ANK_REP_REGION domain-containing protein

Overview
NameANK_REP_REGION domain-containing protein
Smed IDSMED30021270
Length (bp)1971
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ANK_REP_REGION domain-containing protein (SMED30021270) t-SNE clustered cells

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30021270) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ANK_REP_REGION domain-containing protein (SMED30021270) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ANK_REP_REGION domain-containing protein (SMED30021270) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021270

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30021270SMESG000057916.1 SMESG000057915.1 dd_Smed_v4_15179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30021270SMESG000057916.1 SMESG000057915.1 dd_Smed_v4_15179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30021270SMESG000057916.1 SMESG000057915.1 dd_Smed_v4_15179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30021270SMESG000057916.1 SMESG000057915.1 dd_Smed_v4_15179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021270SMESG000057916.1 SMESG000057915.1 dd_Smed_v4_15179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30021270SMESG000057916.1 SMESG000057915.1 dd_Smed_v4_15179_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30021270SMESG000057916.1 SMESG000057915.1 dd_Smed_v6_15179_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30021270SMESG000057916.1 SMESG000057915.1 Contig11205newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30021270SMESG000057916.1 SMESG000057915.1 Contig11205uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30021270SMESG000057916.1 SMESG000057915.1 dd_Smed_v4_15179_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: IQANK1 (IQ motif and ankyrin repeat containing 1 [Source:HGNC Symbol;Acc:HGNC:49576])

HSP 1 Score: 322.783 bits (826), Expect = 9.647e-102
Identity = 192/516 (37.21%), Postives = 298/516 (57.75%), Query Frame = 1
Query:  253 KDDKAVIIQKLVRQFLSKTRLKKLKIEKMEYENKMEELERKAYLEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMIEAAFEGNLSEILSVLQLVEDDDNKQDIKRDFIGQNIRKRHLLDMINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKLLKKIQLHQEKLADEKKKRIEAEL---NNLDLQIAKAQKEHDSAQHRLQKAYCELNKRIYEHDKAVDKGFEKIDITEKCIHDAEFESESARMDMDKCRDKLSLLRLQKREKQKEEGLESGEETTKPGIECHIRELEDVIFKDVGNRLEMSGKWPLVVDPTGQAATFFRYRDTNYVNALDLSQMECNKLRMSLLGALRYGKTFIIDLMEVVQAFRSCVDRLSEIQDNLMDDIINKSILSFEKYSKLIRPNDDPEYDKNRFNNLRTKKFKFILLTSNSLPPNEILDLFHPVWVRI 1791
            +D  A  IQ   RQ  ++  L + + E+ EY  +ME  +++AYL  V+REQ+   R R+ EE  +R+  E  +R++ +++AAF+G++ EI +VL+ VE    ++ +  D  G+  R +  + +  CED+  NTP+SEA++GG    +Q   + GA+ N KG F  TPLYRAAF GHL   EVLL+ GADP++YA+D  TP  V S + V   L +WD   TE +L+ ++  Q++ A E ++  EAE     ++ L++ +  +E       LQ+AYCEL++RI EHD+   +  +K  +T + I D E + +  R +  K  + L++ RL+ RE+ +E     GEE   PG++C + EL DV+ KDVGNR+   G+WPLV+DP GQAATF RY+DTNYV+ ++   +    + ++LLGALRYGK  + DL E                ++L   +  +     E+Y  L+RP D PEY   +F   R + F+   +T    PP E L +  PV V++
Sbjct:   62 EDRAARAIQGAFRQLRARRELARRREERREYLEQMETPQKEAYLAPVRREQEAARRLREQEEAAQRERREELQRRRRLLDAAFDGDVGEIRAVLKEVEQLLTREGVGHDEAGEARRLQRRVALAECEDSYGNTPLSEAAAGGQPLAIQLRAELGASPNSKGAFGPTPLYRAAFGGHLAAVEVLLKLGADPRVYAEDGSTPERVASLDTVVSVLRSWDLSLTEAMLQNMEAEQQRRAQEAQRHKEAEAERCGSMTLKVQQLTREQQQCHKELQQAYCELSRRISEHDQCEWRCMDKTKLTLQAIKDTEAQVDRLRQEAQKAEEALAMARLELREQTQE-----GEEEA-PGLKCQVTELHDVLMKDVGNRIRADGRWPLVIDPLGQAATFLRYQDTNYVDTVNPEPLRPETMWLALLGALRYGKPLVFDLRE----------------EDLFPVVQRQLEAVQERYLSLLRPTDGPEYSPTQFQEQRLEHFRLFFVTKVQWPPAEQLQVLLPVRVQL 555          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK3 (ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494])

HSP 1 Score: 64.6994 bits (156), Expect = 8.176e-11
Identity = 44/113 (38.94%), Postives = 59/113 (52.21%), Query Frame = 1
Query:  646 NTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFLLNWDYLDTEKLLKKIQLHQEKLADEKK 972
            NT +  AS  G A++V+ L+  GANVN + Q   TPLY AA   HL+V + LL NGA   +  +D  TPL V    G  +VV   L N    DT+  ++   LH     D+ K
Sbjct:   82 NTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVKFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTK 190          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 66.6254 bits (161), Expect = 1.181e-10
Identity = 32/82 (39.02%), Postives = 47/82 (57.32%), Query Frame = 1
Query:  619 MINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVG 864
            M++       TP+  AS  GN  LV+FL+   A+VN K +   +PL++AA  GH D+  +LL+NGA P   + D  TPL + 
Sbjct:    7 MVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIA 88          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: TNKS (tankyrase [Source:HGNC Symbol;Acc:HGNC:11941])

HSP 1 Score: 66.2402 bits (160), Expect = 1.292e-10
Identity = 42/120 (35.00%), Postives = 65/120 (54.17%), Query Frame = 1
Query:  607 HLLDM---INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKLLKKIQLHQEKL 957
            HLL M   ++  D     P+  A S G+A++V  L+ +GA+ N +  +  TPL+ AA  G +DVC VLL++GADP I   D ++ LD+       + +L  +Y   E L      ++EKL
Sbjct:  234 HLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSA--KAVLTGEYKKDELLEAARSGNEEKL 351          

HSP 2 Score: 55.4546 bits (132), Expect = 2.402e-7
Identity = 40/146 (27.40%), Postives = 75/146 (51.37%), Query Frame = 1
Query:  484 MIEAAFEGNLSEILSVLQLVEDDDNKQDIKRD-----FIGQN-IRKRHLLDM----INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFL 891
            ++EAA  GN  +++++L  +  + +  D ++        G N +R   LL      ++ +D     P+  A S G+ ++ + L+  GA VN    ++ TPL+ AA    ++VC +LL +GADP +     ++ +D+  T  +RE L
Sbjct:  339 LLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERL 484          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Match: TNKS (tankyrase [Source:HGNC Symbol;Acc:HGNC:11941])

HSP 1 Score: 66.2402 bits (160), Expect = 1.503e-10
Identity = 35/88 (39.77%), Postives = 53/88 (60.23%), Query Frame = 1
Query:  607 HLLDM---INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV 861
            HLL M   ++  D     P+  A S G+A++V  L+ +GA+ N +  +  TPL+ AA  G +DVC VLL++GADP I   D ++ LD+
Sbjct:  234 HLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDL 321          

HSP 2 Score: 63.929 bits (154), Expect = 7.434e-10
Identity = 34/101 (33.66%), Postives = 54/101 (53.47%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKL 924
            +N +D     P+  A+S G+ D+   LI     VN   ++  TPL+ AA  G   +C +LL +GADP +   + QTPLD+ + + +R  L+  D +  E L
Sbjct:  863 VNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLI--DAMPPEAL 961          

HSP 3 Score: 60.077 bits (144), Expect = 1.214e-8
Identity = 29/80 (36.25%), Postives = 48/80 (60.00%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV 861
            ++ +D     P+  A S G+ ++ + L+  GA+VN    +K TPL+ AA  G  ++C++LL++GADP     D  TPLD+
Sbjct:  710 VHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDL 789          

HSP 4 Score: 55.4546 bits (132), Expect = 3.084e-7
Identity = 40/146 (27.40%), Postives = 75/146 (51.37%), Query Frame = 1
Query:  484 MIEAAFEGNLSEILSVLQLVEDDDNKQDIKRD-----FIGQN-IRKRHLLDM----INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFL 891
            ++EAA  GN  +++++L  +  + +  D ++        G N +R   LL      ++ +D     P+  A S G+ ++ + L+  GA VN    ++ TPL+ AA    ++VC +LL +GADP +     ++ +D+  T  +RE L
Sbjct:  339 LLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERL 484          

HSP 5 Score: 53.5286 bits (127), Expect = 1.506e-6
Identity = 37/149 (24.83%), Postives = 76/149 (51.01%), Query Frame = 1
Query:  481 AMIEAAFEGNLSEI-----LSVLQLVEDDDNKQDIKRDFIGQNIRKRHLLDMINCEDANQN-------TPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFL 891
            ++++AA E +L+++     L ++   +   ++  +       + +++ + +++  + AN N       TP+  A+   + D+++ L   GA +N      +T L+RAA AGHL  C +LL  G+DP I +    T   +G+ E V++ L
Sbjct:  492 SLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCAVASLHPKRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDTLGQTALHRAALAGHLQTCRLLLSYGSDPSIISLQGFTAAQMGN-EAVQQIL 639          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: C43H6.3 (pep chromosome:WBcel235:X:2407467:2409567:1 gene:WBGene00016616.1 transcript:C43H6.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C43H6.3)

HSP 1 Score: 64.3142 bits (155), Expect = 2.062e-12
Identity = 37/114 (32.46%), Postives = 62/114 (54.39%), Query Frame = 1
Query:  556 NKQDIKRDFIGQNIRKRHLLDMINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLN 897
            N Q+ + D + Q++ ++++ ++ N       T I  A+  G   ++ +LI  GAN+  K ++  TPL  A + GH D  ++LL+NGAD  I+A D    +D    E +RE L N
Sbjct:    6 NVQNGEIDAVKQSVNEKNVHEIYNGR-----TAIQIAADYGQTSIIAYLISIGANIQDKDKYGITPLLSAVWEGHRDAVKLLLQNGADRSIHAPDGTALIDCTEEEDIRELLKN 114          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 56.9954 bits (136), Expect = 5.146e-8
Identity = 30/80 (37.50%), Postives = 43/80 (53.75%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV 861
            IN +     TP+  A   G  ++V+FL++ GA+V  K +   TPL++AA  GH +    LL NGA P       QTPL +
Sbjct:  715 INSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSI 794          

HSP 2 Score: 53.1434 bits (126), Expect = 6.618e-7
Identity = 34/88 (38.64%), Postives = 47/88 (53.41%), Query Frame = 1
Query:  646 NTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFLLN 897
            NT +  AS  G + +V  L++ GANVN +     TPLY AA   H +V + LL++GA+  +  +D  TPL V    G   VV   L N
Sbjct:  100 NTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN 187          

