLACDCRLLWILQRRKTLNFDN--------------HQPVCASPAKIQGNALRDFPDSILFEHFTCQKPKIRDRKLQHITAHEGQPVSFHCRADGEPVPLIVWV-------SPQRRMITSRSVGRSTVLPEGTLEIRYAQVQDSGTYICIATNAGGNDTYFATLTVK 503          

HSP 2 Score: 60.8474 bits (146), Expect = 6.735e-9
Identity = 53/156 (33.97%), Postives = 73/156 (46.79%), Query Frame = 1
Query:  178 FSTMKFLFLMEFS--LILKGYFLFDCVRKQFSLVCIENDLITFPKSNFINKDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLREL 639
            FS + FL L+ +    +L      DC   Q S++C    L T P+   I  +  +LDLSKN IR L       +  L  + L  N I  I   AF N   L+ L L+ N L +      + VF  L  L  LD+S N I I+ +  F DLR+L+ L
Sbjct:   11 FSIVVFLLLLLYPEWKVLGCPARCDCTPNQRSVICHRKRLTTIPEG--IPSETRLLDLSKNRIRCLNPGDFSPYSLLEEVDLSENIISTIEPGAFANLFFLQILKLKGNQLKL----IPTGVFTKLSNLTLLDISENKIVILLDFMFQDLRSLKSL 160          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Xenopus
Match: LRRC4C (leucine rich repeat containing 4C [Source:NCBI gene;Acc:100188921])

HSP 1 Score: 72.7886 bits (177), Expect = 1.224e-12
Identity = 98/366 (26.78%), Postives = 151/366 (41.26%), Query Frame = 1
Query:  322 KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNAL--------------------------IISNNTFLS-SVFRYL----------------IRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIR-IQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFEC-KPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWD---RIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTL 1275
            + + +L LS+N+IR +   A +   NL  L L  N++  I N AF+  SKLK L LRNN +                           IS   F   S  +YL                ++L+ LDLS N + ++    F  L +L++L++  M  +I+ I++ AF +L +L  L+LA NN   LP+ L      +Q   + LH NPW C+C + W   WL  +        +             C TP  L+   + +L  + F C  P  +     L V       L C+  S   +YV W      I  H     RI +      N+  N+T+       D G Y C  +N+ G+  ++ TL
Sbjct:  100 RHLEVLQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFEYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGEMKRLSYISEGAFEGLSNLKYLNLGMCNLRDIPNLTPLVKLDELDLSGNHLSVLRPGSFQGLTHLQKLWI--MHSQIQVIERNAFDDLQSLVELNLAHNNLTLLPHDLFTPLHNLQ--RIQLHHNPWNCNCDILWLSWWLKEIVTTGSTCCAR------------CSTPPSLKGTHIAELDHNYFTCYAPVIVEPPADLNVTEGMAAELKCR-ASTSLTYVSWITPNGTIMTHGSYKVRISVLNDGTLNF-TNVTVR------DTGLYTCIVSNSAGNTTASATL 441          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Xenopus
Match: LINGO2 (leucine rich repeat and Ig domain containing 2 [Source:NCBI gene;Acc:100490134])

HSP 1 Score: 70.4774 bits (171), Expect = 5.823e-12
Identity = 95/339 (28.02%), Postives = 133/339 (39.23%), Query Frame = 1
Query:  337 LDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLR---------NNALIISNNTFLS-----------SVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQ-LETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPML--------CETPDYLQRK--KLCDLPLSK--FECKPKTLRLGKTLVVKHLEN--VTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYG--IDDGCYVCETTN 1242
            L L K N+  +  DAL    NL +L L    I  +   AFK    LK L +           N+L   N TFLS              ++LI L +L+LS NPIGII    F DL  L+EL+L  +  ++R  +           L     N L      E  FQ  + LE L + DNP  CDCR+ W                      +L  HPML        C +PD L+    K+ D  +    F CK   +R  + L V   E   V ++C  +  P+  + W      +      + L +S+GR  V        +Y    D G Y+C  +N
Sbjct:  186 LTLEKCNLTAVPTDALSHLHNLYSLHLKYLNINVLPPFAFKRLFHLKILEISYWPLLDLVPANSLYGLNLTFLSITNTNLSTIPYHALKHLIYLTHLNLSYNPIGIIDTGVFSDLVRLQELHL--VGAQLRTIEPHAFQGLRFLRLLNVSQNLLE--TLEENAFQSPKALEVLCIDDNPLVCDCRLIW----------------------MLQRHPMLHFGGQQPMCSSPDSLKESSYKVLDAAVLSFYFTCKKPKIRDREMLQVHVDEGQRVQMNCNADGDPQPMISW------VTPRRRTVSL-KSNGRTTVLGNGTLEIRYAQIQDTGTYICVASN 491          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Xenopus
Match: LRIG2 (leucine-rich repeats and immunoglobulin like domains 2 [Source:NCBI gene;Acc:100494845])

HSP 1 Score: 70.0922 bits (170), Expect = 1.023e-11
Identity = 89/325 (27.38%), Postives = 137/325 (42.15%), Query Frame = 1
Query:  337 LDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNAL--IISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIE----NILLNIHPMLCETPDYLQRKKLCD-LPLSKFECKPKTLRLGKTLVVKHLENVTLSCQFES---FPKSYVKWFKNGILIQD---------HWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGS 1254
            LDLS N +  L + A     +L  + L  N+I  I    FK  + L  L LRNN +   I ++   + VF  L RL  L L  N I  I    F  L +L+ L L      + +Q                           E  F  M+L+ L+L+ +   CDC+++WF  W   LN N  H +  +     N L    P+  +  D+     +CD  P  + + +P+T     T+ +K + NV+L+C   S    P S   W K+G ++ D         H   I+L +     Y+  L +F+  +  D+G Y C  TN+ GS
Sbjct:  219 LDLSYNQLNRLDDFAFVGLSSLEKINLGDNRINHIAEGVFKGLANLLVLDLRNNEISWAIEDS---NEVFAGLSRLHTLILQGNKIKSITMKAFTGLDSLQHLDLSNNAI-LSVQ---------------------------ENGFSFMKLQELILNTSNLLCDCQLKWFPHW---LNDNGFHQFVNVSCAHPNWLAGRSPLSVDAEDF-----ICDNFPKPQIKLQPET-----TVALKGM-NVSLTCAAASSSDTPMS-TAWRKDGEVLYDAEVENFARYHKHGIELIE-----YITVLHLFNVNF-TDEGKYQCVITNHFGS 491          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Xenopus
Match: LRIG2 (leucine-rich repeats and immunoglobulin like domains 2 [Source:NCBI gene;Acc:100494845])

HSP 1 Score: 70.0922 bits (170), Expect = 1.190e-11
Identity = 89/325 (27.38%), Postives = 137/325 (42.15%), Query Frame = 1
Query:  337 LDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNAL--IISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIE----NILLNIHPMLCETPDYLQRKKLCD-LPLSKFECKPKTLRLGKTLVVKHLENVTLSCQFES---FPKSYVKWFKNGILIQD---------HWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGS 1254
            LDLS N +  L + A     +L  + L  N+I  I    FK  + L  L LRNN +   I ++   + VF  L RL  L L  N I  I    F  L +L+ L L      + +Q                           E  F  M+L+ L+L+ +   CDC+++WF  W   LN N  H +  +     N L    P+  +  D+     +CD  P  + + +P+T     T+ +K + NV+L+C   S    P S   W K+G ++ D         H   I+L +     Y+  L +F+  +  D+G Y C  TN+ GS
Sbjct:  240 LDLSYNQLNRLDDFAFVGLSSLEKINLGDNRINHIAEGVFKGLANLLVLDLRNNEISWAIEDS---NEVFAGLSRLHTLILQGNKIKSITMKAFTGLDSLQHLDLSNNAI-LSVQ---------------------------ENGFSFMKLQELILNTSNLLCDCQLKWFPHW---LNDNGFHQFVNVSCAHPNWLAGRSPLSVDAEDF-----ICDNFPKPQIKLQPET-----TVALKGM-NVSLTCAAASSSDTPMS-TAWRKDGEVLYDAEVENFARYHKHGIELIE-----YITVLHLFNVNF-TDEGKYQCVITNHFGS 512          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Mouse
Match: Lrfn5 (leucine rich repeat and fibronectin type III domain containing 5 [Source:MGI Symbol;Acc:MGI:2144814])

HSP 1 Score: 77.7962 bits (190), Expect = 3.312e-14
Identity = 97/357 (27.17%), Postives = 148/357 (41.46%), Query Frame = 1
Query:  253 RKQFSLVCIENDLITFPKSNFIN-KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLE-----------TLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTL-RLGKTLVVKHLENVTLSCQFESFPKSYVKWFK-NGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLII 1281
            R+   L   +N +    + +F N   +  L LS+N I  +   A  D  NL  L L+SN++ KITN+ F   S L +L L NN L + ++T    VF     LE LDLS N +  IP      + +L  L L+  M +  I KG FS+L  +  L +  N    LP   +  FQ  Q+             L    NP  C+C + W +R    L++ +D     +E          C +P  L  +    +P  +F C+P  + R    + V   +  TL C+    P+  + W    G LI +    +        N   ++ I + K   D G + C  +N  G A     L I
Sbjct:   51 RRTVELRLADNFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFSGLSNLHHLILNNNQLTLISSTAFDDVF----ALEELDLSYNNLETIPWDAVEKMVSLHTLSLDHNMID-NIPKGTFSHLHKMTRLDVTSNKLQKLPP--DPLFQRAQVLATSGIISPSTFALSFGGNPLHCNCELLWLRR----LSREDD-----LET---------CASPALLTGRYFWSIPEEEFLCEPPLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYD-----NGTLDILITTVK---DTGAFTCIASNPAGEATQTVDLHI 374          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Mouse
Match: Lrfn5 (leucine rich repeat and fibronectin type III domain containing 5 [Source:MGI Symbol;Acc:MGI:2144814])

HSP 1 Score: 77.411 bits (189), Expect = 3.793e-14
Identity = 97/357 (27.17%), Postives = 148/357 (41.46%), Query Frame = 1
Query:  253 RKQFSLVCIENDLITFPKSNFIN-KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLE-----------TLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTL-RLGKTLVVKHLENVTLSCQFESFPKSYVKWFK-NGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLII 1281
            R+   L   +N +    + +F N   +  L LS+N I  +   A  D  NL  L L+SN++ KITN+ F   S L +L L NN L + ++T    VF     LE LDLS N +  IP      + +L  L L+  M +  I KG FS+L  +  L +  N    LP   +  FQ  Q+             L    NP  C+C + W +R    L++ +D     +E          C +P  L  +    +P  +F C+P  + R    + V   +  TL C+    P+  + W    G LI +    +        N   ++ I + K   D G + C  +N  G A     L I
Sbjct:   51 RRTVELRLADNFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFSGLSNLHHLILNNNQLTLISSTAFDDVF----ALEELDLSYNNLETIPWDAVEKMVSLHTLSLDHNMID-NIPKGTFSHLHKMTRLDVTSNKLQKLPP--DPLFQRAQVLATSGIISPSTFALSFGGNPLHCNCELLWLRR----LSREDD-----LET---------CASPALLTGRYFWSIPEEEFLCEPPLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYD-----NGTLDILITTVK---DTGAFTCIASNPAGEATQTVDLHI 374          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Mouse
Match: Lrrc4c (leucine rich repeat containing 4C [Source:MGI Symbol;Acc:MGI:2442636])

HSP 1 Score: 75.485 bits (184), Expect = 1.330e-13
Identity = 100/364 (27.47%), Postives = 155/364 (42.58%), Query Frame = 1
Query:  322 KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNAL--------------------------IISNNTFLS-SVFRYL----------------IRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFEC-KPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWF-KNGILIQDHWDRIQLSQ-SSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTL 1275
            + + IL LS+N+IR +   A +   NL  L L  N++  I N AF   SKLK L LRNN +                           IS   F   S  RYL                I+L+ LDLS N +  I    F  L +L++L++ +   ++ I++ AF NL +L  ++LA NN   LP+ L        LE + LH NPW C+C + W   W+  +  +N    +             C TP  L+ + + +L  + F C  P  +     L V       L C+  S   + V W   NG ++     +++++  S G     N+T+       D G Y C  +N+VG+  ++ TL
Sbjct:  100 RHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQV-IERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLH--HLERIHLHHNPWNCNCDILWLSWWIRDMAPSNTACCAR------------CNTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKCR-ASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQ------DTGMYTCMVSNSVGNTTASATL 441          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Mouse
Match: Lrrc4c (leucine rich repeat containing 4C [Source:MGI Symbol;Acc:MGI:2442636])

HSP 1 Score: 75.485 bits (184), Expect = 1.330e-13
Identity = 100/364 (27.47%), Postives = 155/364 (42.58%), Query Frame = 1
Query:  322 KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNAL--------------------------IISNNTFLS-SVFRYL----------------IRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFEC-KPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWF-KNGILIQDHWDRIQLSQ-SSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTL 1275
            + + IL LS+N+IR +   A +   NL  L L  N++  I N AF   SKLK L LRNN +                           IS   F   S  RYL                I+L+ LDLS N +  I    F  L +L++L++ +   ++ I++ AF NL +L  ++LA NN   LP+ L        LE + LH NPW C+C + W   W+  +  +N    +             C TP  L+ + + +L  + F C  P  +     L V       L C+  S   + V W   NG ++     +++++  S G     N+T+       D G Y C  +N+VG+  ++ TL
Sbjct:  100 RHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQV-IERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLH--HLERIHLHHNPWNCNCDILWLSWWIRDMAPSNTACCAR------------CNTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKCR-ASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQ------DTGMYTCMVSNSVGNTTASATL 441          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Mouse
Match: Lrrc4c (leucine rich repeat containing 4C [Source:MGI Symbol;Acc:MGI:2442636])

HSP 1 Score: 75.485 bits (184), Expect = 1.330e-13
Identity = 100/364 (27.47%), Postives = 155/364 (42.58%), Query Frame = 1
Query:  322 KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNAL--------------------------IISNNTFLS-SVFRYL----------------IRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFEC-KPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWF-KNGILIQDHWDRIQLSQ-SSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTL 1275
            + + IL LS+N+IR +   A +   NL  L L  N++  I N AF   SKLK L LRNN +                           IS   F   S  RYL                I+L+ LDLS N +  I    F  L +L++L++ +   ++ I++ AF NL +L  ++LA NN   LP+ L        LE + LH NPW C+C + W   W+  +  +N    +             C TP  L+ + + +L  + F C  P  +     L V       L C+  S   + V W   NG ++     +++++  S G     N+T+       D G Y C  +N+VG+  ++ TL
Sbjct:  100 RHLEILQLSRNHIRTIEIGAFNGLANLNTLELFDNRLTTIPNGAFVYLSKLKELWLRNNPIESIPSYAFNRIPSLRRLDLGELKRLSYISEGAFEGLSNLRYLNLAMCNLREIPNLTPLIKLDELDLSGNHLSAIRPGSFQGLMHLQKLWMIQSQIQV-IERNAFDNLQSLVEINLAHNNLTLLPHDLFTPLH--HLERIHLHHNPWNCNCDILWLSWWIRDMAPSNTACCAR------------CNTPPNLKGRYIGELDQNYFTCYAPVIVEPPADLNVTEGMAAELKCR-ASTSLTSVSWITPNGTVMTHGAYKVRIAVLSDGTLNFTNVTVQ------DTGMYTCMVSNSVGNTTASATL 441          
BLAST of Leucine Rich repeat-containing domain protein vs. UniProt/SwissProt
Match: sp|A6NDA9|LRIT2_HUMAN (Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LRIT2 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 9.862e-19
Identity = 85/359 (23.68%), Postives = 155/359 (43.18%), Query Frame = 1
Query:  250 VRKQFSLVCIEND-LITFPKSNFIN-KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQ-LSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIKI-PSHKDNAID 1314
            + ++F  V IEN  L   P+ +FIN   +  L L+ NNI +++  AL+    L  L L+ NK+  +   AF+    L+ L L+ N +    +       ++L+ L YLDLSSN + ++ +S FL+    ++    +   EI                                    +    + LHDNPW CDCR+R   +++ ++         T+  IL+N + ++C+ P     +   +  LS    KP+       + ++  +NVTL C  ++ P   + W          W     L+ S+G +   +     + + +D G Y C  +N++G  +SN  + + + P+   +A D
Sbjct:   53 LSEEFKQVRIENSPLFEMPQGSFINMSTLEYLWLNFNNISVIHLGALEHLPELRELRLEGNKLCSVPWTAFRATPLLRVLDLKRNKI----DALPELALQFLVSLTYLDLSSNRLTVVSKSVFLNWPAYQKCRQPDCGAEI------------------------------------LSSLVVALHDNPWVCDCRLRGLVQFVKSI---------TLPVILVNSY-LICQGPLSKAGQLFHETELSACM-KPQISTPSANITIRAGQNVTLRCLAQASPSPSIAW----TYPLSMWREFDVLTSSTGEDTALSELAIPAAHLVDSGNYTCMASNSIG--KSNLVISLHVQPAQALHAPD 354          
BLAST of Leucine Rich repeat-containing domain protein vs. UniProt/SwissProt
Match: sp|Q50LG9|LRC24_HUMAN (Leucine-rich repeat-containing protein 24 OS=Homo sapiens OX=9606 GN=LRRC24 PE=2 SV=2)

HSP 1 Score: 83.1889 bits (204), Expect = 2.727e-15
Identity = 81/340 (23.82%), Postives = 136/340 (40.00%), Query Frame = 1
Query:  316 INKDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHL-ENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQ-----------------SSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLII 1281
            I      L L  NNI  L   AL     L  L L +N +  +   AF+ + +L  L+L +N L        S  F  L +L  L L+ N +  + +  FL L  L+EL+L+E   E+   +          L              L+       L+ L L +NPW CDC + W   W   + +    L ++ +  +      +C  P  L  + L D+  S   C P ++ +    +  +L E++ ++CQ   +P+  V W K   + Q    R +                     SG  +++N+T+  +      G Y CE +N  G+AR  + L++
Sbjct:   48 IPPGTQTLFLQDNNIARLEPGALAPLAALRRLYLHNNSLRALEAGAFRAQPRLLELALTSNRL----RGLRSGAFVGLAQLRVLYLAGNQLARLLDFTFLHLPRLQELHLQENSIELLEDQALAGLSSLALLDLSRNQLGTISREALQ---PLASLQVLRLTENPWRCDCALHWLGAW---IKEGGQRLLTSRDRKI------MCAEPPRLALQSLLDVSHSSLICIPPSVHVQPLELTANLGEDLRVACQASGYPQPLVTWRK---VPQPREGRPRAQAQLEGGLLGLGGHSASDTGSGMLFLSNITLAHA------GKYECEASNAGGAARVPFRLLV 362          
BLAST of Leucine Rich repeat-containing domain protein vs. UniProt/SwissProt
Match: sp|Q96NI6|LRFN5_HUMAN (Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Homo sapiens OX=9606 GN=LRFN5 PE=1 SV=2)