HSP 3 Score: 52.7582 bits (125), Expect = 9.623e-7
Identity = 31/81 (38.27%), Postives = 47/81 (58.02%), Query Frame = 1
Query:  649 TPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVV 879
            TP+  A+  G  ++V +L+ +GAN + +     TPL+ AA A   DV  VL+RNGA     A + QTPL +    G+T++V
Sbjct:  427 TPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIV 507          

HSP 4 Score: 51.6026 bits (122), Expect = 1.934e-6
Identity = 27/73 (36.99%), Postives = 44/73 (60.27%), Query Frame = 1
Query:  649 TPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGS 867
            TP+  AS  GN ++V+ L+++G  V+ +G+ + TPL+ AA   +  V  +LL NGA  K  A +  TPL + +
Sbjct:  559 TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAA 631          

HSP 5 Score: 51.2174 bits (121), Expect = 2.582e-6
Identity = 47/171 (27.49%), Postives = 73/171 (42.69%), Query Frame = 1
Query:  493 AAFEGNLSEILSVLQLVEDDD----------------NKQDIKRDFIGQNIRKRHLLDMINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFLLNWDYLDTEKLLKKIQLH 945
            AAF G ++ ++ +LQ   + D                N+ D+ R  I    +       ++ +     TP+  AS  GN D+V  L+  GAN N   +   +PL+ AA  G  +V  +LL + AD  +      TPL +    G+ EVVR  L     +D E   +   LH
Sbjct:  432 AAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAK-------VDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLH 595          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 56.9954 bits (136), Expect = 5.146e-8
Identity = 30/80 (37.50%), Postives = 43/80 (53.75%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV 861
            IN +     TP+  A   G  ++V+FL++ GA+V  K +   TPL++AA  GH +    LL NGA P       QTPL +
Sbjct:  715 INSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSI 794          

HSP 2 Score: 53.1434 bits (126), Expect = 6.618e-7
Identity = 34/88 (38.64%), Postives = 47/88 (53.41%), Query Frame = 1
Query:  646 NTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFLLN 897
            NT +  AS  G + +V  L++ GANVN +     TPLY AA   H +V + LL++GA+  +  +D  TPL V    G   VV   L N
Sbjct:  100 NTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRVVAVLLEN 187          

HSP 3 Score: 52.7582 bits (125), Expect = 9.623e-7
Identity = 31/81 (38.27%), Postives = 47/81 (58.02%), Query Frame = 1
Query:  649 TPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVV 879
            TP+  A+  G  ++V +L+ +GAN + +     TPL+ AA A   DV  VL+RNGA     A + QTPL +    G+T++V
Sbjct:  427 TPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIV 507          

HSP 4 Score: 51.6026 bits (122), Expect = 1.934e-6
Identity = 27/73 (36.99%), Postives = 44/73 (60.27%), Query Frame = 1
Query:  649 TPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGS 867
            TP+  AS  GN ++V+ L+++G  V+ +G+ + TPL+ AA   +  V  +LL NGA  K  A +  TPL + +
Sbjct:  559 TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAA 631          

HSP 5 Score: 51.2174 bits (121), Expect = 2.582e-6
Identity = 47/171 (27.49%), Postives = 73/171 (42.69%), Query Frame = 1
Query:  493 AAFEGNLSEILSVLQLVEDDD----------------NKQDIKRDFIGQNIRKRHLLDMINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFLLNWDYLDTEKLLKKIQLH 945
            AAF G ++ ++ +LQ   + D                N+ D+ R  I    +       ++ +     TP+  AS  GN D+V  L+  GAN N   +   +PL+ AA  G  +V  +LL + AD  +      TPL +    G+ EVVR  L     +D E   +   LH
Sbjct:  432 AAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAK-------VDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLH 595          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: fem-1 (Sex-determining protein fem-1 [Source:UniProtKB/Swiss-Prot;Acc:P17221])

HSP 1 Score: 56.225 bits (134), Expect = 6.922e-8
Identity = 34/96 (35.42%), Postives = 52/96 (54.17%), Query Frame = 1
Query:  583 IGQNIRKRHLLDMINCEDANQNTPISEASSGGNADLVQFLIDKG-ANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGS 867
            IG +   R +++  N E+     P+  AS+ G+ ++V+ LI+K  A+VN     + TPL  A + GHLD+ + LL  GADP I      T L + S
Sbjct:   70 IGADPSVRGVVEFDN-ENIQGTPPLWAASAAGHIEIVKLLIEKANADVNQATNTRSTPLRGACYDGHLDIVKYLLEKGADPHIPNRHGHTCLMIAS 164          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Match: unc-44 (AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86])

HSP 1 Score: 54.6842 bits (130), Expect = 2.155e-7
Identity = 30/81 (37.04%), Postives = 43/81 (53.09%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVG 864
            IN +     TP+  A   G  ++V+FL++ GA+V  K +   TPL++AA  GH +    LL NGA P       QTPL + 
Sbjct:  715 INSKTNAGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGASPNEQTATGQTPLSIA 795          

HSP 2 Score: 52.373 bits (124), Expect = 1.355e-6
Identity = 29/73 (39.73%), Postives = 42/73 (57.53%), Query Frame = 1
Query:  646 NTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVG 864
            NT +  AS  G + +V  L++ GANVN +     TPLY AA   H +V + LL++GA+  +  +D  TPL V 
Sbjct:  100 NTALHIASLAGQSLIVTILVENGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVA 172          

HSP 3 Score: 51.6026 bits (122), Expect = 1.872e-6
Identity = 31/81 (38.27%), Postives = 47/81 (58.02%), Query Frame = 1
Query:  649 TPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVV 879
            TP+  A+  G  ++V +L+ +GAN + +     TPL+ AA A   DV  VL+RNGA     A + QTPL +    G+T++V
Sbjct:  427 TPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAKVDAQARELQTPLHIASRLGNTDIV 507          

HSP 4 Score: 50.8322 bits (120), Expect = 3.484e-6
Identity = 27/75 (36.00%), Postives = 45/75 (60.00%), Query Frame = 1
Query:  649 TPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTE 873
            TP+  AS  GN ++V+ L+++G  V+ +G+ + TPL+ AA   +  V  +LL NGA  K  A +  TPL + + +
Sbjct:  559 TPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHYNNDKVAMLLLENGASAKAAAKNGYTPLHIAAKK 633          

HSP 5 Score: 50.0618 bits (118), Expect = 6.998e-6
Identity = 47/171 (27.49%), Postives = 73/171 (42.69%), Query Frame = 1
Query:  493 AAFEGNLSEILSVLQLVEDDD----------------NKQDIKRDFIGQNIRKRHLLDMINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFLLNWDYLDTEKLLKKIQLH 945
            AAF G ++ ++ +LQ   + D                N+ D+ R  I    +       ++ +     TP+  AS  GN D+V  L+  GAN N   +   +PL+ AA  G  +V  +LL + AD  +      TPL +    G+ EVVR  L     +D E   +   LH
Sbjct:  432 AAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRNGAK-------VDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVAGILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLH 595          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: CG3104 (gene:FBgn0031473 transcript:FBtr0335132)

HSP 1 Score: 68.1662 bits (165), Expect = 5.063e-12
Identity = 36/94 (38.30%), Postives = 56/94 (59.57%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFL 891
            ++C+D +  TP+  A++GG+   V  L+D+GA+ N +     TPL+ AA  GHLDV ++L++ GA     + D  TPL V    G  ++VRE L
Sbjct:   36 VDCKDEDGTTPLILAAAGGHTYCVMELLDQGADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELL 129          

HSP 2 Score: 54.6842 bits (130), Expect = 1.254e-7
Identity = 33/104 (31.73%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPL----DVGSTEVVREFLLNWDYLDTEK 921
            ++   A+  TP+  A  GG+  +V+ L+D GANVN   + + TP++ +A  GH  V  +L++ GA+  I   D  TPL     +G   + +  L N   +DT +
Sbjct:  102 VDTPSADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDRATPVFISAQNGHRTVLSLLIQAGAEIDIKRIDGATPLWIAAQMGQDHICKVLLQNGANVDTVR 205          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: CG3104 (gene:FBgn0031473 transcript:FBtr0077686)

HSP 1 Score: 68.1662 bits (165), Expect = 5.063e-12
Identity = 36/94 (38.30%), Postives = 56/94 (59.57%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFL 891
            ++C+D +  TP+  A++GG+   V  L+D+GA+ N +     TPL+ AA  GHLDV ++L++ GA     + D  TPL V    G  ++VRE L
Sbjct:   36 VDCKDEDGTTPLILAAAGGHTYCVMELLDQGADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELL 129          

HSP 2 Score: 54.6842 bits (130), Expect = 1.254e-7
Identity = 33/104 (31.73%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPL----DVGSTEVVREFLLNWDYLDTEK 921
            ++   A+  TP+  A  GG+  +V+ L+D GANVN   + + TP++ +A  GH  V  +L++ GA+  I   D  TPL     +G   + +  L N   +DT +
Sbjct:  102 VDTPSADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDRATPVFISAQNGHRTVLSLLIQAGAEIDIKRIDGATPLWIAAQMGQDHICKVLLQNGANVDTVR 205          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: CG3104 (gene:FBgn0031473 transcript:FBtr0077687)

HSP 1 Score: 68.1662 bits (165), Expect = 5.063e-12
Identity = 36/94 (38.30%), Postives = 56/94 (59.57%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFL 891
            ++C+D +  TP+  A++GG+   V  L+D+GA+ N +     TPL+ AA  GHLDV ++L++ GA     + D  TPL V    G  ++VRE L
Sbjct:   36 VDCKDEDGTTPLILAAAGGHTYCVMELLDQGADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELL 129          

HSP 2 Score: 54.6842 bits (130), Expect = 1.254e-7
Identity = 33/104 (31.73%), Postives = 55/104 (52.88%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPL----DVGSTEVVREFLLNWDYLDTEK 921
            ++   A+  TP+  A  GG+  +V+ L+D GANVN   + + TP++ +A  GH  V  +L++ GA+  I   D  TPL     +G   + +  L N   +DT +
Sbjct:  102 VDTPSADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDRATPVFISAQNGHRTVLSLLIQAGAEIDIKRIDGATPLWIAAQMGQDHICKVLLQNGANVDTVR 205          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Tnks (gene:FBgn0027508 transcript:FBtr0330383)

HSP 1 Score: 62.003 bits (149), Expect = 1.676e-9
Identity = 29/70 (41.43%), Postives = 43/70 (61.43%), Query Frame = 1
Query:  652 PISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV 861
            P+  A S G+ ++ + L+  GANVN    +K TPL+ AA  G  D+C++LL++GADP     D  TP D+
Sbjct:  556 PLHNACSYGHYEVTELLVKHGANVNVSDLWKFTPLHEAAAKGKYDICKLLLKHGADPMKKNRDGATPADL 625          

HSP 2 Score: 59.6918 bits (143), Expect = 7.919e-9
Identity = 30/88 (34.09%), Postives = 48/88 (54.55%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVRE 885
            ++ +D     P+  A S G+ D+ + LI  GANVN    +  TPL+ AA    ++VC +LL  GADP +    +++ +D   T  +RE
Sbjct:  236 VHAKDKGGLVPLHNACSYGHFDVTKLLIQAGANVNANDLWAFTPLHEAASKSRVEVCSLLLSRGADPTLLNCHSKSAIDAAPTRELRE 323          

HSP 3 Score: 55.8398 bits (133), Expect = 1.142e-7
Identity = 42/154 (27.27%), Postives = 71/154 (46.10%), Query Frame = 1
Query:  481 AMIEAAFEGNLSEILSVLQLVEDDDNKQDIK-RDFIGQNIRKRHLLDM----------------INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFL 891
            A+++AA +GNL+ +  ++         + I  RD  G+N    HL                   +N +D     P+  ASS G+ D+   LI     VN   ++  TPL+ AA  G   +C +LL +GAD  +   + QTP+++ + + V+  L
Sbjct:  642 ALLDAAKKGNLARVQRLV-------TPESINCRDAQGRNSTPLHLAAGYNNFECAEYLLENGADVNAQDKGGLIPLHNASSYGHLDIAALLIKHKTVVNATDKWGFTPLHEAAQKGRTQLCSLLLAHGADAYMKNQEGQTPIELATADDVKCLL 788          

HSP 4 Score: 53.9138 bits (128), Expect = 4.466e-7
Identity = 29/80 (36.25%), Postives = 47/80 (58.75%), Query Frame = 1
Query:  652 PISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFL 891
            P+    S G+A++V+ L+  GA+ N    +  TPL+ AA  G +DVC  LL++GA+  I   + +TPL++ + E  R  L
Sbjct:   93 PLHNCCSFGHAEVVRLLLKAGASPNTTDNWNYTPLHEAASKGKVDVCLALLQHGANHTIRNSEQKTPLEL-ADEATRPVL 171          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Match: Tnks (gene:FBgn0027508 transcript:FBtr0084890)

HSP 1 Score: 61.2326 bits (147), Expect = 2.580e-9
Identity = 29/71 (40.85%), Postives = 43/71 (60.56%), Query Frame = 1
Query:  649 TPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV 861
             P+  A S G+ ++ + L+  GANVN    +K TPL+ AA  G  D+C++LL++GADP     D  TP D+
Sbjct:  555 VPLHNACSYGHYEVTELLVKHGANVNVSDLWKFTPLHEAAAKGKYDICKLLLKHGADPMKKNRDGATPADL 625          

HSP 2 Score: 59.3066 bits (142), Expect = 9.296e-9
Identity = 30/88 (34.09%), Postives = 48/88 (54.55%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVRE 885
            ++ +D     P+  A S G+ D+ + LI  GANVN    +  TPL+ AA    ++VC +LL  GADP +    +++ +D   T  +RE
Sbjct:  236 VHAKDKGGLVPLHNACSYGHFDVTKLLIQAGANVNANDLWAFTPLHEAASKSRVEVCSLLLSRGADPTLLNCHSKSAIDAAPTRELRE 323          

HSP 3 Score: 55.4546 bits (132), Expect = 1.492e-7
Identity = 42/154 (27.27%), Postives = 71/154 (46.10%), Query Frame = 1
Query:  481 AMIEAAFEGNLSEILSVLQLVEDDDNKQDIK-RDFIGQNIRKRHLLDM----------------INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFL 891
            A+++AA +GNL+ +  ++         + I  RD  G+N    HL                   +N +D     P+  ASS G+ D+   LI     VN   ++  TPL+ AA  G   +C +LL +GAD  +   + QTP+++ + + V+  L
Sbjct:  642 ALLDAAKKGNLARVQRLV-------TPESINCRDAQGRNSTPLHLAAGYNNFECAEYLLENGADVNAQDKGGLIPLHNASSYGHLDIAALLIKHKTVVNATDKWGFTPLHEAAQKGRTQLCSLLLAHGADAYMKNQEGQTPIELATADDVKCLL 788          

HSP 4 Score: 53.9138 bits (128), Expect = 4.605e-7
Identity = 29/80 (36.25%), Postives = 47/80 (58.75%), Query Frame = 1
Query:  652 PISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFL 891
            P+    S G+A++V+ L+  GA+ N    +  TPL+ AA  G +DVC  LL++GA+  I   + +TPL++ + E  R  L
Sbjct:   93 PLHNCCSFGHAEVVRLLLKAGASPNTTDNWNYTPLHEAASKGKVDVCLALLQHGANHTIRNSEQKTPLEL-ADEATRPVL 171          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 67.3958 bits (163), Expect = 9.216e-12
Identity = 45/113 (39.82%), Postives = 60/113 (53.10%), Query Frame = 1
Query:  646 NTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFLLNWDYLDTEKLLKKIQLHQEKLADEKK 972
            NT +  AS  G AD+V+ L++ GAN+N + Q   TPLY AA   HLDV + LL NG+   I  +D  TPL V    G  +VV   L N    DT+  ++   LH     D+ K
Sbjct:   78 NTALHIASLAGQADVVKELVNNGANINAQSQNGFTPLYMAAQENHLDVVKFLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTK 186          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 67.0106 bits (162), Expect = 9.655e-12
Identity = 45/113 (39.82%), Postives = 60/113 (53.10%), Query Frame = 1
Query:  646 NTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFLLNWDYLDTEKLLKKIQLHQEKLADEKK 972
            NT +  AS  G AD+V+ L++ GAN+N + Q   TPLY AA   HLDV + LL NG+   I  +D  TPL V    G  +VV   L N    DT+  ++   LH     D+ K
Sbjct:   89 NTALHIASLAGQADVVKELVNNGANINAQSQNGFTPLYMAAQENHLDVVKFLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTK 197          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 63.5438 bits (153), Expect = 1.513e-11
Identity = 34/73 (46.58%), Postives = 44/73 (60.27%), Query Frame = 1
Query:  646 NTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVG 864
            NT +  AS  G AD+V+ L++ GAN+N + Q   TPLY AA   HLDV + LL NG+   I  +D  TPL V 
Sbjct:   71 NTALHIASLAGQADVVKELVNNGANINAQSQNGFTPLYMAAQENHLDVVKFLLDNGSSQSIATEDGFTPLAVA 143          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ankrd39 (ankyrin repeat domain 39 [Source:ZFIN;Acc:ZDB-GENE-081104-153])

HSP 1 Score: 63.1586 bits (152), Expect = 4.844e-11
Identity = 32/77 (41.56%), Postives = 43/77 (55.84%), Query Frame = 1
Query:  625 NCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPL 855
            N  D    T +  AS  G+  + + L+D GA VN +     TPL+RAA+ GH  V ++LL  GADP +  DD  TPL
Sbjct:   55 NMRDQANYTALHYASRAGHVSVCELLLDCGACVNAQTHGGATPLHRAAYCGHQRVLKLLLERGADPGLTDDDGATPL 131          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Match: ankrd39 (ankyrin repeat domain 39 [Source:ZFIN;Acc:ZDB-GENE-081104-153])

HSP 1 Score: 63.1586 bits (152), Expect = 4.844e-11
Identity = 32/77 (41.56%), Postives = 43/77 (55.84%), Query Frame = 1
Query:  625 NCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPL 855
            N  D    T +  AS  G+  + + L+D GA VN +     TPL+RAA+ GH  V ++LL  GADP +  DD  TPL
Sbjct:   55 NMRDQANYTALHYASRAGHVSVCELLLDCGACVNAQTHGGATPLHRAAYCGHQRVLKLLLERGADPGLTDDDGATPL 131          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: bcorl1 (BCL6 corepressor like 1 [Source:NCBI gene;Acc:100216085])

HSP 1 Score: 70.4774 bits (171), Expect = 8.552e-12
Identity = 39/100 (39.00%), Postives = 58/100 (58.00%), Query Frame = 1
Query:  601 KRHLLDMINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNW 900
            +R L D IN  D    T + EA + G  D++Q L+D GANVNC  Q    P++ A    +L+   +LL  GADP +     QTP+ + S+E++R+FL N+
Sbjct: 1282 QRDLGD-INHRDNAGYTALHEACARGWTDILQILLDNGANVNCSAQDGTRPIHDAVVNDNLETVWLLLSYGADPTLATYSGQTPMKLASSEIMRKFLSNY 1380          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: bcorl1 (BCL6 corepressor like 1 [Source:NCBI gene;Acc:100216085])

HSP 1 Score: 70.0922 bits (170), Expect = 9.271e-12
Identity = 39/100 (39.00%), Postives = 58/100 (58.00%), Query Frame = 1
Query:  601 KRHLLDMINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNW 900
            +R L D IN  D    T + EA + G  D++Q L+D GANVNC  Q    P++ A    +L+   +LL  GADP +     QTP+ + S+E++R+FL N+
Sbjct: 1309 QRDLGD-INHRDNAGYTALHEACARGWTDILQILLDNGANVNCSAQDGTRPIHDAVVNDNLETVWLLLSYGADPTLATYSGQTPMKLASSEIMRKFLSNY 1407          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: anks6 (ankyrin repeat and sterile alpha motif domain containing 6 [Source:NCBI gene;Acc:100170596])

HSP 1 Score: 68.9366 bits (167), Expect = 1.659e-11
Identity = 39/107 (36.45%), Postives = 60/107 (56.07%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVRE------FLLNWDYLD 912
            ++C D + NT +  A+ GG+  +V+FL+ KGA+V+ +  +  TPL +AA  GHL+V  +LL NGAD         + L V    G   VV+E      F+ N+D+ D
Sbjct:   60 VDCTDEDGNTALQLAAGGGHEPIVRFLLRKGASVDSRNHYGWTPLMQAARTGHLNVAMILLENGADVNAQNRLGASVLTVASRGGHVNVVKELLDHGAFVDNYDHFD 166          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: anks6 (ankyrin repeat and sterile alpha motif domain containing 6 [Source:NCBI gene;Acc:100170596])

HSP 1 Score: 68.5514 bits (166), Expect = 2.248e-11
Identity = 39/107 (36.45%), Postives = 60/107 (56.07%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVRE------FLLNWDYLD 912
            ++C D + NT +  A+ GG+  +V+FL+ KGA+V+ +  +  TPL +AA  GHL+V  +LL NGAD         + L V    G   VV+E      F+ N+D+ D
Sbjct:   60 VDCTDEDGNTALQLAAGGGHEPIVRFLLRKGASVDSRNHYGWTPLMQAARTGHLNVAMILLENGADVNAQNRLGASVLTVASRGGHVNVVKELLDHGAFVDNYDHFD 166          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Match: anks6 (ankyrin repeat and sterile alpha motif domain containing 6 [Source:NCBI gene;Acc:100170596])