HSP 1 Score: 77.411 bits (189), Expect = 2.608e-13
Identity = 95/349 (27.22%), Postives = 146/349 (41.83%), Query Frame = 1
Query:  253 RKQFSLVCIENDLITFPKSNFIN-KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLE-----------TLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTL-RLGKTLVVKHLENVTLSCQFESFPKSYVKWFK-NGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSA 1257
            R+   L   +N +    + +F N   +  L LS+N I  +   A  D  NL  L L+SN++ KITN+ F   S L +L L NN L + ++T    VF     LE LDLS N +  IP      + +L  L L+  M +  I KG FS+L  +  L +  N    LP   +  FQ  Q+             L    NP  C+C + W +R    L++ +D     +E          C +P  L  +    +P  +F C+P  + R    + V   +  TL C+    P+  + W    G LI +    +        N   ++ I + K   D G + C  +N  G A
Sbjct:   51 RRTVELRLADNFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFSGLSNLHHLILNNNQLTLISSTAFDDVF----ALEELDLSYNNLETIPWDAVEKMVSLHTLSLDHNMID-NIPKGTFSHLHKMTRLDVTSNKLQKLPP--DPLFQRAQVLATSGIISPSTFALSFGGNPLHCNCELLWLRR----LSREDD-----LET---------CASPPLLTGRYFWSIPEEEFLCEPPLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYD-----NGTLDILITTVK---DTGAFTCIASNPAGEA 366          
BLAST of Leucine Rich repeat-containing domain protein vs. UniProt/SwissProt
Match: sp|Q8BXA0|LRFN5_MOUSE (Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Mus musculus OX=10090 GN=Lrfn5 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.653e-13
Identity = 97/357 (27.17%), Postives = 148/357 (41.46%), Query Frame = 1
Query:  253 RKQFSLVCIENDLITFPKSNFIN-KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLE-----------TLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTL-RLGKTLVVKHLENVTLSCQFESFPKSYVKWFK-NGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLII 1281
            R+   L   +N +    + +F N   +  L LS+N I  +   A  D  NL  L L+SN++ KITN+ F   S L +L L NN L + ++T    VF     LE LDLS N +  IP      + +L  L L+  M +  I KG FS+L  +  L +  N    LP   +  FQ  Q+             L    NP  C+C + W +R    L++ +D     +E          C +P  L  +    +P  +F C+P  + R    + V   +  TL C+    P+  + W    G LI +    +        N   ++ I + K   D G + C  +N  G A     L I
Sbjct:   51 RRTVELRLADNFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFSGLSNLHHLILNNNQLTLISSTAFDDVF----ALEELDLSYNNLETIPWDAVEKMVSLHTLSLDHNMID-NIPKGTFSHLHKMTRLDVTSNKLQKLPP--DPLFQRAQVLATSGIISPSTFALSFGGNPLHCNCELLWLRR----LSREDD-----LET---------CASPALLTGRYFWSIPEEEFLCEPPLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYD-----NGTLDILITTVK---DTGAFTCIASNPAGEATQTVDLHI 374          
BLAST of Leucine Rich repeat-containing domain protein vs. UniProt/SwissProt
Match: sp|D4A1J9|LRFN5_RAT (Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Lrfn5 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.942e-13
Identity = 97/357 (27.17%), Postives = 148/357 (41.46%), Query Frame = 1
Query:  253 RKQFSLVCIENDLITFPKSNFIN-KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLE-----------TLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTL-RLGKTLVVKHLENVTLSCQFESFPKSYVKWFK-NGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLII 1281
            R+   L   +N +    + +F N   +  L LS+N I  +   A  D  NL  L L+SN++ KITN+ F   S L +L L NN L + ++T    VF     LE LDLS N +  IP      + +L  L L+  M +  I KG FS+L  +  L +  N    LP   +  FQ  Q+             L    NP  C+C + W +R    L++ +D     +E          C +P  L  +    +P  +F C+P  + R    + V   +  TL C+    P+  + W    G LI +    +        N   ++ I + K   D G + C  +N  G A     L I
Sbjct:   51 RRTVELRLADNFVTNIKRKDFANMTSLVDLTLSRNTISFITPHAFADLRNLRALHLNSNRLTKITNDMFSGLSNLHHLILNNNQLTLISSTAFDDVF----ALEELDLSYNNLETIPWDAVEKMVSLHTLSLDHNMID-NIPKGTFSHLHKMTRLDVTSNKLQKLPP--DPLFQRAQVLATSGIISPSTFALSFGGNPLHCNCELLWLRR----LSREDD-----LET---------CASPALLTGRYFWSIPEEEFLCEPPLITRHTHEMRVLEGQRATLRCKARGDPEPAIHWISPEGKLISNATRSLVYD-----NGTLDILITTVK---DTGAFTCIASNPAGEATQTMDLHI 374          
BLAST of Leucine Rich repeat-containing domain protein vs. TrEMBL
Match: A0A504Y3D3 (Putative slit OS=Fasciola gigantica OX=46835 GN=FGIG_05745 PE=4 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 6.444e-38
Identity = 127/353 (35.98%), Postives = 180/353 (50.99%), Query Frame = 1
Query:  274 CIENDLITFPKSNFINKDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSK-LKYLSLRNNALIISNN--TFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDL-RNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYE-FQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRL---------GKTLVVKHLE--NVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIK 1284
            C  + LI  P +  IN+    LDLS N I +L+ED+     +L  L L  NKI+KIT  AF   ++ L YL LRNN  I+SN+  +F  +    L+ L YLDLS NP+ I+P  F   +  NL +L L  +  +++IQ GAF  L  L  L+LA N+F    N   +E  +  Q   L  H   W CDCR+ WF+RWL     N+    +   + L       C +P   + + L  L L+  +C P+ L            + + V  L+  N+TLSC F S PK+ V W++NGILIQ HW R     SSG  +  +L        +D G Y C+T+N  GSA  N+ + +K
Sbjct:   37 CTHSRLIEVPGN--INRLTEELDLSHNLIEVLHEDSFHRLNSLRRLVLSHNKIYKITERAFLAVAQTLTYLDLRNNQ-IMSNSITSFPVTALAPLVHLTYLDLSGNPLSIVPTEFLRHMGANLTQLDLSSVPMKLQIQPGAFRGLAQLHRLNLAGNSFGEF-NEDSFEGLRPAQFSQLSFHGVQWRCDCRLLWFRRWL-----NHVPRKALFADALPGGE---CISPPAFKGRSLLFLNLTDLQCAPRLLGTIPPSQEQDSPEPVHVVALDGYNLTLSCVFVSEPKTQVHWYQNGILIQSHWKRFTQFTSSGTKFTTSLHFHQLNSQLDTGTYQCQTSNQKGSAGKNFMVDVK 377          
BLAST of Leucine Rich repeat-containing domain protein vs. TrEMBL
Match: A0A2H1CU83 (Leucine Rich repeat-containing domain protein OS=Fasciola hepatica OX=6192 GN=D915_02041 PE=4 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 6.811e-38
Identity = 126/354 (35.59%), Postives = 178/354 (50.28%), Query Frame = 1
Query:  274 CIENDLITFPKSNFINKDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSK-LKYLSLRNNALIISNNT-FLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDL-RNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYE-FQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHLE-------------NVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIK 1284
            C  + LI  P +  IN+    LDLS N I +L+ED+     +L  L L  NKI+KIT  AF   ++ L YL LRNN ++ ++ T F  +    L+ L YLDLS NP+ I+P  F   +  NL +L L  +  +++IQ GAF  L  L  L+LA N+F    N   +E  +  Q   L LH   W CDCR+ WF+RWL     N+    +   + L       C +P   + + L  L L+  +C P+ L  G     + L+             N+TLSC F S PK  V W++NGILIQ HW R     SSG  +  +L        +D G Y C+T+N  GSA  N+ + +K
Sbjct:   37 CTHSRLIEVPGN--INRLTEELDLSHNLIEVLHEDSFHRLNSLRRLVLSHNKIYKITERAFLAVAQTLTYLDLRNNQIMSNSITGFPITALAPLVHLTYLDLSGNPLSIVPTEFLQHMGANLTQLDLSSVPMKLQIQPGAFRGLAQLHRLNLAGNSFGEF-NEDSFEGLRPAQFSQLSLHGVQWRCDCRLLWFRRWL-----NHVPRKALFADALPGGE---CISPPAFKGRSLLFLNLTDLQCAPRLL--GTIPPSQELDSPEPVHVVALDGYNLTLSCVFVSEPKMQVHWYQNGILIQSHWKRFTQFTSSGTKFTTSLHFHQLNSQLDTGTYQCQTSNQKGSAGKNFMVDVK 377          
BLAST of Leucine Rich repeat-containing domain protein vs. TrEMBL
Match: A0A4E0RKD6 (Putative slit OS=Fasciola hepatica OX=6192 GN=D915_001401 PE=4 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 7.648e-38
Identity = 126/354 (35.59%), Postives = 178/354 (50.28%), Query Frame = 1
Query:  274 CIENDLITFPKSNFINKDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSK-LKYLSLRNNALIISNNT-FLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDL-RNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYE-FQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHLE-------------NVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIK 1284
            C  + LI  P +  IN+    LDLS N I +L+ED+     +L  L L  NKI+KIT  AF   ++ L YL LRNN ++ ++ T F  +    L+ L YLDLS NP+ I+P  F   +  NL +L L  +  +++IQ GAF  L  L  L+LA N+F    N   +E  +  Q   L LH   W CDCR+ WF+RWL     N+    +   + L       C +P   + + L  L L+  +C P+ L  G     + L+             N+TLSC F S PK  V W++NGILIQ HW R     SSG  +  +L        +D G Y C+T+N  GSA  N+ + +K
Sbjct:   37 CTHSRLIEVPGN--INRLTEELDLSHNLIEVLHEDSFHRLNSLRRLVLSHNKIYKITERAFLAVAQTLTYLDLRNNQIMSNSITGFPITALAPLVHLTYLDLSGNPLSIVPTEFLQHMGANLTQLDLSSVPMKLQIQPGAFRGLAQLHRLNLAGNSFGEF-NEDSFEGLRPAQFSQLSLHGVQWRCDCRLLWFRRWL-----NHVPRKALFADALPGGE---CISPPAFKGRSLLFLNLTDLQCAPRLL--GTIPPSQELDSPEPVHVVALDGYNLTLSCVFVSEPKMQVHWYQNGILIQSHWKRFTQFTSSGTKFTTSLHFHQLNSQLDTGTYQCQTSNQKGSAGKNFMVDVK 377          
BLAST of Leucine Rich repeat-containing domain protein vs. TrEMBL
Match: A0A3P6TYJ9 (Ig-like domain-containing protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS2329 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 1.704e-37
Identity = 121/353 (34.28%), Postives = 175/353 (49.58%), Query Frame = 1
Query:  274 CIENDLITFPKSNFINKDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKS-KLKYLSLRNNALI--ISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDL-RNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLV-------------VKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLII 1281
            CI ++L + P+   I+ D   LDLS N I IL+ED+   F  L  L LD N+I+KIT+ AF+  +  L+YLSLR N L   +S+N F  S    L +L  LDLS NP+G I   +   L   LR L++ ++   + IQ  AF+ L  L+   L+ N F + P       +  +L  + L    W CDCR+ W + WL  +++     Y   + I     P  C+ P    +  L DLP++ F+C PK   +  T                   E + L C F S PK  V W+KNG+L++    RI+   S G  +   LTIF  +Y  D G Y C T N+ GSAR+ + L +
Sbjct:    5 CINSELGSIPQG--IHPDTRKLDLSNNRIEILHEDSFLGFRQLQTLNLDDNRIYKITDRAFEALALTLEYLSLRRNRLSFRVSSN-FPVSALSKLKKLRGLDLSGNPLGRIATEWLSPLGETLRILHISDLNGPVEIQSNAFAGLGLLEDFDLSNNEFSAFPENAFEGIRPEKLTAINLTHISWVCDCRLLWLRHWLAQVHRQP---YVKEKKI---TSP--CKYPKEFSKLTLLDLPVTTFQCVPKLQAINATAANIYEQSKTFLHVSSAAGETIQLRCTFLSQPKMLVSWYKNGVLLRPELKRIRQETSKGTRFTTTLTIFDLQYDEDSGNYTCTTANSRGSARAAFQLWV 346          
BLAST of Leucine Rich repeat-containing domain protein vs. TrEMBL
Match: A0A0R3SAJ9 (Ig-like domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS1382 PE=4 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 4.276e-37
Identity = 113/339 (33.33%), Postives = 176/339 (51.92%), Query Frame = 1
Query:  316 INKDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKS-KLKYLSLRNNALII-SNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRN-LRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHLEN--------------VTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLII 1281
            ++ +  ILDLS+N +++++ED+  ++  L  L LD N+I+KIT+ A  + S  L+YLSLR N L + S++ F       L  L  LDLS NP+G++  ++   L   LR L L  ++ ++ +++ AF  L NL+    + N+F   P       +  +L+ L L D PW CDC++ W ++WL  +   N     TI           C +P  L +  L  LPL+ F+C P TL+   +    H  N              +TL+C+F S PK  V+W+KNG L++    R   S S G  + A LTI   +   D+G Y C+T+NN G AR  ++L I
Sbjct:   54 VHPETRILDLSRNFLKVIHEDSFVEYHRLTQLILDYNEIYKITDRALNSISITLRYLSLRGNRLSVRSSSNFPIDALAKLRNLRILDLSENPLGVMVSNWLAPLGGTLRVLRLSGLIDQVELKENAFFGLGNLEEFDFSNNSFYHFPENAFSGIRPEKLKRLNLRDIPWHCDCKLFWLRQWLKEVKIINSPGEPTITGP--------CSSPPTLGKTPLISLPLTHFQCPP-TLQAMHSSAPHHFGNYKSLLYVTPSLGDSITLTCKFVSQPKMLVQWYKNGALLRPELKRFAQSVSRGSKFSAILTITDLRSPADNGNYTCKTSNNRGLARGVFSLNI 383          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Cavefish
Match: lrit2 (leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2 [Source:NCBI gene;Acc:103045557])