HSP 1 Score: 68.5514 bits (166), Expect = 2.729e-11
Identity = 39/107 (36.45%), Postives = 60/107 (56.07%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVRE------FLLNWDYLD 912
            ++C D + NT +  A+ GG+  +V+FL+ KGA+V+ +  +  TPL +AA  GHL+V  +LL NGAD         + L V    G   VV+E      F+ N+D+ D
Sbjct:   91 VDCTDEDGNTALQLAAGGGHEPIVRFLLRKGASVDSRNHYGWTPLMQAARTGHLNVAMILLENGADVNAQNRLGASVLTVASRGGHVNVVKELLDHGAFVDNYDHFD 197          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Iqank1 (IQ motif and ankyrin repeat containing 1 [Source:MGI Symbol;Acc:MGI:3588184])

HSP 1 Score: 379.022 bits (972), Expect = 2.223e-123
Identity = 217/538 (40.33%), Postives = 328/538 (60.97%), Query Frame = 1
Query:  184 KNSHS--GSLNKKPILTTTEKVWTEKDDKAVIIQKLVRQFLSKTRLKKLKIEKMEYENKMEELERKAYLEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMIEAAFEGNLSEILSVLQLVEDDDNKQDIKRDFIGQNIRKRHLLDMINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKLLKKIQLHQEKLADEKKKRIEAELNNLDLQIAKAQKEHDSAQHRLQKAYCELNKRIYEHDKAVDKGFEKIDITEKCIHDAEFESESARMDMDKCRDKLSLLRLQKREKQKEEGLESGEETTKPGIECHIRELEDVIFKDVGNRLEMSGKWPLVVDPTGQAATFFRYRDTNYVNALDLSQMECNKLRMSLLGALRYGKTFIIDLMEVVQAFRSCVDRLSEIQDNLMDDIINKSILSFEKYSKLIRPNDDPEYDKNRFNNLRTKKFKFILLTSNSLPPNEILDLFHPVWVRI 1791
            K SH   GS ++ P         T +D  A++IQ   RQ+L++  L +   E+ EY ++ME+L+++AYL +V++EQ+   RQR+ EE E+R   E  +R++ ++EAAFEG+L EI  VL+ VE    ++ +  D  G+  R +  +  + CED++ NTP+SEA++GG    +Q L + GAN N KG F RTPLYRAAF GHL+  E LL+ GADP++YADD  TP  V S   V   L +WD   TE +LK ++  Q++ A E +K  E E   +++++ +  KE    Q  LQ+AYCELN+RI EHDK   K     ++T + I DAE + +  + +  K  + L++ RL+ RE+  E      +E T+PG++C + EL DV+ KDVG+R+   G+WPLV+DP+GQAATF RY+DTNYV+ L+   +   ++R++LLGALRYGK  + DL + V  F     +L  +Q  L   ++N+ +L+ E Y  L+RP D PEYD ++F   R + F+   +T    PP + L    PV V++
Sbjct:   40 KASHPSKGSFSENP---QAPAAPTAEDKAAIVIQCAFRQYLARRELARRCQERQEYLDEMEKLQKEAYLALVRQEQEAARRQREKEEAEERARREELQRRRRLLEAAFEGDLGEIRQVLKEVEQLMTREGVGYDEDGKARRLQRRVATVECEDSHGNTPLSEAAAGGQTMAIQLLAELGANPNTKGAFGRTPLYRAAFGGHLEAVEELLKIGADPRMYADDGSTPEQVASLAAVASVLQSWDLSLTEAMLKNMEAEQQRRAQEAQKHKENEAKRINIKVQQLAKEQQKCQKELQQAYCELNRRIMEHDKCERKFMGNTELTLQAIKDAEAQVDRLQQEAQKAEETLAMARLELREQTPE------DEDTEPGLKCRVTELHDVLMKDVGDRIRADGRWPLVIDPSGQAATFLRYQDTNYVDTLNPEHLRPERIRLALLGALRYGKPLVFDLRQ-VNLFPVVQQQLEVVQTGLAQALLNRGLLAKEGYLSLLRPTDGPEYDPSQFQEARLENFRLFFVTQVKWPPADQLQTLLPVRVQM 567          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Iqank1 (IQ motif and ankyrin repeat containing 1 [Source:MGI Symbol;Acc:MGI:3588184])

HSP 1 Score: 124.405 bits (311), Expect = 2.198e-32
Identity = 59/119 (49.58%), Postives = 79/119 (66.39%), Query Frame = 1
Query:  496 AFEGNLSEILSVLQLVEDDDNKQDIKRDFIGQNIRKRHLLDMINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTP 852
            AFEG+L EI  VL+ VE    ++ +  D  G+  R +  +  + CED++ NTP+SEA++GG    +Q L + GAN N KG F RTPLYRAAF GHL+  E LL+ GADP++YADD  TP
Sbjct:   48 AFEGDLGEIRQVLKEVEQLMTREGVGYDEDGKARRLQRRVATVECEDSHGNTPLSEAAAGGQTMAIQLLAELGANPNTKGAFGRTPLYRAAFGGHLEAVEELLKIGADPRMYADDGSTP 166          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 64.6994 bits (156), Expect = 4.858e-11
Identity = 44/113 (38.94%), Postives = 58/113 (51.33%), Query Frame = 1
Query:  646 NTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFLLNWDYLDTEKLLKKIQLHQEKLADEKK 972
            NT +  AS  G A++V+ L+  GANVN + Q   TPLY AA   HL+V   LL NGA   +  +D  TPL V    G  +VV   L N    DT+  ++   LH     D+ K
Sbjct:   78 NTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTK 186          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 64.6994 bits (156), Expect = 7.456e-11
Identity = 44/113 (38.94%), Postives = 58/113 (51.33%), Query Frame = 1
Query:  646 NTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFLLNWDYLDTEKLLKKIQLHQEKLADEKK 972
            NT +  AS  G A++V+ L+  GANVN + Q   TPLY AA   HL+V   LL NGA   +  +D  TPL V    G  +VV   L N    DT+  ++   LH     D+ K
Sbjct:   82 NTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTK 190          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Match: Tnks (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase [Source:MGI Symbol;Acc:MGI:1341087])

HSP 1 Score: 66.2402 bits (160), Expect = 1.067e-10
Identity = 35/88 (39.77%), Postives = 53/88 (60.23%), Query Frame = 1
Query:  607 HLLDM---INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV 861
            HLL M   ++  D     P+  A S G+A++V  L+ +GA+ N +  +  TPL+ AA  G +DVC VLL++GADP I   D ++ LD+
Sbjct:  227 HLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDL 314          

HSP 2 Score: 64.3142 bits (155), Expect = 4.969e-10
Identity = 34/101 (33.66%), Postives = 54/101 (53.47%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKL 924
            +N +D     P+  A+S G+ D+   LI     VN   ++  TPL+ AA  G   +C +LL +GADP +   + QTPLD+ + + +R  L+  D +  E L
Sbjct:  856 VNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLI--DAMPPEAL 954          

HSP 3 Score: 60.077 bits (144), Expect = 7.979e-9
Identity = 31/88 (35.23%), Postives = 52/88 (59.09%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV---GSTEV 876
            ++ +D     P+  A S G+ ++ + L+  GA+VN    +K TPL+ AA  G  ++C++LL++GADP     D  TPLD+   G T++
Sbjct:  703 VHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDI 790          

HSP 4 Score: 55.4546 bits (132), Expect = 2.403e-7
Identity = 40/146 (27.40%), Postives = 75/146 (51.37%), Query Frame = 1
Query:  484 MIEAAFEGNLSEILSVLQLVEDDDNKQDIKRD-----FIGQN-IRKRHLLDM----INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFL 891
            ++EAA  GN  +++++L  +  + +  D ++        G N +R   LL      ++ +D     P+  A S G+ ++ + L+  GA VN    ++ TPL+ AA    ++VC +LL +GADP +     ++ +D+  T  +RE L
Sbjct:  332 LLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERL 477          

HSP 5 Score: 53.1434 bits (126), Expect = 1.087e-6
Identity = 37/149 (24.83%), Postives = 76/149 (51.01%), Query Frame = 1
Query:  481 AMIEAAFEGNLSEI-----LSVLQLVEDDDNKQDIKRDFIGQNIRKRHLLDMINCEDANQN-------TPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFL 891
            ++++AA E +L+++     L ++   +   ++  +       + +++ + +++  + AN N       TP+  A+   + D+++ L   GA +N      +T L+RAA AGHL  C +LL  G+DP I +    T   +G+ E V++ L
Sbjct:  485 SLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCAVASLHPKRKQVAELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDSLGQTALHRAALAGHLQTCRLLLSYGSDPSIISLQGFTAAQMGN-EAVQQIL 632          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|A8MXQ7|YH010_HUMAN (Putative IQ motif and ankyrin repeat domain-containing protein LOC642574 OS=Homo sapiens OX=9606 PE=5 SV=2)

HSP 1 Score: 312.768 bits (800), Expect = 9.753e-97
Identity = 192/537 (35.75%), Postives = 297/537 (55.31%), Query Frame = 1
Query:  253 KDDKAVIIQKLVRQFLSKTRLKKLKIEKMEYENKMEELERKAYLEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMIEAAFEGNLSEILSVLQLVEDDDNKQDIKRDFIGQNIRKRHLLDMINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKLLKKIQLHQEKLADEKKKRIEAELNNLDLQIAKAQKEHDSAQHRLQKAYCELNKRIYEHDKAVDKGFEKIDITEKCIHDAEFESESARMDMDKCRDKLSLLRLQKREKQKEEGLESGEETTKPGIECHIRELEDVIFKDVGNRLEMSG------------------------KWPLVVDPTGQAATFFRYRDTNYVNALDLSQMECNKLRMSLLGALRYGKTFIIDLMEVVQAFRSCVDRLSEIQDNLMDDIINKSILSFEKYSKLIRPNDDPEYDKNRFNNLRTKKFKFILLTSNSLPPNEILDLFHPVWVRI 1791
            +D  A  IQ   RQ  ++  L + + E+ EY  +ME  +++AYL  V+REQ+   R R+ EE  +R+  E  +R++ +++AAF+G++ EI +VL+ VE    ++ +  D  G+  R +  + +  CED+  NTP+SEA++GG    +Q   + GA+ N KG F  TPLYRAAF GHL   EVLL+ GADP++YA+D  TP  V S + V   L +WD   TE +L+ ++  Q++ A E ++  EAE   + L++ +  +E       LQ+AYCEL++RI EHD+   +  +K  +T + I D E + +  R +  K  + L++ RL+ RE+ +E     GEE   PG++C + EL DV+ KDVGNR+   G                        +WPLV+DP GQAATF RY+DTNYV+ ++   +    + ++LLGALRYGK  + DL E                ++L   +  +     E+Y  L+RP D PEY   +F   R + F+   +T    PP E L +  PV V++
Sbjct:   85 EDRAARAIQGAFRQLRARRELARRREERREYLEQMETPQKEAYLAPVRREQEAARRLREQEEAAQRERREELQRRRRLLDAAFDGDVGEIRAVLKEVEQLLTREGVGHDEAGEARRLQRRVALAECEDSYGNTPLSEAAAGGQPLAIQLRAELGASPNSKGAFGPTPLYRAAFGGHLAAVEVLLKLGADPRVYAEDGSTPERVASLDTVVSVLRSWDLSLTEAMLQNMEAEQQRRAQEAQRHKEAEAERMTLKVQQLTREQQQCHKELQQAYCELSRRISEHDQCEWRCMDKTKLTLQAIKDTEAQVDRLRQEAQKAEEALAMARLELREQTQE-----GEEEA-PGLKCQVTELHDVLMKDVGNRIRADGRSVLRARRGRFGVWTDSSDLMGVPRWPLVIDPLGQAATFLRYQDTNYVDTVNPEPLRPETMWLALLGALRYGKPLVFDLRE----------------EDLFPVVQRQLEAVQERYLSLLRPTDGPEYSPTQFQEQRLEHFRLFFVTKVQWPPAEQLQVLLPVRVQL 599          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3TYL0|YH010_MOUSE (Putative IQ motif and ankyrin repeat domain-containing protein LOC642574 homolog OS=Mus musculus OX=10090 PE=5 SV=2)

HSP 1 Score: 150.214 bits (378), Expect = 7.940e-39
Identity = 98/228 (42.98%), Postives = 145/228 (63.60%), Query Frame = 1
Query:  184 KNSHS--GSLNKKPILTTTEKVWTEKDDKAVIIQKLVRQFLSKTRLKKLKIEKMEYENKMEELERKAYLEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMIEAAFEGNLSEILSVLQLVEDDDNKQDIKRDFIGQNIRKRHLLDMINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV 861
            K SH   GS ++ P         T +D  A++IQ   RQ+L++  L +   E+ EY ++ME+L+++AYL +V++EQ+   RQR+ EE E+R   E  +R++ ++EAAFEG+L EI  VL+ VE    ++ +  D  G+  R +  +  + CED++ NTP+SEA++GG    +Q L + GAN N KG F RTPLYRAAF GHL+  E LL+ GADP++YADD  TP  V
Sbjct:   97 KASHPSKGSFSENPQAPAAP---TAEDKAAIVIQCAFRQYLARRELARRCQERQEYLDEMEKLQKEAYLALVRQEQEAARRQREKEEAEERARREELQRRRRLLEAAFEGDLGEIRQVLKEVEQLMTREGVGYDEDGKARRLQRRVATVECEDSHGNTPLSEAAAGGQTMAIQLLAELGANPNTKGAFGRTPLYRAAFGGHLEAVEELLKIGADPRMYADDGSTPEQV 321          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|O95271|TNKS1_HUMAN (Poly [ADP-ribose] polymerase tankyrase-1 OS=Homo sapiens OX=9606 GN=TNKS PE=1 SV=2)

HSP 1 Score: 66.2402 bits (160), Expect = 7.219e-10
Identity = 35/88 (39.77%), Postives = 53/88 (60.23%), Query Frame = 1
Query:  607 HLLDM---INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV 861
            HLL M   ++  D     P+  A S G+A++V  L+ +GA+ N +  +  TPL+ AA  G +DVC VLL++GADP I   D ++ LD+
Sbjct:  234 HLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDL 321          

HSP 2 Score: 63.929 bits (154), Expect = 3.570e-9
Identity = 34/101 (33.66%), Postives = 54/101 (53.47%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKL 924
            +N +D     P+  A+S G+ D+   LI     VN   ++  TPL+ AA  G   +C +LL +GADP +   + QTPLD+ + + +R  L+  D +  E L
Sbjct:  863 VNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLI--DAMPPEAL 961          

HSP 3 Score: 60.077 bits (144), Expect = 5.832e-8
Identity = 29/80 (36.25%), Postives = 48/80 (60.00%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV 861
            ++ +D     P+  A S G+ ++ + L+  GA+VN    +K TPL+ AA  G  ++C++LL++GADP     D  TPLD+
Sbjct:  710 VHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDL 789          

HSP 4 Score: 55.4546 bits (132), Expect = 1.481e-6
Identity = 40/146 (27.40%), Postives = 75/146 (51.37%), Query Frame = 1
Query:  484 MIEAAFEGNLSEILSVLQLVEDDDNKQDIKRD-----FIGQN-IRKRHLLDM----INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFL 891
            ++EAA  GN  +++++L  +  + +  D ++        G N +R   LL      ++ +D     P+  A S G+ ++ + L+  GA VN    ++ TPL+ AA    ++VC +LL +GADP +     ++ +D+  T  +RE L
Sbjct:  339 LLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERL 484          

HSP 5 Score: 53.5286 bits (127), Expect = 7.235e-6
Identity = 37/149 (24.83%), Postives = 76/149 (51.01%), Query Frame = 1
Query:  481 AMIEAAFEGNLSEI-----LSVLQLVEDDDNKQDIKRDFIGQNIRKRHLLDMINCEDANQN-------TPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFL 891
            ++++AA E +L+++     L ++   +   ++  +       + +++ + +++  + AN N       TP+  A+   + D+++ L   GA +N      +T L+RAA AGHL  C +LL  G+DP I +    T   +G+ E V++ L
Sbjct:  492 SLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCAVASLHPKRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDTLGQTALHRAALAGHLQTCRLLLSYGSDPSIISLQGFTAAQMGN-EAVQQIL 639          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6PFX9|TNKS1_MOUSE (Poly [ADP-ribose] polymerase tankyrase-1 OS=Mus musculus OX=10090 GN=Tnks PE=1 SV=1)

HSP 1 Score: 66.2402 bits (160), Expect = 7.460e-10
Identity = 35/88 (39.77%), Postives = 53/88 (60.23%), Query Frame = 1
Query:  607 HLLDM---INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV 861
            HLL M   ++  D     P+  A S G+A++V  L+ +GA+ N +  +  TPL+ AA  G +DVC VLL++GADP I   D ++ LD+
Sbjct:  227 HLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDL 314          

HSP 2 Score: 64.3142 bits (155), Expect = 3.476e-9
Identity = 34/101 (33.66%), Postives = 54/101 (53.47%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKL 924
            +N +D     P+  A+S G+ D+   LI     VN   ++  TPL+ AA  G   +C +LL +GADP +   + QTPLD+ + + +R  L+  D +  E L
Sbjct:  856 VNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLI--DAMPPEAL 954          

HSP 3 Score: 60.077 bits (144), Expect = 5.581e-8
Identity = 31/88 (35.23%), Postives = 52/88 (59.09%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV---GSTEV 876
            ++ +D     P+  A S G+ ++ + L+  GA+VN    +K TPL+ AA  G  ++C++LL++GADP     D  TPLD+   G T++
Sbjct:  703 VHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDI 790          

HSP 4 Score: 55.4546 bits (132), Expect = 1.681e-6
Identity = 40/146 (27.40%), Postives = 75/146 (51.37%), Query Frame = 1
Query:  484 MIEAAFEGNLSEILSVLQLVEDDDNKQDIKRD-----FIGQN-IRKRHLLDM----INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFL 891
            ++EAA  GN  +++++L  +  + +  D ++        G N +R   LL      ++ +D     P+  A S G+ ++ + L+  GA VN    ++ TPL+ AA    ++VC +LL +GADP +     ++ +D+  T  +RE L
Sbjct:  332 LLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELRERL 477          

HSP 5 Score: 53.1434 bits (126), Expect = 7.607e-6
Identity = 37/149 (24.83%), Postives = 76/149 (51.01%), Query Frame = 1
Query:  481 AMIEAAFEGNLSEI-----LSVLQLVEDDDNKQDIKRDFIGQNIRKRHLLDMINCEDANQN-------TPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFL 891
            ++++AA E +L+++     L ++   +   ++  +       + +++ + +++  + AN N       TP+  A+   + D+++ L   GA +N      +T L+RAA AGHL  C +LL  G+DP I +    T   +G+ E V++ L
Sbjct:  485 SLLQAAREADLAKVKKTLALEIINFKQPQSHETALHCAVASLHPKRKQVAELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAKMNALDSLGQTALHRAALAGHLQTCRLLLSYGSDPSIISLQGFTAAQMGN-EAVQQIL 632          
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Match: sp|P16157|ANK1_HUMAN (Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3)

HSP 1 Score: 66.2402 bits (160), Expect = 9.261e-10
Identity = 32/82 (39.02%), Postives = 47/82 (57.32%), Query Frame = 1
Query:  619 MINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVG 864
            M++       TP+  AS  GN  LV+FL+   A+VN K +   +PL++AA  GH D+  +LL+NGA P   + D  TPL + 
Sbjct:  693 MVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIA 774          

HSP 2 Score: 59.3066 bits (142), Expect = 1.165e-7
Identity = 35/88 (39.77%), Postives = 50/88 (56.82%), Query Frame = 1
Query:  646 NTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVG---STEVVREFLLNW 900
            NT +  A+  G  ++V+ L++ GANVN + Q   TPLY AA   HL+V + LL NGA+  +  +D  TPL V      E V   L+N+
Sbjct:   79 NTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINY 166          

HSP 3 Score: 56.225 bits (134), Expect = 1.113e-6
Identity = 28/90 (31.11%), Postives = 49/90 (54.44%), Query Frame = 1
Query:  625 NCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLL 894
            N  +    TP+  A+  G+ ++ ++L+   A VN K +  +TPL+ AA  GH ++ ++LL N A+P +      TPL + + E   E +L
Sbjct:  431 NVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVL 520          

HSP 4 Score: 53.9138 bits (128), Expect = 5.853e-6
Identity = 32/102 (31.37%), Postives = 54/102 (52.94%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKLL 927
            +N    N  TP+  AS  GN  +V+ L+D+GA +  K + + TPL+ AA  GH+ + E+LL +GA  +    +  +P+ + +           D+LD  +LL
Sbjct:  232 VNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAA---------QGDHLDCVRLL 324          

HSP 5 Score: 53.5286 bits (127), Expect = 6.538e-6
Identity = 34/87 (39.08%), Postives = 48/87 (55.17%), Query Frame = 1
Query:  649 TPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLD----VGSTEVVREFLLN 897
            TP+  AS  G+  +V+ L+ +GA+ N       TPL+ AA AGH +V + LL+N A     A D QTPL     +G T +V+  L N
Sbjct:  406 TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLEN 492          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A1S3HW65 (putative IQ motif and ankyrin repeat domain-containing protein OS=Lingula unguis OX=7574 GN=LOC106158392 PE=4 SV=1)