HSP 1 Score: 80.4925 bits (197), Expect = 2.321e-15
Identity = 92/363 (25.34%), Postives = 151/363 (41.60%), Query Frame = 1
Query:  250 VRKQFSLVCIENDLIT-FPKSNFIN-KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLET------LLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRK-------KLCDLPLSKFECKPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIKIPS 1293
            + + F+ + IE   +T  PKS F   K +  L L+ N+I I+   +L    NL  L L+ NK+  +   AF++   LK L L++N L    +       ++L  L YLDLS N + +I +  FL                                           P Y +  F+  + ET      L LH+NPW CDCR+R F  ++++L+            IL+N + + C  P+Y+  K       K C  P++       ++ LG         NVTL+C   + P+  V W+  G+ I   +  +Q         V +  I  S +  D G Y C   N +G+  S+ ++++ + S
Sbjct:   56 IPEDFTKIRIEKSHLTEIPKSAFSRYKSLENLWLNFNDITIINIKSLQGLNNLTELRLEGNKLSSVPWTAFEDAPSLKILDLKHNRL----DVLPEHALKFLPGLTYLDLSFNQLTVISKDVFLKW-----------------------------------------PLY-DRVFKSAERETVPTNVVLALHENPWQCDCRLRGFVEFVMSLSP---------PIILMNSY-LSCSGPEYMAGKFFHEVELKTCIKPVATSPTTNISMPLGA--------NVTLTCFAMARPEPAV-WWTYGLKILRGFHELQ--TRVNEETVKSELIIPSLHLADRGVYTCTANNFIGN--SSVSILVDVKS 349          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Cavefish
Match: lrrc4ba (leucine-rich repeat-containing protein 4B-like [Source:NCBI gene;Acc:103034410])

HSP 1 Score: 80.4925 bits (197), Expect = 3.014e-15
Identity = 105/378 (27.78%), Postives = 162/378 (42.86%), Query Frame = 1
Query:  322 KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNAL--------------------------IISNNTFLSSV-FRYL----------------IRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFEC-KPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWF-KNGILIQDHWDRIQLSQ-SSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIKIPSHKDNAIDY 1317
            + + IL LSKN IR +   A +   NL  L L  N++  + + AF+  SKL+ L LRNN +                           IS+  F+  +  RYL                +RLE L+LS N + II    F  L +LR+L+L      + I++ AF +L +L+ L+L+ N+  SLP+ L    Q  +LE + L+ NPW C+C + W   WL     +N    +             C  P YL+ K + +L  S F C  P  +     L V       L C+  +   S V W   NG L+     R+++S    G     N+T+       D G Y C  TN+ G+  +   L +   +  D +++Y
Sbjct:   80 RHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTLVPSQAFEYLSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMTV-IERNAFDDLKSLEELNLSHNSLHSLPHDLFTPLQ--KLERVHLNHNPWVCNCDVLWLSWWLKETVPSNTTCCAR------------CHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTS-VNWITPNGTLMTHGSYRVRISVLHDGTLNFTNVTLR------DTGQYTCMVTNSAGNTTATAVLNV---TAADASVNY 432          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Cavefish
Match: LRIT2 (leucine rich repeat, Ig-like and transmembrane domains 2 [Source:NCBI gene;Acc:103030533])

HSP 1 Score: 79.7221 bits (195), Expect = 4.311e-15
Identity = 86/337 (25.52%), Postives = 137/337 (40.65%), Query Frame = 1
Query:  262 FSLVCIENDLIT-FPKSNFINKDIAILD---LSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSS-GRNYVANLTIFSSKYGIDDGCYVCETTNNVGSA 1257
            F  + IEN  +T  P+  F    ++ LD   L+ N+I ++   +L+   NL  L L  NK+  +   AF++   LK L L++N L    +       R+L  L YLDLS N + +I    FL+    R                                     P       ++     L LHDN W CDCR++ F  ++ +++            IL+N + + C  PD    K   +L L K   KP+T      + +    NVTL C  ++ P   V+W  +   I+       +SQS  G + + +  I  S +  D G Y C   N +G++
Sbjct:   16 FIKIRIENSHLTEIPQRAFFT--VSALDSLWLNFNDIALMNAKSLEGLNNLTELRLQGNKLRSVPWTAFQDAPNLKILDLKHNRL----DVLPEHALRHLPALTYLDLSFNQLKVISRDVFLNWPRYR-------------------------------------PQTHGRREEDAANVVLALHDNQWLCDCRLKGFVEFIKSVSP---------PIILMNSY-LTCSGPDSRAGKFFHELEL-KTCLKPQTSTPEVNITLPLGANVTLRCFVKARPDPVVQWSYSLKTIRG----FTVSQSQVGEDTIGSALIIPSVHVADRGLYTCTANNFIGNS 294          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Cavefish
Match: lrrc4ba (leucine-rich repeat-containing protein 4B-like [Source:NCBI gene;Acc:103034410])

HSP 1 Score: 79.7221 bits (195), Expect = 5.489e-15
Identity = 105/378 (27.78%), Postives = 162/378 (42.86%), Query Frame = 1
Query:  322 KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNAL--------------------------IISNNTFLSSV-FRYL----------------IRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFEC-KPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWF-KNGILIQDHWDRIQLSQ-SSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIKIPSHKDNAIDY 1317
            + + IL LSKN IR +   A +   NL  L L  N++  + + AF+  SKL+ L LRNN +                           IS+  F+  +  RYL                +RLE L+LS N + II    F  L +LR+L+L      + I++ AF +L +L+ L+L+ N+  SLP+ L    Q  +LE + L+ NPW C+C + W   WL     +N    +             C  P YL+ K + +L  S F C  P  +     L V       L C+  +   S V W   NG L+     R+++S    G     N+T+       D G Y C  TN+ G+  +   L +   +  D +++Y
Sbjct:   93 RHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTLVPSQAFEYLSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMTV-IERNAFDDLKSLEELNLSHNSLHSLPHDLFTPLQ--KLERVHLNHNPWVCNCDVLWLSWWLKETVPSNTTCCAR------------CHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTS-VNWITPNGTLMTHGSYRVRISVLHDGTLNFTNVTLR------DTGQYTCMVTNSAGNTTATAVLNV---TAADASVNY 445          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Cavefish
Match: lrrc4ba (leucine-rich repeat-containing protein 4B-like [Source:NCBI gene;Acc:103034410])

HSP 1 Score: 79.7221 bits (195), Expect = 5.489e-15
Identity = 105/378 (27.78%), Postives = 162/378 (42.86%), Query Frame = 1
Query:  322 KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNAL--------------------------IISNNTFLSSV-FRYL----------------IRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFEC-KPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWF-KNGILIQDHWDRIQLSQ-SSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIKIPSHKDNAIDY 1317
            + + IL LSKN IR +   A +   NL  L L  N++  + + AF+  SKL+ L LRNN +                           IS+  F+  +  RYL                +RLE L+LS N + II    F  L +LR+L+L      + I++ AF +L +L+ L+L+ N+  SLP+ L    Q  +LE + L+ NPW C+C + W   WL     +N    +             C  P YL+ K + +L  S F C  P  +     L V       L C+  +   S V W   NG L+     R+++S    G     N+T+       D G Y C  TN+ G+  +   L +   +  D +++Y
Sbjct:   93 RHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTLVPSQAFEYLSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMTV-IERNAFDDLKSLEELNLSHNSLHSLPHDLFTPLQ--KLERVHLNHNPWVCNCDVLWLSWWLKETVPSNTTCCAR------------CHAPPYLKGKYIGELDQSHFTCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTS-VNWITPNGTLMTHGSYRVRISVLHDGTLNFTNVTLR------DTGQYTCMVTNSAGNTTATAVLNV---TAADASVNY 445          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Sea Lamprey
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 81.2629 bits (199), Expect = 3.600e-16
Identity = 113/393 (28.75%), Postives = 166/393 (42.24%), Query Frame = 1
Query:  280 ENDLITFPKSNFIN-KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNAL--------------------------IISNNTFLS-SVFRYL----------------IRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIR-IQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLV-VKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQ-SSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIKIPSHKDNAIDY 1317
            EN L      +F N   + +L L++N IR +   A +   +L  L L  N++  I + AF+  SKL+ L LRNN +                           ISN  F   S  RYL                +RLE L+LS N I I+    F  L NLR+L++  M  E+R +++ AF  L +LK L+LA N+ +SLP+ L    Q  +LE + LH NPW CDC + W   WL     NN    +             C  P   +   L +L  S+F C P  + +  + V +       L C+  S   S      NG  +     +I++S    G     N+T+       D G Y C   N+VG++ ++ TL +  P    N   Y
Sbjct:   40 ENSLKMVQADSFRNLHRLEVLQLARNAIRQVEVGAFNGLTSLTTLELLDNRLTAIPSGAFEFLSKLRDLWLRNNPIEDISAYTFTRIPSLQRLDLGELTKLQFISNEAFEGLSNLRYLNLGMCNLREVPKLSPLVRLEELELSGNRIEILRPGSFQGLANLRKLWI--MHSEVRLVERNAFDELQSLKELNLAHNSLMSLPHDLFSPLQ--KLERVHLHHNPWTCDCDILWLSWWLRENVPNNATCCAR------------CALPADRKAINLWELDSSRFTCYPPLIEVPPSDVNISEGMAAELRCRAPSSASSVTWITPNGTSMTHGSYKIRISVLHDGTLNFTNVTV------QDTGIYTCLVANSVGNSTASATLNVTAPDTGTNGYTY 410          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Sea Lamprey
Match: islr2 (immunoglobulin superfamily containing leucine-rich repeat 2 [Source:ZFIN;Acc:ZDB-GENE-050320-95])

HSP 1 Score: 77.7962 bits (190), Expect = 4.870e-15
Identity = 90/356 (25.28%), Postives = 142/356 (39.89%), Query Frame = 1
Query:  274 CIENDLITFPKSNFINKDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQ-LETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHLE-----NVTLSCQFESFPKSYVKW---FKNGILIQDHWDRIQLSQSS--GRNYVANLTIFSSKYGI---------DDGCYVCETTNNVG--SARSNYTL 1275
            C    L T PK   +  +I  L LS N +R L  DA ++   + +L L  N++  I         +L+ L L NN L      F     R L  L+ L L++N +  +P   F  L +LR L L   +    I++G                            F+ +  L  LLL++NP  C C+ RW   WL T + +      + ENI        C  PD L+ + +  +P    EC   T+RL  +  V+         V L CQ +  P   V W    + G +    +D  ++ + +    N V +  + + + G          ++G Y C  TN++G  SA +  TL
Sbjct:   40 CAYKQLETVPKG--LPANITSLSLSANRLRSLSRDAFEEIPLMSSLWLSHNELVSIEKGTLAGLVQLRNLDLSNNQLA----DFSWEDLRNLTALQVLKLNNNNLVRLPRDAFETLTDLRSLRLHHNLFAT-IEEGT---------------------------FENLHALSHLLLYENPLRCSCKARWLPAWLNTTSID----IPSKENI-------ACAEPDELKGQAVQQMP--DVECVAPTVRLSSSPDVRETRLYSDFAVVLDCQADGLPAPTVSWKLRKEGGEIDLGVFDEEKVPEEAVVETNDVLDKRVMAFRNGTLVIPQLSESEEGAYTCVATNDMGESSASARITL 348          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Sea Lamprey
Match: lingo4b (leucine rich repeat and Ig domain containing 4b [Source:ZFIN;Acc:ZDB-GENE-091214-3])

HSP 1 Score: 74.7146 bits (182), Expect = 3.826e-14
Identity = 99/379 (26.12%), Postives = 148/379 (39.05%), Query Frame = 1
Query:  268 LVCIENDLITFPKSNFIN-KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLK--------YLS---------LRNNALIISN---NTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLE-EMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQ-LETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLP----LSKFECKPKTLRLGKT--LVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYG--IDDGCYVCETTNNVGSARSNYTLIIKIPSHKDNAI 1311
            L+  END++   +  F     +  L L K N+ ++  D+L     L  L L    I  I   +FK   +LK        YLS         L   +L +++    TF  +   +L+ L YL+LS NP+G+I      DL  L EL++    +  I  Q  +      +   S      L      E  FQ +  L+ L L  NP ACDCR+ W  R    LN +               H  +C TPDY+  ++L D P     + F C+   +R  +    +V    +V   CQ E  P   + W            ++ LS+S GR  V        +Y    D G Y C  TN  G+     TL ++   H    +
Sbjct:  169 LMMAENDVVYISQHAFSGLYSLEQLTLEKYNLTVVPRDSLMHLHRLKVLRLKYMNINSIPPYSFKRLVRLKILEIDHWPYLSRLPPKSLYGLNLTSLSVTHCNLTTFPHAAMHHLVYLRYLNLSHNPLGVIEAHALSDLVRLTELHVSNAQLLAIEPQAFSGLLHLRVLNTSGNLLTTLE-----ENVFQALGNLDVLRLDGNPLACDCRLLWILRRRRRLNFDG--------------HQPICATPDYVHGQELKDFPEILLPNHFTCQRARIREKEPEHYIVMEGHSVRFPCQAEGDPTPRIHWVSP-------QRKVLLSRSVGRLLVTADGSIEVRYAQTQDGGTYTCVATNAGGTDSYTVTLFVRKIEHDAGPL 521          

HSP 2 Score: 55.0694 bits (131), Expect = 5.566e-8
Identity = 46/131 (35.11%), Postives = 63/131 (48.09%), Query Frame = 1
Query:  262 FSLVCIENDLITFPKSNFINKDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNAL-IISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEE 651
            +S+VC    L+T P    I  D  +LDLSKN ++ +       +  L  L L  N I  I   AF N   L  + L++N L +IS       VF  L  L  LD+S N I I+ +  F +L NLR L + E
Sbjct:   50 WSVVCHRKRLLTIPDG--IPIDTRVLDLSKNRLKCINYGDFSGYPQLQELDLHENVISNIEPGAFNNLHHLHTIHLQSNRLKLIS-----MGVFAGLQNLTQLDISENKIVILLDYMFHNLHNLRWLMMAE 173          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010345.1 (pep scaffold:Pmarinus_7.0:GL477728:405586:411287:1 gene:ENSPMAG00000009370.1 transcript:ENSPMAT00000010345.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 1.075e-12
Identity = 60/199 (30.15%), Postives = 91/199 (45.73%), Query Frame = 1
Query:  268 LVCIENDLITFPKSNFIN-KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQ-LETLLLHDNPWACDCRMRWFKRWLIT 858
            L+  +N +++F  S F    +++ LD+  NNI  L   A     +L+ L L  NKI +I+  AF     L YL+L NN +     T      + L  LE L L++N I  +  S F  L NLRELY    M  +  +    SN+   +L        +         F  +  L+ + LH NP+ CDC++    +WL T
Sbjct:  136 LILGKNSILSFTSSTFQGLSELSDLDMPMNNITSLPALAFQHTPSLVILDLAYNKIQQISPKAFVGLKNLDYLNLDNNKI----TTIAPGTLQSLQNLEMLVLNNNNIKRVTSSTFKGLTNLRELYFSNNMVSVLTKDAFNSNIKLTQLTISDNKIKVIEAG----TFSTLSGLQMIYLHGNPYHCDCKLNPLVQWLAT 326          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Sea Lamprey
Match: lrfn5a (leucine rich repeat and fibronectin type III domain containing 5a [Source:ZFIN;Acc:ZDB-GENE-080327-17])

HSP 1 Score: 67.781 bits (164), Expect = 6.228e-12
Identity = 88/348 (25.29%), Postives = 150/348 (43.10%), Query Frame = 1
Query:  253 RKQFSLVCIENDLITFPKSNFINKDIAI-LDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQL---------ETLLLH--DNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTL-RLGKTLVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSA 1257
            R+   L   +N + +  + +F N  + + L LS+N I  +   A  D  +L  L  D N++  I N +FK  S L++L + NN L   ++  + +   +L+ LE LDL+ N +  +P      + +L  L L+  M +  I+ G FS+L  L  L +  N    LP   +  F  +QL           L+L+   NP  C+C + W +R    L + +D     +E          C +P  L  K    +P  +F C+P  + R    L+V   +  TL C+    P  +V W      +  +  R  +      N    + + ++K   DDG + C  +N  G +
Sbjct:   51 RRTVELRLGDNFITSVRRQDFGNMTLMVDLTLSRNTISQIAPYAFADLSSLTFLHFDYNRLTHIGNKSFKGLSNLRHLIISNNQL---SDISVGAFDDFLMSLEDLDLAYNNLEKVPWEAIQKMTSLHTLSLDHNMIDY-IEAGTFSHLHKLARLDMTSNKLQKLPP--DPLFTRLQLFANKGIHHTPPLVLNFGGNPLHCNCELLWLRR----LTREDD-----LET---------CASPQALVGKYFWSIPEEEFVCEPPLITRHTHRLLVLEGQRATLKCKAIGDPDPWVHWISPDEKVISNTTRTVVHD----NGTLEILVTTTK---DDGTFTCIASNPAGES 367          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Nematostella
Match: EDO49554 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL8])

HSP 1 Score: 52.373 bits (124), Expect = 6.400e-7
Identity = 44/156 (28.21%), Postives = 79/156 (50.64%), Query Frame = 1
Query:  826 RMRWFKRWLITLNQNNDHLYSTI--ENILLNIHPMLC-ETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIK 1284
            R++   R+ I+ ++ ND +YS +  E    +  P  C  + D  +   L +L +++   +P+  +  K + VKH E  T S + +  PK  V W+K+G ++++  + IQL +S G  Y   +   + +   D G Y+CE TN  G A   + + IK
Sbjct:  415 RIKDGGRFTISESEEND-MYSLVIDEARTEDSGPYKCVASNDAGKTTALLNLDVNEKVVQPEFDKEVKPIEVKHGEEATTSLEIKGKPKPKVTWYKDGKVLRESKN-IQL-KSIGDTYSIRIVRTAPE---DVGTYMCEATNKAGLASRKFDITIK 564          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Nematostella
Match: EDO35407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLJ8])

HSP 1 Score: 51.2174 bits (121), Expect = 6.605e-7
Identity = 34/103 (33.01%), Postives = 58/103 (56.31%), Query Frame = 1
Query:  343 LSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEE 651
            +S++ +++L   +  D++ L  L L +N I  I +  F+N   LK L+L  N +     T  +S+F+ L+ LE LDL  N +  +P   F  L++LREL+L +
Sbjct:    1 VSRSPLKLLKNTSFQDYQYLKWLDLSNNDISDIQDGTFENLRYLKQLNLGENKI----RTVSASMFKGLVSLEKLDLRFNDLKALPRGVFKPLKSLRELFLHD 99          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Nematostella
Match: EDO47109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNB0])

HSP 1 Score: 49.2914 bits (116), Expect = 5.310e-6
Identity = 38/113 (33.63%), Postives = 56/113 (49.56%), Query Frame = 1
Query:  274 CIENDLITFPKSNFINKDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFF 612
            C    L T P S  + +++  L L+ N+IR L   A  ++ +L  L L +N++  I N  FK+  KLK L+L +N L +      +  FR L  L YL L  N I  I +  F
Sbjct:   58 CSNATLQTIPTS--LPRNLGSLFLNTNHIRALQAKAFANYLSLRVLDLSNNELSVIANGTFKSLGKLKTLTLNSNRLEV----VYAETFRGLRDLRYLSLRHNSIRTIGDGAF 164          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Nematostella
Match: EDO49555 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL9])