HSP 1 Score: 485.337 bits (1248), Expect = 1.974e-161
Identity = 259/519 (49.90%), Postives = 384/519 (73.99%), Query Frame = 1
Query:  238 KVWTEKDDKAVIIQKLVRQFLSKTRLKKLKIEKMEYENKMEELERKAYLEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMIEAAFEGNLSEILSVLQLVEDDDNKQDIKRDFIGQNIRKRHLLDMINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKLLKKIQLHQEKLADEKKKRIEAELNNLDLQIAKAQKEHDSAQHRLQKAYCELNKRIYEHDKAVDKGFEKIDITEKCIHDAEFESESARMDMDKCRDKLSLLRLQKREKQKEEGLESGEETTKPGIECHIRELEDVIFKDVGNRLEMSGKWPLVVDPTGQAATFFRYRDTNYVNALDLSQMECNKLRMSLLGALRYGKTFIIDLMEVVQAFRSCVDRLSEIQDNLMDDIINKSILSFEKYSKLIRPNDDPEYDKNRFNNLRTKKFKFILLTSNSLPPNEILDLFHPVWVRIN 1794
            KVWT++DD A  IQ  +RQ+L+K  L+K K EK +YE  ME+LE++A++++VK EQ++ E++R+ +EEE+R+  E ++R K M+EAAFEG+  E+L+VL+ V D DNK  I  D IG+ +R++H L ++ CEDAN NTP+SEA+SGGN D ++ L+++GA+VN +GQF RTPLYRAAFAGHL+ CEVLL++GADP++YA+D  TP  + S   + E L +WD   TE +L K++  +EK A+ +++R  AE + ++ QI +A+KE+D AQ  L K YCE+NKRI EHDKAV +GF K DIT + IHD+E + E A+++ +K R+KL+ L+L+ REK+K EG+    E   PGI+ +I+EL+DV+ +DVGN+++ SGKWPL++DP+ QAATF RYRDTNY+NAL+ +QME  K+R+++LG++RYGK+ ++D+ME V  F +  DR  E+   LM+ I++KS+L  E Y+ L+R  D  EYDKN+F   R + FKF+++T N LPP E+L+  + + + IN
Sbjct:   63 KVWTKEDDAARKIQTKIRQYLAKKVLQKKKQEKKDYEELMEKLEKEAFVKMVKMEQEQYEKERQQQEEERRRKAEERKRIKRMLEAAFEGDKDEVLTVLKEVADLDNKNGIGNDVIGRGLRQKHELAIVECEDANNNTPLSEAASGGNVDTIKLLLERGADVNSRGQFDRTPLYRAAFAGHLEACEVLLQHGADPRLYANDGSTPESIASIAPIVELLGSWDISQTENILVKLETEKEKRAEIERQRKAAETSKIEEQIKEAEKEYDIAQKTLNKEYCEMNKRITEHDKAVTEGFAKTDITLQMIHDSEADVEVAKINCEKAREKLAQLKLKLREKEK-EGM---AEEDLPGIKVNIKELDDVLLRDVGNKIKESGKWPLLIDPSSQAATFLRYRDTNYLNALNPAQMEPEKVRLAVLGSVRYGKSLVLDMME-VDMFDTVSDRFDEVHKGLMNMIMDKSLLKDEAYTCLLRKGDPQEYDKNKFIENRVQNFKFVIITKNPLPPAELLERTYAIRIHIN 576          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: K1S0J4 (ANK_REP_REGION domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10021272 PE=4 SV=1)

HSP 1 Score: 464.537 bits (1194), Expect = 2.615e-153
Identity = 255/518 (49.23%), Postives = 372/518 (71.81%), Query Frame = 1
Query:  238 KVWTEKDDKAVIIQKLVRQFLSKTRLKKLKIEKMEYENKMEELERKAYLEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMIEAAFEGNLSEILSVLQLVEDDDNKQDIKRDFIGQNIRKRHLLDMINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKLLKKIQLHQEKLADEKKKRIEAELNNLDLQIAKAQKEHDSAQHRLQKAYCELNKRIYEHDKAVDKGFEKIDITEKCIHDAEFESESARMDMDKCRDKLSLLRLQKREKQKEEGLESGEETTKPGIECHIRELEDVIFKDVGNRLEMSGKWPLVVDPTGQAATFFRYRDTNYVNALDLSQMECNKLRMSLLGALRYGKTFIIDLMEVVQAFRSCVDRLSEIQDNLMDDIINKSILSFEKYSKLIRPNDDPEYDKNRFNNLRTKKFKFILLTSNSLPPNEILDLFHPVWVRI 1791
            KVWTEKDD A+ IQ   RQF +K  L K K EK EYE  M++LE++A+L++VK EQ++ E++R+ EEEE+++  E  +RKK M+EAAFEG++ EI ++L+ V+  D+++ + +D IG  IR +HL+++I CEDAN NTP+SEA++GG+   VQ  +DKGA+ N KGQFKRTPLYRAAFAGHL+  + LL+NGADP++YADD Q P  + S E V+E L  WD  +T+KLL+K++  ++K  +E++ R +AE + L+  +  AQ+E+D  Q +L  AYCE+NKRI EHD AV  GF++ ++T + IHD E E E  +   DK R+ L+  +L+ RE Q  EGLE+ E    PG++  I+EL+DV+ +DVG++++ SGKWPL++D + QAATF RYRDTNY+N L+  +ME NK+R+SLLGA+R+GK  ++D+ME V  F +  DR  EI+  LMD I++KSI+  E Y KLI+  D PEY+KN+F + RT+ FKF ++T N  PP+ +LD  + + + +
Sbjct:   64 KVWTEKDDAALKIQTKYRQFRAKKALDKKKKEKQEYEELMDKLEKEAFLQLVKMEQEKAEKERQKEEEERKRKREEIKRKKRMLEAAFEGDIEEIENILKEVKALDDQKGVGKDAIGLAIRNKHLMNVIECEDANDNTPLSEAANGGDPKTVQLFLDKGADPNSKGQFKRTPLYRAAFAGHLEAVQALLQNGADPRLYADDGQNPEQIASVEAVKEVLAEWDVAETDKLLQKLEAEKQKRKEEQQMRRDAETSKLEGSVQAAQEEYDRIQKQLSHAYCEMNKRITEHDTAVGSGFDRPELTLQAIHDQEDEVEILKSKCDKAREDLANAKLKLRE-QLNEGLETNENL--PGMQILIKELDDVLLRDVGDKIKDSGKWPLIIDRSSQAATFLRYRDTNYLNTLNTKEMEPNKVRLSLLGAIRFGKPLVLDMME-VDMFHTVSDRFDEIEKGLMDQIMDKSIMQEENYLKLIKEGDGPEYEKNKFTSYRTQNFKFWIITKNPYPPDYLLDRCYTIRIYV 577          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A433SUC4 (ANK_REP_REGION domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_019346 PE=4 SV=1)

HSP 1 Score: 461.84 bits (1187), Expect = 3.987e-152
Identity = 260/541 (48.06%), Postives = 386/541 (71.35%), Query Frame = 1
Query:  169 IKTVSKNSHSGSLNKKPILTTTEKVWTEKDDKAVIIQKLVRQFLSKTRLKKLKIEKMEYENKMEELERKAYLEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMIEAAFEGNLSEILSVLQLVEDDDNKQDIKRDFIGQNIRKRHLLDMINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKLLKKIQLHQEKLADEKKKRIEAELNNLDLQIAKAQKEHDSAQHRLQKAYCELNKRIYEHDKAVDKGFEKIDITEKCIHDAEFESESARMDMDKCRDKLSLLRLQKREKQKEEGLESGEETTKPGIECHIRELEDVIFKDVGNRLEMSGKWPLVVDPTGQAATFFRYRDTNYVNALDLSQMECNKLRMSLLGALRYGKTFIIDLMEVVQAFRSCVDRLSEIQDNLMDDIINKSILSFEKYSKLIRPNDDPEYDKNRFNNLRTKKFKFILLTSNSLPPNEILDLFHPVWVRI 1791
            +K  S N+   S N+KP     +  WT++DD A  IQ   RQF +K  L+K K EK EYE  ME+LE++A+L +VK EQ+E ER+++ E+EE+R+  E ++R K M+EAAF+G++ ++  +L+ V D D+K  I  D IG+++R +H++ +I+C+DAN NT +SEA++GGNAD ++FL+++GA+ N +G F RTPLYRAAFAGHL+    LL NGADP+IYA D+QTP D+ S + V+  L NWD   TE L K+I+  +EK A+E +KR EAE + L+ Q+A+AQKE+++ Q +L  AYCELNKRI EHD  V +GF++ ++T + I+D E E E+ ++ + + RDKLS LRL+ RE  K E   +  + + PG++ +I+EL+DV+ +D+GNR++ S KWPL++D +GQA+TF RYRDTNY+N++  + ME N +R  LLG++R+GK F++D+ME V  F +C DR  EIQ +LM  II+KSIL  EKY KL++  D PEYDK +FN+LR   FKF+L++ +  P  ++LD+F+ + V I
Sbjct:   45 LKKSSSNTKKQSKNEKP----KKNEWTKEDDAARKIQTKYRQFTAKKNLEKKKKEKEEYEELMEKLEKEAFLHMVKMEQEEAERRQQKEDEERRRKKEEQKRIKRMLEAAFDGDIDQMKEILKEVSDLDDKNGIGNDVIGRSLRTKHMMSIIDCKDANDNTALSEAANGGNADAIKFLLERGADPNTQGHFMRTPLYRAAFAGHLEATLALLENGADPRIYASDSQTPTDIASRDDVKAVLQNWDISRTEVLQKQIEAAKEKRAEEDRKRKEAETSKLEDQVAEAQKEYEAVQKQLDHAYCELNKRINEHDTCVAQGFDRPELTLQSINDQELEVETTKIKVAEARDKLSKLRLRLRESIKGEDSSTANDDS-PGVKVNIKELDDVLLRDIGNRIKDSEKWPLLIDQSGQASTFLRYRDTNYINSIRPADMENNNIRRCLLGSIRFGKPFVVDMME-VDMFDTCSDRFGEIQKDLMSSIIDKSILKPEKYLKLVKAEDGPEYDKTKFNDLRLANFKFVLISKSPFPNPKLLDMFYVIKVII 579          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: A0A2C9KSV2 (ANK_REP_REGION domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106068929 PE=4 SV=1)