HSP 1 Score: 44.2838 bits (103), Expect = 7.376e-6
Identity = 26/87 (29.89%), Postives = 45/87 (51.72%), Query Frame = 1
Query: 1024 LVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIK 1284
            +VV+  E++ +  Q  + PK  VKW+K+G  ++D       +    R+ + N  + S+K   D G Y CE TN VG A   + + ++
Sbjct:    1 IVVRQGEDIDIGAQITAKPKPNVKWYKDGKPLRDG----PRTTIRARDDLYNCKVLSAKPE-DTGMYKCEATNAVGKATRTFDVQVE 82          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Medaka
Match: lingo4b (leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 [Source:NCBI gene;Acc:101164675])

HSP 1 Score: 86.6557 bits (213), Expect = 3.668e-17
Identity = 98/371 (26.42%), Postives = 162/371 (43.67%), Query Frame = 1
Query:  280 ENDLITFPKSNFIN-KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRN---------NALIISNNTFLS-----------SVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQ-LETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLP----LSKFECKPKTL--RLGKTLVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYG--IDDGCYVCETTNNVGSARSNYTLIIK-IPSHK 1299
            ENDL+   +  F   +++  L+L ++N+  +  +AL   ++L  + +    I  + NNAF+   +L+ L + N         N+LI  N T L+           +  R+L+ L +LDLS NPI +I  +   DL  L+EL+L      +RI+ GAF  L   ++L++  N   +L    E  F  +  L+ L L  NP ACDCR+ W  R    LN +               H   C +PD +Q+++  D      +  F C+P  +  R  +   V+    V  SC+ +  P   + W      I  H + +     +GR  V        ++    D G Y C   N  G+   +  L +K +P +K
Sbjct:  162 ENDLVFISQRAFFGLQNLQELNLDRSNLTSIPTEALTQLQSLTVIRMFRLTISSLPNNAFRRLPRLRTLQILNWPALDTIASNSLIGLNLTSLTISSCNLTAVPYAALRHLVYLRFLDLSYNPITVIQGNLLGDLLRLQELHLAG-ASLLRIEPGAFKGLSFFRMLNVTSNMLTTLE---ESAFHSVGNLQVLRLDGNPLACDCRLLWVMRRRQRLNFDG--------------HQPTCSSPDAVQQREFRDFSEKELVRLFTCRPARIMDRRPQEARVEEGTTVLFSCKADGDPFPTITW------ISSHKNTV---SPTGRIRVLPNGTLEVRFAQVQDSGTYQCLAVNAAGNDSMSVGLYVKGVPRNK 505          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Medaka
Match: lingo4b (leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 [Source:NCBI gene;Acc:101164675])

HSP 1 Score: 86.6557 bits (213), Expect = 3.668e-17
Identity = 98/371 (26.42%), Postives = 162/371 (43.67%), Query Frame = 1
Query:  280 ENDLITFPKSNFIN-KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRN---------NALIISNNTFLS-----------SVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQ-LETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLP----LSKFECKPKTL--RLGKTLVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYG--IDDGCYVCETTNNVGSARSNYTLIIK-IPSHK 1299
            ENDL+   +  F   +++  L+L ++N+  +  +AL   ++L  + +    I  + NNAF+   +L+ L + N         N+LI  N T L+           +  R+L+ L +LDLS NPI +I  +   DL  L+EL+L      +RI+ GAF  L   ++L++  N   +L    E  F  +  L+ L L  NP ACDCR+ W  R    LN +               H   C +PD +Q+++  D      +  F C+P  +  R  +   V+    V  SC+ +  P   + W      I  H + +     +GR  V        ++    D G Y C   N  G+   +  L +K +P +K
Sbjct:  162 ENDLVFISQRAFFGLQNLQELNLDRSNLTSIPTEALTQLQSLTVIRMFRLTISSLPNNAFRRLPRLRTLQILNWPALDTIASNSLIGLNLTSLTISSCNLTAVPYAALRHLVYLRFLDLSYNPITVIQGNLLGDLLRLQELHLAG-ASLLRIEPGAFKGLSFFRMLNVTSNMLTTLE---ESAFHSVGNLQVLRLDGNPLACDCRLLWVMRRRQRLNFDG--------------HQPTCSSPDAVQQREFRDFSEKELVRLFTCRPARIMDRRPQEARVEEGTTVLFSCKADGDPFPTITW------ISSHKNTV---SPTGRIRVLPNGTLEVRFAQVQDSGTYQCLAVNAAGNDSMSVGLYVKGVPRNK 505          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Medaka
Match: lrrc24 (leucine-rich repeat-containing protein 24 [Source:NCBI gene;Acc:101166166])

HSP 1 Score: 80.8777 bits (198), Expect = 2.143e-15
Identity = 65/251 (25.90%), Postives = 115/251 (45.82%), Query Frame = 1
Query:  358 IRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKT-LVVKHLENVTLSCQFESFPKSYVKWFKN 1107
            ++I  +D L   E+L  L L +N I  +   AF N+ +L  L+L  N +    +     +F+ L  L  L L+ N I  I +  F  L+ L+EL+L+E   E+  +           L     +      ++L+     + L+ L + +NPW CDC + W + W   ++++   L S+ E   L     +C  P  L    L ++  +   C P  ++L  + L V+  E++ +SCQ   +P+  V W K+
Sbjct:   64 VQIRLQD-LTGLESLHYLYLQNNSISALEPGAFLNQGQLLELALNGNLI----HLVTPDMFQGLEHLRILYLAGNQITRIQDHTFRGLQRLQELHLQENSIELLAEHALSGLSSLALLDLSKNHLRTLGASFLK---PLVSLQVLRVTENPWRCDCALAWLRTW---ISEDGQRLLSSAEQRRL-----MCSEPPRLSHLSLAEVAPNSLVCIPPVVQLEPSHLTVRLGESLRVSCQASGYPQPLVTWKKS 298          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Medaka
Match: lrrc24 (leucine-rich repeat-containing protein 24 [Source:NCBI gene;Acc:101166166])

HSP 1 Score: 80.4925 bits (197), Expect = 2.838e-15
Identity = 65/251 (25.90%), Postives = 115/251 (45.82%), Query Frame = 1
Query:  358 IRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKT-LVVKHLENVTLSCQFESFPKSYVKWFKN 1107
            ++I  +D L   E+L  L L +N I  +   AF N+ +L  L+L  N +    +     +F+ L  L  L L+ N I  I +  F  L+ L+EL+L+E   E+  +           L     +      ++L+     + L+ L + +NPW CDC + W + W   ++++   L S+ E   L     +C  P  L    L ++  +   C P  ++L  + L V+  E++ +SCQ   +P+  V W K+
Sbjct:   64 VQIRLQD-LTGLESLHYLYLQNNSISALEPGAFLNQGQLLELALNGNLI----HLVTPDMFQGLEHLRILYLAGNQITRIQDHTFRGLQRLQELHLQENSIELLAEHALSGLSSLALLDLSKNHLRTLGASFLK---PLVSLQVLRVTENPWRCDCALAWLRTW---ISEDGQRLLSSAEQRRL-----MCSEPPRLSHLSLAEVAPNSLVCIPPVVQLEPSHLTVRLGESLRVSCQASGYPQPLVTWKKS 298          
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Medaka
Match: lrrc4bb (leucine-rich repeat-containing protein 4B [Source:NCBI gene;Acc:101159140])

HSP 1 Score: 80.4925 bits (197), Expect = 3.346e-15
Identity = 103/369 (27.91%), Postives = 156/369 (42.28%), Query Frame = 1
Query:  322 KDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNAL--------------------------IISNNTFLSSV-FRYL----------------IRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFEC-KPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWF-KNGILIQDHWDRIQLSQ-SSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIKIP 1290
            + + IL LSKN+IR +   A +   NL  L L  N++  + + AF+  SKL+ L LRNN +                           IS   F   V  R+L                ++LE L+LS N +GI+    F  L +LR+L+L      + I++ AF  L +L+ L+L+ N+  SLP+ L       QLE + L+ NPW C+C + W   WL     +N    +             C  P  L+ K + +L  S F C  P  +     L V       L C+  +   S V WF  NG L+     R+++S    G     N+T+       D G Y C  TN+ G+  ++  L +  P
Sbjct:   92 RHLEILQLSKNHIRQIEVGAFNGLPNLNTLELFDNRLTVVPSQAFEYLSKLRELWLRNNPIETLGAFAFHRVPSLRRLDLGELRKLDFISEAAFEGLVNLRFLNLGMCGLKDIPNLTPLVKLEELELSGNQLGIVRPGSFQGLVSLRKLWLMHSRVSV-IERNAFDELKSLEELNLSHNSLHSLPHDLFTPLH--QLERVHLNHNPWVCNCDVLWLSWWLKETVPSNTTCCAR------------CHAPPGLKGKYIGELDQSHFPCYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTS-VNWFTPNGTLMTHGSYRVRISVLHDGTLNFTNVTVQ------DTGQYTCMVTNSAGNTTASAVLNVSAP 438          
BLAST of Leucine Rich repeat-containing domain protein vs. Planmine SMEST
Match: SMESG000006503.1 (SMESG000006503.1)

HSP 1 Score: 1170.61 bits (3027), Expect = 0.000e+0
Identity = 623/625 (99.68%), Postives = 625/625 (100.00%), Query Frame = 1
Query:  187 MKFLFLMEFSLILKGYFLFDCVRKQFSLVCIENDLITFPKSNFINKDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIKIPSHKDNAIDYKKQQXXXXXXXVASXXXXXXXXXXXXXYCFYGNSLTNENKFKILKKSDLLYVNDKVLMTCNSDIISTSPLLQIISKTDEHNGFLKWNNHVPIDAKDSDEKKLIIDSFENQVESNENPIVKNFMVNESIFSNHTSDSDNHSCQLSIHEDCPIHGTGNSYSCPIHDSENETIVLENQSYNWSYVFNNKNTITNNYYSLKSAFNNKNGRSNINPMTDSYSMNIKKSEIDKIDCGIPIEKVSSQLSFNIDQI 2061
            MKFLFLMEFSLILKGYFLFDC+RKQFSLVCIENDLITFPKSNFINKDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGAFSNLFNLKLLSLAKNNFLSLPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNND+LYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIKIPSHKDNAIDYKKQQIILLLIIVASGIITLIILVGIVIYCFYGNSLTNENKFKILKKSDLLYVNDKVLMTCNSDIISTSPLLQIISKTDEHNGFLKWNNHVPIDAKDSDEKKLIIDSFENQVESNENPIVKNFMVNESIFSNHTSDSDNHSCQLSIHEDCPIHGTGNSYSCPIHDSENETIVLENQSYNWSYVFNNKNTITNNYYSLKSAFNNKNGRSNINPMTDSYSMNIKKSEIDKIDCGIPIEKVSSQLSFNIDQI
Sbjct:    1 MKFLFLMEFSLILKGYFLFDCIRKQFSLVCIENDLITFPKSNFINKDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGAFSNLFNLKLLSLAKNNFLSLPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDYLYSTIENILLNIHPMLCETPDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIKIPSHKDNAIDYKKQQIILLLIIVASGIITLIILVGIVIYCFYGNSLTNENKFKILKKSDLLYVNDKVLMTCNSDIISTSPLLQIISKTDEHNGFLKWNNHVPIDAKDSDEKKLIIDSFENQVESNENPIVKNFMVNESIFSNHTSDSDNHSCQLSIHEDCPIHGTGNSYSCPIHDSENETIVLENQSYNWSYVFNNKNTITNNYYSLKSAFNNKNGRSNINPMTDSYSMNIKKSEIDKIDCGIPIEKVSSQLSFNIDQI 625          
BLAST of Leucine Rich repeat-containing domain protein vs. Planmine SMEST
Match: SMESG000006317.1 (SMESG000006317.1)

HSP 1 Score: 147.902 bits (372), Expect = 6.749e-37
Identity = 122/384 (31.77%), Postives = 201/384 (52.34%), Query Frame = 1
Query:  328 IAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYS---TIEN--ILLNIHPMLCETPDYLQRKKLC-------DLPLSKFECKPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIKIPSHKDNAIDYKKQQXXXXXXXVASXXXXXXXXXXXXXYCFYGNSLTNENKFK 1443
            +A + +   N+ ++    L +  NL+NLTL+SNKI K++ NAF +  +L  L L  N + +  N+  SS   YL +L  LDLS NP+G +P+ +F  L+ LR L L    K   I+      L NL++L L  N+F +L   L    + MQL    L +NPW CDC ++W K W  +         S   TI    I+ ++ P  CE+P  L  + +         + ++  +C P+     +   +    N+T +C+F + P   V W KNG+++Q+HW R+  ++S G  + A LT+ + +   D G + C  T +V  ++ N T ++K+ S + N ID+K   I+  + I A  +I L++++GI+IYC YG  + N  + K
Sbjct:   65 VAEIIIENQNLSVIDSAQLKNLPNLVNLTLNSNKITKLSPNAFTHVPQLISLRLSGNQIYLGENSMPSSSLIYLKKLHTLDLSENPLGFVPDYYFQLLKQLRILNLSTANKGFYIETNGLYGLTNLQVLDLTNNHFTTLSEGLSISLKAMQLNEFYLFNNPWNCDCNLQWLKAWFTSHKVKYTKDLSKDITINGGKIIEDLQPK-CESPFPLSERNIFSDSTNTDSIGINDLKCAPRIFTQDRVYEMTKDHNITFTCEFHANPGGTVTWSKNGMIVQNHWRRVSWNRSQGIKFKAWLTLQNVEEN-DSGNWRCILTTHV--SKVNATFLLKVISPQ-NIIDFKS--ILKYVGIGAVTLILLLVVIGIIIYCVYGFQIQNNRRPK 441          
BLAST of Leucine Rich repeat-containing domain protein vs. Planmine SMEST
Match: SMESG000058478.1 (SMESG000058478.1)

HSP 1 Score: 145.591 bits (366), Expect = 7.047e-36
Identity = 108/372 (29.03%), Postives = 175/372 (47.04%), Query Frame = 1
Query:  247 CVRKQFSLVCIENDLITFPKSNFINKDIAILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLY-----STIENILLNIHPMLCETPDYLQRKKLCD-------LPLSKFECKPKTLRLGKTLVVKHLENVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIK--IPSHKDNAIDYK 1320
            C R +     I +DL  F         +  L++   NI  L  D L     L +L LDSNK+  I  +AF N  KLK LSL++N LI+  N+F S+    L  L+ LDL +NP+G +P+ FF  L+ L +L L        ++  +   L +L+ L ++ ++  +L   +      MQL       N W CDC ++W K+W   L   +  ++     S  ++ LL      C +P   Q   + +       +   +  C PK     + + +   +N+TL C+FE+ P   V+W KNG+ +Q HW + +  Q+SG  + A L+I  +    D+G + C    +  SA + Y+L ++   P H D  I  K
Sbjct:   44 CSRLETKFTRIPHDLPDF---------VETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAALLQLKHLKVLDLDNNPLGFVPDFFFQPLKFLTKLILSRATNGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFGNQWTCDCNLKWLKKW--GLKHKDVRIFKKFSRSNGQSALLQPQ---CFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIFTKNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLE-DNGLWRCILITDTQSANATYSLRVRPSFPPHIDLTIILK 400          
BLAST of Leucine Rich repeat-containing domain protein vs. Planmine SMEST
Match: SMESG000023338.1 (SMESG000023338.1)

HSP 1 Score: 112.464 bits (280), Expect = 3.161e-25
Identity = 102/325 (31.38%), Postives = 169/325 (52.00%), Query Frame = 1
Query:  334 ILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEM-MKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEMQ-LETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKL---CDLPLSK---FECKPKTLRLGKTLVVKHLE-NVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLII 1281
            +L +++ NI ++ E+   +   L  L+L  + + +I  NAFKN S L  L L  N LI+++++  S +   L+ L++L L++NP+ +IP+ FF  L +LR+L L +     +RI   AF  L +L+ L L  +   ++   +E +F+EM+ L  LLL +NPW CDC +RW  R+L  + +     + T++  L N     C+ P  L+  ++    D   SK   F C  K  R+    VV   E ++ L+C+  S P   V W KNG  +++  ++ Q+  S   N+ + L I S K  +D G + C     V     N+TL I
Sbjct:   63 MLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQE-----FITLQ--LDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIWTKNGYKVEETVNKFQIFNSGNENFYSTLHIRSLK-SVDSGSWSCR----VDDVFQNFTLKI 375          
BLAST of Leucine Rich repeat-containing domain protein vs. Planmine SMEST
Match: SMESG000075643.1 (SMESG000075643.1)