HSP 1 Score: 460.685 bits (1184), Expect = 2.255e-151
Identity = 248/538 (46.10%), Postives = 366/538 (68.03%), Query Frame = 1
Query:  178 VSKNSHSGSLNKKPILTTTEKVWTEKDDKAVIIQKLVRQFLSKTRLKKLKIEKMEYENKMEELERKAYLEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMIEAAFEGNLSEILSVLQLVEDDDNKQDIKRDFIGQNIRKRHLLDMINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKLLKKIQLHQEKLADEKKKRIEAELNNLDLQIAKAQKEHDSAQHRLQKAYCELNKRIYEHDKAVDKGFEKIDITEKCIHDAEFESESARMDMDKCRDKLSLLRLQKREKQKEEGLESGEETTKPGIECHIRELEDVIFKDVGNRLEMSGKWPLVVDPTGQAATFFRYRDTNYVNALDLSQMECNKLRMSLLGALRYGKTFIIDLMEVVQAFRSCVDRLSEIQDNLMDDIINKSILSFEKYSKLIRPNDDPEYDKNRFNNLRTKKFKFILLTSNSLPPNEILDLFHPVWVRI 1791
            VSKNS      K+ +   TEK     D  A+ IQ  VRQFL K  L+K + EK EYE KMEEL+++A+L + + EQ++ E+Q+  E+EEKR+  E  +RKK  +EAAF+GN+  +  +L+ V D D+K  +  D IG+++  +HL+ +I C DAN+NT +SEA++GG+A+ ++ L++ GA+ N  GQF+RTPLYRAAFAGHL+   +LL NGADP+I   D+Q+P +V S + V+E L NW    TE LLK+I+  +EK  +E K+R EAE   L+  + + + E+   Q +L+ AYCELNKRI+EHD  + +GF+K ++TE  IHD EFE E+A+++++  R++L+  RL  RE  K    E+ EE   PG++  I+EL+DV+F+DVGNR++ SGKWP V+D  GQA TF RYRDTNYV +L  + ME N +R+SLLG +R+GK F++D+ME V  F +CVD   ++   LM+ I++K+I++ +KY  LI+  D PEY+  +FN +RT KF FILLT N  P  +++ L + + V +
Sbjct:   79 VSKNSSQKQKTKETVAKPTEK-----DLAAIKIQTTVRQFLGKKTLEKRRKEKQEYEQKMEELDKQAFLYLCRLEQEKAEKQQAKEQEEKRRKQEETKRKKRFLEAAFDGNVVSMKQILKEVSDIDDKNGLGNDIIGRSLHTKHLMAIIECTDANENTALSEAANGGHAEAIKLLLENGADPNTIGQFRRTPLYRAAFAGHLEATYMLLENGADPRIIGGDSQSPAEVASVQAVKEVLENWKIETTETLLKQIETAKEKRLNEDKQRREAETMKLEEFVNELETEYKVKQKKLEFAYCELNKRIHEHDVCMSEGFDKPELTESAIHDQEFEVENAKLELESAREQLAKARLALRESSKTVDEETEEEL--PGLKVVIKELDDVLFRDVGNRIKDSGKWPCVIDINGQAGTFLRYRDTNYVCSLRPADMEVNNIRLSLLGTIRFGKPFVLDMME-VDMFETCVDIFDKVMKGLMNSILDKTIVNEDKYKTLIKSTDGPEYELTKFNEIRTSKFMFILLTKNPTPSEKLMQLMYLIRVVV 608          
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Match: V4ALM5 (ANK_REP_REGION domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_215456 PE=4 SV=1)

HSP 1 Score: 456.833 bits (1174), Expect = 2.770e-150
Identity = 244/518 (47.10%), Postives = 362/518 (69.88%), Query Frame = 1
Query:  235 EKVWTEKDDKAVIIQKLVRQFLSKTRLKKLKIEKMEYENKMEELERKAYLEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMIEAAFEGNLSEILSVLQLVEDDDNKQDI-KRDFIGQNIRKRHLLDMINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKLLKKIQLHQEKLADEKKKRIEAELNNLDLQIAKAQKEHDSAQHRLQKAYCELNKRIYEHDKAVDKGFEKIDITEKCIHDAEFESESARMDMDKCRDKLSLLRLQKREKQKEEGLESGEETTKPGIECHIRELEDVIFKDVGNRLEMSGKWPLVVDPTGQAATFFRYRDTNYVNALDLSQMECNKLRMSLLGALRYGKTFIIDLMEVVQAFRSCVDRLSEIQDNLMDDIINKSILSFEKYSKLIRPNDDPEYDKNRFNNLRTKKFKFILLTSNSLPPNEILDLFHPVWV 1785
            EKVWT++D+ +  IQK VR FL++ +L++ +IEK +YE KM+ LE++A++ +VK +Q+E ERQ K +EEE+++  E  +RKK M+EAA++G+   IL +LQ V + D+K +I K D IG+ +R +H+L MI CEDAN+NTP+SEA+SGG+   +Q L+D  A+ N KGQF+RTPLYRAAFAGHL+ C+VL++NG DP++YA D QT   V S   ++E L +WD   TE LLK+I+  +EK  +E KK+ EAE + L+  + +A K++ + Q +LQ A+CELNKRI EHDKAV  GF++ ++  + IHDAE E E+ ++  +K RDKL+  RL+ REKQ  +  ES      PG++  IRELE+V+ +DVGN++  SGKWPL++D +GQA+TF RYRDTN +NAL    ME N++R++LLGA+RYGK  +ID+M+ V  +  C DR  E+   LMD I++ S+L  EKY  L++P+D  EY   +  +   + FK  ++ +N  P   +L+  +P+ +
Sbjct:   57 EKVWTKEDEASCKIQKHVRVFLARKKLERKRIEKEKYEEKMQNLEKEAFVHMVKMQQEEVERQMKKDEEERKRKREEVKRKKRMLEAAYDGDNDSILDILQEVREIDDKNNISKDDVIGKAVRNKHILAMIECEDANENTPLSEAASGGHVPTIQLLLDYEADPNSKGQFQRTPLYRAAFAGHLEACQVLIQNGGDPRMYASDGQTAEQVASVPAIQEMLQSWDISKTESLLKRIESSKEKRLEEHKKQREAEQSKLEGVVEEALKDYQNKQKQLQTAHCELNKRIVEHDKAVLAGFDRPELLVQTIHDAELELETVKIHTEKARDKLAQARLRLREKQAGDD-ESDVSDNLPGVKVAIRELEEVLLRDVGNKIRDSGKWPLIIDTSGQASTFLRYRDTNVINALRQQDMEPNRIRLALLGAIRYGKPLVIDMMQ-VDMYEVCRDRFDEVHKGLMDSILDSSLLKDEKYLSLVKPDDGEEYSHTK--HFFVENFKLFIVCANPYPSESLLNQMYPIRI 570          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: tnksa (tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase a [Source:ZFIN;Acc:ZDB-GENE-030131-7450])

HSP 1 Score: 64.6994 bits (156), Expect = 1.935e-10
Identity = 50/168 (29.76%), Postives = 82/168 (48.81%), Query Frame = 1
Query:  484 MIEAAFEGNLSEILSVLQLV----EDDDNKQDIKRDFIGQNIRK---RHLLDM---INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKLLKKIQLHQEKL 957
            + EA   G++S +  ++  V    +D   ++     F     RK    HLL     ++  D     P+  A S G+A++V  L+ +GA+ N +  +  TPL+ AA  G +DVC VLL++GADP I   D ++ LD+       + +L  +Y   E L      ++EKL
Sbjct:  130 LFEACRNGDVSRVKRLVDSVNVNAKDMAGRKSTPLHFAAGFGRKDVVEHLLQTGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNSRDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSA--KAVLTGEYKKDELLEAARSGNEEKL 295          

HSP 2 Score: 54.299 bits (129), Expect = 3.371e-7
Identity = 39/146 (26.71%), Postives = 75/146 (51.37%), Query Frame = 1
Query:  484 MIEAAFEGNLSEILSVLQLVEDDDNKQDIKRD-----FIGQN-IRKRHLLDM----INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFL 891
            ++EAA  GN  +++++L  +  + +  D ++        G N +R   LL      ++ +D     P+  A S G+ ++ + L+  GA VN    ++ TPL+ AA    ++VC +LL +GADP +     ++ +D+  T  ++E L
Sbjct:  283 LLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVNCHGKSAVDMAPTPELKERL 428          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 65.0846 bits (157), Expect = 2.409e-10
Identity = 45/113 (39.82%), Postives = 58/113 (51.33%), Query Frame = 1
Query:  646 NTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFLLNWDYLDTEKLLKKIQLHQEKLADEKK 972
            NT +  AS  G +D+V+ L+  GANVN + Q   TPLY AA   HLDV   LL NG+   I  +D  TPL V    G  +VV   L N    DT+  ++   LH     D+ K
Sbjct:   55 NTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTK 163          

HSP 2 Score: 50.0618 bits (118), Expect = 8.150e-6
Identity = 31/111 (27.93%), Postives = 53/111 (47.75%), Query Frame = 1
Query:  625 NCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFLLNWDYLDTEKLLKKIQLH 945
            N +  N  TP+  A       +++ L+  GA++    +   TP++ AAF GH ++   L+ +GA P       +T L +    G TEVV+  + N  Y+D +    +  LH
Sbjct:  341 NAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLH 451          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ANKRD50 (ankyrin repeat domain 50 [Source:NCBI gene;Acc:103026486])

HSP 1 Score: 64.6994 bits (156), Expect = 2.945e-10
Identity = 57/168 (33.93%), Postives = 85/168 (50.60%), Query Frame = 1
Query:  481 AMIEAAFEGNLSEILSVLQL---VEDDDNKQD---IKRDFIGQNIRKRHLLDM---INCEDANQNTPISEAS-----SGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPL----DVGSTEVVREFLLNW----DYLDTE 918
            A+  AA+ G+   +L++LQ    V   DN+     I   ++G      HLLD    +N ED +  T +S A+     S G+A +V  LID+GA V+   +   TPL  AA+ GH+DV ++LL  GAD     ++ +TPL     +G   VV   L  W    D +D+E
Sbjct:  641 ALRAAAWGGHEDIVLNLLQHGAEVNKADNEGRTALIAAAYMGHREIVEHLLDHGAEVNHEDVDGRTALSVAALCVPASKGHASVVSLLIDRGAEVDHCDKDCMTPLLVAAYEGHVDVVDLLLEGGADVDHTDNNGRTPLLAAASMGHASVVNTLLF-WGAAVDSIDSE 807          

HSP 2 Score: 54.299 bits (129), Expect = 4.767e-7
Identity = 30/80 (37.50%), Postives = 46/80 (57.50%), Query Frame = 1
Query:  634 DANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTE 873
            D+   T +S AS+ GN ++V+ L+D+G + N +     TPL+ AAF GH  VC+ LL  GA      +D + PL + + E
Sbjct:  805 DSEGRTVLSIASAQGNVEVVRTLLDRGLDENHRDDAGWTPLHMAAFEGHRQVCDALLEQGARCSEVDNDGRIPLILAAQE 884          

HSP 3 Score: 51.2174 bits (121), Expect = 3.813e-6
Identity = 30/82 (36.59%), Postives = 45/82 (54.88%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGS 867
            ++C DA+  T +  A+ GG+ D+V  L+  GA VN      RT L  AA+ GH ++ E LL +GA+      D +T L V +
Sbjct:  631 VDCADADSRTALRAAAWGGHEDIVLNLLQHGAEVNKADNEGRTALIAAAYMGHREIVEHLLDHGAEVNHEDVDGRTALSVAA 712          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ankef1a (ankyrin repeat and EF-hand domain-containing protein 1-like [Source:NCBI gene;Acc:103043611])

HSP 1 Score: 63.5438 bits (153), Expect = 4.316e-10
Identity = 31/78 (39.74%), Postives = 45/78 (57.69%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPL 855
            ++ +D    TP+  A   GN ++ +FL+D GA+VN + QF  TPL+ A  AG LD+ E+L+  GA     A    TPL
Sbjct:  523 VDVKDQYYKTPLMTACGSGNYEVAKFLLDLGADVNARDQFSWTPLHHACHAGQLDIIELLVEAGAAVDAPALSGATPL 600          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Match: ankef1a (ankyrin repeat and EF-hand domain-containing protein 1-like [Source:NCBI gene;Acc:103043611])