HSP 1 Score: 105.916 bits (263), Expect = 1.739e-23
Identity = 109/366 (29.78%), Postives = 178/366 (48.63%), Query Frame = 1
Query:  271 VCIENDLITFPKSNF--INKDIAI----LDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISN-NTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDL-RNLRELYLEEMMKEIRIQKGXXXXXXXXXXXXXXXXXXXXXPNYLEYEFQEM-QLETLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCETPDYLQRKKL---CDLPLS--KFECKPKTLRLGKTLVVKHLENVTLSCQFESFPK-SYVKWFKNGILIQDHWDRIQLSQSSGRNY-VANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLIIKIPSHKDNAIDYK 1320
            V I ND    P +N   I KD+++    L++   N+  L  +       L  LTL+S  +  I+  AF++ S+L  L+L NN+L+I + N   S +F+ LI L  LDLS N I +IP+ FF  L ++L+ L +        I   + S+L  L+ L ++ NN + L +  E  F +M  L+ L+LH NPW CDC++RW   W       +    S+  + L +    LC +P  +    L     +P+   +F C PK L       V   ENV+L C F+S  + + +KW  NG L++ +     +   + R+  V  L  F+ K      CY+    N +G   +N++++ +  S+ D    +K
Sbjct:   43 VAICND----PSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSGFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGSFPAESSPSS-LSHFQSALCHSPRSMHNAILLRSISIPIKSHEFPCFPKCLSKNSDFFVGEGENVSLPCSFQSLDQYTRIKWSHNGTLLKSNSRNYVIKSDTKRHRSVLTLIHFTIKLSGLWRCYILFDDNIIG---TNFSVLFRWSSNNDKQYHFK 400          
The following BLAST results are available for this feature:
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRIT22.145e-2023.77leucine rich repeat, Ig-like and transmembrane dom... [more]
LRIT22.054e-1923.68leucine rich repeat, Ig-like and transmembrane dom... [more]
LRRC245.678e-1623.82leucine rich repeat containing 24 [Source:HGNC Sym... [more]
LRFN51.327e-1427.22leucine rich repeat and fibronectin type III domai... [more]
LRFN51.333e-1427.22leucine rich repeat and fibronectin type III domai... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lron-21.813e-729.63ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
lron-21.813e-729.63ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kek11.392e-2125.43gene:FBgn0015399 transcript:FBtr0346702[more]
kek11.392e-2125.43gene:FBgn0015399 transcript:FBtr0332210[more]
kek36.095e-1524.23gene:FBgn0028370 transcript:FBtr0300848[more]
kek36.095e-1524.23gene:FBgn0028370 transcript:FBtr0080752[more]
kek51.775e-1322.29gene:FBgn0031016 transcript:FBtr0074707[more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc241.697e-1627.65leucine rich repeat containing 24 [Source:ZFIN;Acc... [more]
lrrc4ba6.513e-1528.57leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
lrrc4ba6.513e-1528.57leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
lrrc4ba8.386e-1528.57leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
lrrc4ba8.386e-1528.57leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000026364.17.152e-1527.65leucine rich repeat and Ig domain containing 3 [So... [more]
LRRC4C1.224e-1226.78leucine rich repeat containing 4C [Source:NCBI gen... [more]
LINGO25.823e-1228.02leucine rich repeat and Ig domain containing 2 [So... [more]
LRIG21.023e-1127.38leucine-rich repeats and immunoglobulin like domai... [more]
LRIG21.190e-1127.38leucine-rich repeats and immunoglobulin like domai... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrfn53.312e-1427.17leucine rich repeat and fibronectin type III domai... [more]
Lrfn53.793e-1427.17leucine rich repeat and fibronectin type III domai... [more]
Lrrc4c1.330e-1327.47leucine rich repeat containing 4C [Source:MGI Symb... [more]
Lrrc4c1.330e-1327.47leucine rich repeat containing 4C [Source:MGI Symb... [more]
Lrrc4c1.330e-1327.47leucine rich repeat containing 4C [Source:MGI Symb... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6NDA9|LRIT2_HUMAN9.862e-1923.68Leucine-rich repeat, immunoglobulin-like domain an... [more]
sp|Q50LG9|LRC24_HUMAN2.727e-1523.82Leucine-rich repeat-containing protein 24 OS=Homo ... [more]
sp|Q96NI6|LRFN5_HUMAN2.608e-1327.22Leucine-rich repeat and fibronectin type-III domai... [more]
sp|Q8BXA0|LRFN5_MOUSE2.653e-1327.17Leucine-rich repeat and fibronectin type-III domai... [more]
sp|D4A1J9|LRFN5_RAT2.942e-1327.17Leucine-rich repeat and fibronectin type-III domai... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504Y3D36.444e-3835.98Putative slit OS=Fasciola gigantica OX=46835 GN=FG... [more]
A0A2H1CU836.811e-3835.59Leucine Rich repeat-containing domain protein OS=F... [more]
A0A4E0RKD67.648e-3835.59Putative slit OS=Fasciola hepatica OX=6192 GN=D915... [more]
A0A3P6TYJ91.704e-3734.28Ig-like domain-containing protein OS=Dibothrioceph... [more]
A0A0R3SAJ94.276e-3733.33Ig-like domain-containing protein OS=Hymenolepis d... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrit22.321e-1525.34leucine-rich repeat, immunoglobulin-like domain an... [more]
lrrc4ba3.014e-1527.78leucine-rich repeat-containing protein 4B-like [So... [more]
LRIT24.311e-1525.52leucine rich repeat, Ig-like and transmembrane dom... [more]
lrrc4ba5.489e-1527.78leucine-rich repeat-containing protein 4B-like [So... [more]
lrrc4ba5.489e-1527.78leucine-rich repeat-containing protein 4B-like [So... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc4ba3.600e-1628.75leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
islr24.870e-1525.28immunoglobulin superfamily containing leucine-rich... [more]
lingo4b3.826e-1426.12leucine rich repeat and Ig domain containing 4b [S... [more]
ENSPMAT00000010345.11.075e-1230.15pep scaffold:Pmarinus_7.0:GL477728:405586:411287:1... [more]
lrfn5a6.228e-1225.29leucine rich repeat and fibronectin type III domai... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO495546.400e-728.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354076.605e-733.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471095.310e-633.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495557.376e-629.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lingo4b3.668e-1726.42leucine-rich repeat and immunoglobulin-like domain... [more]
lingo4b3.668e-1726.42leucine-rich repeat and immunoglobulin-like domain... [more]
lrrc242.143e-1525.90leucine-rich repeat-containing protein 24 [Source:... [more]
lrrc242.838e-1525.90leucine-rich repeat-containing protein 24 [Source:... [more]
lrrc4bb3.346e-1527.91leucine-rich repeat-containing protein 4B [Source:... [more]
back to top
BLAST of Leucine Rich repeat-containing domain protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006503.10.000e+099.68SMESG000006503.1[more]
SMESG000006317.16.749e-3731.77SMESG000006317.1[more]
SMESG000058478.17.047e-3629.03SMESG000058478.1[more]
SMESG000023338.13.161e-2531.38SMESG000023338.1[more]
SMESG000075643.11.739e-2329.78SMESG000075643.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021280 ID=SMED30021280|Name=Leucine Rich repeat-containing domain protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2323bp
ATCCCTTTAAAATATGATTAAATAGAATGGTACGTTTGATAAATTTTTTG
TCTATCATATATTAATATTAAAAGATACATAATTTCTAAATCTCAAATAT
AATTGATTGGTTATTTTTCATTTCCTGCTCAATTTAATTAAAAGTCAGAA
AATTTTGTTTCCATGTAACAGTATCAGTTCTCTACAATGAAATTTCTATT
TTTAATGGAGTTTTCATTAATTTTAAAGGGATATTTCTTATTCGACTGTG
TACGCAAACAATTTTCTCTTGTTTGTATTGAAAATGATTTAATAACATTT
CCGAAATCGAATTTCATTAACAAAGATATTGCAATATTGGATTTGTCGAA
GAACAATATCCGAATTCTCTATGAAGATGCTTTGGACGATTTTGAAAATT
TAATAAATCTAACTCTCGATTCAAACAAAATTTGGAAAATTACAAATAAT
GCTTTTAAAAATAAATCTAAACTGAAATATCTCTCGTTACGAAATAATGC
CTTAATAATCAGTAATAATACATTTTTGTCAAGTGTTTTCCGTTATTTGA
TACGATTGGAATATTTGGATTTATCAAGCAACCCAATTGGTATTATTCCC
GAAAGCTTTTTTTTGGATTTACGAAATTTAAGAGAACTGTATTTGGAAGA
AATGATGAAAGAAATAAGAATCCAAAAAGGAGCTTTTTCAAATCTATTCA
ATCTAAAGTTACTATCGTTGGCTAAAAATAATTTTCTATCACTTCCTAAT
TATTTAGAATATGAATTTCAAGAAATGCAACTGGAAACATTGTTGCTGCA
TGACAATCCTTGGGCATGCGACTGTCGTATGAGGTGGTTCAAACGCTGGC
TTATTACATTGAACCAGAACAATGATCATTTATACTCGACAATAGAAAAT
ATTTTACTAAATATCCATCCTATGCTTTGTGAAACTCCAGACTATTTACA
AAGAAAAAAATTATGCGATCTGCCTCTGAGTAAATTTGAATGCAAACCTA
AAACTCTTAGACTAGGCAAAACTCTAGTCGTTAAACATCTGGAAAATGTC
ACTTTATCTTGCCAGTTTGAAAGTTTCCCAAAATCCTATGTTAAGTGGTT
CAAAAATGGAATTCTAATTCAAGACCACTGGGATCGAATACAGTTAAGTC
AGAGTAGTGGACGCAATTACGTTGCAAATTTAACTATTTTTAGTTCAAAA
TATGGTATAGATGACGGCTGTTACGTTTGTGAAACAACAAACAATGTCGG
TTCAGCGAGATCAAATTACACTTTAATCATCAAAATACCTTCTCATAAAG
ATAATGCAATTGACTACAAAAAACAGCAAATAATTCTCCTGTTGATTATA
GTCGCTAGTGGAATAATAACTCTTATTATACTAGTTGGAATTGTAATCTA
TTGTTTCTATGGCAACAGTTTGACTAATGAAAATAAATTTAAAATTCTAA
AGAAATCTGATTTATTGTATGTTAACGACAAAGTCTTAATGACTTGCAAT
TCCGATATCATTTCAACATCTCCTTTGTTGCAAATTATTTCTAAAACTGA
TGAACATAATGGATTTTTGAAATGGAATAATCACGTGCCCATTGATGCTA
AAGATAGTGATGAAAAGAAATTAATTATCGATTCATTTGAAAATCAAGTT
GAAAGTAATGAAAATCCGATTGTGAAAAATTTTATGGTAAATGAAAGCAT
ATTTTCAAATCATACTTCGGATTCCGATAACCATTCATGTCAGCTCTCTA
TTCACGAAGACTGCCCAATACATGGAACCGGAAACTCGTACAGTTGTCCC
ATTCATGATTCAGAAAATGAAACAATTGTATTGGAAAATCAATCCTATAA
TTGGAGTTATGTTTTTAATAATAAAAATACTATTACGAATAATTATTACT
CTTTAAAATCAGCTTTTAATAATAAAAATGGCCGTAGTAACATCAATCCA
ATGACAGATTCTTATTCTATGAATATTAAAAAGTCAGAAATTGATAAGAT
TGATTGTGGAATTCCTATTGAAAAGGTTTCTAGTCAGCTATCATTCAATA
TTGACCAAATCTAATGTTTAATTTTGTTATCATTATTATTACCTTTTTTC
AATTATTGTATAAGAATTATTGCATGTATTTCTTTTATGATTTATAAATG
TTTAACGAATTCATTTTTGCAACAAATGAGGTATTTGTTACCAAGATGGT
TCTATGTTAAGAGAGTGCCAAGCCAAAGACTGCAGAATGGCTGCAAAAAT
GATAAAAACCTAGAAAATGTAAAACTTTTTTAATAATGAAGAAGTCAGTT
TATTTCCTATAATGATCCAAGAG
back to top

protein sequence of SMED30021280-orf-1

>SMED30021280-orf-1 ID=SMED30021280-orf-1|Name=SMED30021280-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=626bp
MKFLFLMEFSLILKGYFLFDCVRKQFSLVCIENDLITFPKSNFINKDIAI
LDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLS
LRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRE
LYLEEMMKEIRIQKGAFSNLFNLKLLSLAKNNFLSLPNYLEYEFQEMQLE
TLLLHDNPWACDCRMRWFKRWLITLNQNNDHLYSTIENILLNIHPMLCET
PDYLQRKKLCDLPLSKFECKPKTLRLGKTLVVKHLENVTLSCQFESFPKS
YVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCET
TNNVGSARSNYTLIIKIPSHKDNAIDYKKQQIILLLIIVASGIITLIILV
GIVIYCFYGNSLTNENKFKILKKSDLLYVNDKVLMTCNSDIISTSPLLQI
ISKTDEHNGFLKWNNHVPIDAKDSDEKKLIIDSFENQVESNENPIVKNFM
VNESIFSNHTSDSDNHSCQLSIHEDCPIHGTGNSYSCPIHDSENETIVLE
NQSYNWSYVFNNKNTITNNYYSLKSAFNNKNGRSNINPMTDSYSMNIKKS
EIDKIDCGIPIEKVSSQLSFNIDQI*
back to top
Aliases
The feature 'Leucine Rich repeat-containing domain protein' has the following synonyms
Synonym
Smed_22239
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003599Ig_sub
IPR003598Ig_sub2
IPR003591Leu-rich_rpt_typical-subtyp
IPR000483Cys-rich_flank_reg_C
IPR013783Ig-like_fold
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
IPR013098Ig_I-set
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 283..355
e-value: 0.0026
score: 27.0
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 277..366
e-value: 9.7E-4
score: 28.4
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 170..193
e-value: 83.0
score: 5.7
coord: 121..144
e-value: 1.3
score: 18.0
coord: 69..92
e-value: 11.0
score: 12.9
IPR000483Cysteine-rich flanking region, C-terminalSMARTSM00082lrrct1coord: 207..270
e-value: 1.5E-7
score: 41.1
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 269..370
e-value: 1.1E-14
score: 56.3
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 278..365
e-value: 1.5E-7
score: 31.3
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 161..268
e-value: 1.6E-17
score: 65.3
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 19..160
e-value: 3.4E-21
score: 77.1
NoneNo IPR availablePANTHERPTHR45842FAMILY NOT NAMEDcoord: 48..371
NoneNo IPR availablePANTHERPTHR45842:SF12INSULIN LIKE GROWTH FACTOR BINDING PROTEIN ACID LABILE SUBUNITcoord: 48..371
NoneNo IPR availableCDDcd00096Igcoord: 288..362
e-value: 8.70897E-9
score: 50.3184
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..15
score: 0.504
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 19..273
NoneNo IPR availableTMHMMTMhelixcoord: 387..409
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 172..193
score: 6.719
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 47..68
score: 4.693
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 123..144
score: 8.02
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 95..115
score: 6.203
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 71..92
score: 6.857
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 271..364
score: 10.698
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 270..368