HSP 1 Score: 63.5438 bits (153), Expect = 4.429e-10
Identity = 31/78 (39.74%), Postives = 45/78 (57.69%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPL 855
            ++ +D    TP+  A   GN ++ +FL+D GA+VN + QF  TPL+ A  AG LD+ E+L+  GA     A    TPL
Sbjct:  523 VDVKDQYYKTPLMTACGSGNYEVAKFLLDLGADVNARDQFSWTPLHHACHAGQLDIIELLVEAGAAVDAPALSGATPL 600          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009608.1 (pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 gene:ENSPMAG00000008655.1 transcript:ENSPMAT00000009608.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 1.257e-11
Identity = 36/101 (35.64%), Postives = 55/101 (54.46%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKL 924
            +N +D     P+  A+S G+ D+   LI   A VN   ++  TPL+ AA  G   +C +LL +GADP +   + QTPLD+ + + VR  L+  D +  E L
Sbjct:  829 VNAQDKGGLIPLHNAASYGHVDIAALLIKYSACVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPSMKNQEGQTPLDLATADDVRALLI--DAMPPEAL 927          

HSP 2 Score: 66.6254 bits (161), Expect = 1.323e-11
Identity = 50/158 (31.65%), Postives = 78/158 (49.37%), Query Frame = 1
Query:  505 GNLSEILSVLQL-VEDDDNKQDIKRDFIGQNIRK---RHLLDM---INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKLLKKIQLHQEKL 957
            G +  ++S L +   D   ++     F     RK    HLL     ++  D     P+  A S G+A++V  L+ +GA+ N +  +  TPL+ AA  G +DVC VLL++GADP I   D +T LD+   E   + +L  +Y   E L      ++EKL
Sbjct:  161 GRVKRLVSPLNVNARDTTGRKSTPLHFAAGFGRKDVVEHLLQNGANVHARDDGGLIPLHNACSFGHAEVVNLLLRQGADPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPGIRNTDGKTALDL--AEPTAKAVLTGEYKKDELLEAARSGNEEKL 316          

HSP 3 Score: 59.6918 bits (143), Expect = 1.696e-9
Identity = 31/88 (35.23%), Postives = 52/88 (59.09%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV---GSTEV 876
            ++ +D     P+  A S G+ ++ + L+ +GA VN    +K TPL+ AA  G  ++C++LL++GADP     D  TPLD+   G T++
Sbjct:  676 VHAKDKGGLVPLHNACSYGHYEVAELLVKRGAVVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDI 763          

HSP 4 Score: 55.4546 bits (132), Expect = 3.955e-8
Identity = 39/147 (26.53%), Postives = 77/147 (52.38%), Query Frame = 1
Query:  484 MIEAAFEGNLSEILSVLQLVEDDDNKQDIKRD-----FIGQN-IRKRHLLDM----INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLL 894
            ++EAA  GN  +++++L  +  + +  D ++        G N +R   LL      ++ +D     P+  A S G+ ++ + L+  GA+VN    ++ TPL+ AA    ++VC +LL  GADP +    +++ +D+  T  ++E L+
Sbjct:  304 LLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLVKHGASVNAMDLWQFTPLHEAASKNRVEVCSLLLSYGADPTLLNCHSKSAIDLAPTSELKERLV 450          

HSP 5 Score: 54.6842 bits (130), Expect = 6.598e-8
Identity = 29/81 (35.80%), Postives = 45/81 (55.56%), Query Frame = 1
Query:  649 TPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFL 891
            TP+  AS   + D++  L+  GA +N      +T L+RAA AGHL  C +LL +G DP + +    T   +G+ E V++ L
Sbjct:  525 TPLHVASDKAHNDVIDVLLKHGAKINVTDSLGQTSLHRAAHAGHLTTCRLLLSHGCDPNLPSLQGFTAAQLGN-ESVQQIL 604          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 4.942e-10
Identity = 34/86 (39.53%), Postives = 49/86 (56.98%), Query Frame = 1
Query:  646 NTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFL 891
            NT +  A+  G  D+V+ L++ GAN+N + Q   TPLY AA   HL++ + LL NGA+  +  +D  TPL V    G  +VV   L
Sbjct:   78 NTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLL 163          

HSP 2 Score: 57.3806 bits (137), Expect = 8.824e-9
Identity = 30/73 (41.10%), Postives = 40/73 (54.79%), Query Frame = 1
Query:  649 TPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGS 867
            TP+  AS  G A++VQ L+ +G++ N       TPLY A+  GH DV  +LL NGAD         TPL + S
Sbjct:  471 TPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIAS 543          

HSP 3 Score: 56.6102 bits (135), Expect = 1.390e-8
Identity = 33/85 (38.82%), Postives = 49/85 (57.65%), Query Frame = 1
Query:  649 TPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFL 891
            TPI  AS  G+ ++VQ L+  GA+ N       TPL+ A+ AG L+V + LL++GA   + A + QTPL +    G  E+V+  L
Sbjct:  405 TPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLL 489          

HSP 4 Score: 51.6026 bits (122), Expect = 5.677e-7
Identity = 27/83 (32.53%), Postives = 43/83 (51.81%), Query Frame = 1
Query:  625 NCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTE 873
            N  +    TP+  AS  G  ++V+ L+  GA V  K +  +TPL+ A+  G  ++ ++LL+ G+DP        TPL   S E
Sbjct:  430 NATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASRE 512          

HSP 5 Score: 51.2174 bits (121), Expect = 6.131e-7
Identity = 29/93 (31.18%), Postives = 48/93 (51.61%), Query Frame = 1
Query:  625 NCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFL 891
            N    N  TP+  A       +++ L+  GA+++   +   TP++ A+F GHL+V ++LL+NGA         +TPL +    G  EVV+  L
Sbjct:  364 NARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLL 456          

HSP 6 Score: 50.0618 bits (118), Expect = 1.407e-6
Identity = 28/83 (33.73%), Postives = 46/83 (55.42%), Query Frame = 1
Query:  625 NCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRN--GADPKIYADDAQTPLDVGS 867
            N   A+ +TP+  AS  G+ D+   L++ GA+++   +   TPL+ A+  G L+V  +LL     ADPK+   +  TPL V +
Sbjct:  496 NAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVAT 578          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.2326 bits (147), Expect = 5.916e-10
Identity = 34/86 (39.53%), Postives = 49/86 (56.98%), Query Frame = 1
Query:  646 NTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFL 891
            NT +  A+  G  D+V+ L++ GAN+N + Q   TPLY AA   HL++ + LL NGA+  +  +D  TPL V    G  +VV   L
Sbjct:   77 NTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLL 162          

HSP 2 Score: 58.151 bits (139), Expect = 4.749e-9
Identity = 50/187 (26.74%), Postives = 77/187 (41.18%), Query Frame = 1
Query:  649 TPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFLLNWDYLDTEKLLKKIQLHQEKLADEKKKRIEAELNNLDLQIAKAQKEHDSAQHRLQKAYCELNKRIYEHDKA-VDKGFEKIDITEKCIHDAEFESESARMDM 1194
            TP+  AS  G A++VQ L+ +G++ N       TPLY A+  GH DV  +LL NGAD         TPL +    G  EV    L  +   D +       LH     D +K  +        L + K    H +A++     +    K   E  K  ++ G E   +T++ +      ++    DM
Sbjct:  478 TPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVAL--------LLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADM 656          

HSP 3 Score: 56.9954 bits (136), Expect = 1.240e-8
Identity = 33/85 (38.82%), Postives = 49/85 (57.65%), Query Frame = 1
Query:  649 TPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFL 891
            TPI  AS  G+ ++VQ L+  GA+ N       TPL+ A+ AG L+V + LL++GA   + A + QTPL +    G  E+V+  L
Sbjct:  412 TPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLL 496          

HSP 4 Score: 51.6026 bits (122), Expect = 4.633e-7
Identity = 27/83 (32.53%), Postives = 43/83 (51.81%), Query Frame = 1
Query:  625 NCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTE 873
            N  +    TP+  AS  G  ++V+ L+  GA V  K +  +TPL+ A+  G  ++ ++LL+ G+DP        TPL   S E
Sbjct:  437 NATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASRE 519          

HSP 5 Score: 51.2174 bits (121), Expect = 7.046e-7
Identity = 29/93 (31.18%), Postives = 48/93 (51.61%), Query Frame = 1
Query:  625 NCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFL 891
            N    N  TP+  A       +++ L+  GA+++   +   TP++ A+F GHL+V ++LL+NGA         +TPL +    G  EVV+  L
Sbjct:  371 NARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLL 463          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002048.1 (pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 gene:ENSPMAG00000001850.1 transcript:ENSPMAT00000002048.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 1.171e-9
Identity = 39/98 (39.80%), Postives = 61/98 (62.24%), Query Frame = 1
Query:  613 LDMINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQ-TPLDV---GSTEVVREFLL 894
            +D I+ E +N +T ++ A +GG+ DLV  LI +GAN+  + +   TPL  AA AGH++V E+LL NGAD +  ++  + TPL +   G  + V E L+
Sbjct:  924 IDCIHTE-SNHDTALTLACAGGHEDLVTVLIARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKDTPLSLACSGGRQEVVELLI 1020          

HSP 2 Score: 55.8398 bits (133), Expect = 3.210e-8
Identity = 35/96 (36.46%), Postives = 54/96 (56.25%), Query Frame = 1
Query:  625 NCEDANQ--NTPISEASSGGNADLVQFLIDKGANVNCKG-QFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFL 891
            N ED N+  +TP+ EA+SGG+ ++ + L+++GA +N    +FK + L  A + GHL++   LL  GAD +   D+  T L      G  EV R  L
Sbjct:  225 NLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLL 320          

HSP 3 Score: 55.8398 bits (133), Expect = 3.266e-8
Identity = 32/85 (37.65%), Postives = 45/85 (52.94%), Query Frame = 1
Query:  649 TPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPL----DVGSTEVVREFL 891
            TP+  A+SGG  D+V+ L+  GA+VN +     T L  A   G++DV  VLL  GA+ + + +   TPL      G  EV R  L
Sbjct:  169 TPLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLL 253          

HSP 4 Score: 53.1434 bits (126), Expect = 2.114e-7
Identity = 24/73 (32.88%), Postives = 43/73 (58.90%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADD 840
            +N + +  NT ++ A +GG  D+V+ L++ GAN+    +   TPL  AA  GH++V  +LL  GA    ++++
Sbjct:  193 VNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNE 265          

HSP 5 Score: 52.7582 bits (125), Expect = 2.282e-7
Identity = 37/97 (38.14%), Postives = 49/97 (50.52%), Query Frame = 1
Query:  631 EDANQNTPISEASSGGNADLVQFLIDKGANVN-CKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPL----DVGSTEVVREFLLNWDY 906
            E     TP+ +A+  G+   VQFLI KGA+VN        T L  A   GHL V E+LL +GADP     D  T L      G T VV  +L+++ +
Sbjct:  492 ESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGADPNHRLKDGSTMLIEAAKGGHTSVVC-YLIDYPH 587          

HSP 6 Score: 50.447 bits (119), Expect = 1.310e-6
Identity = 27/70 (38.57%), Postives = 43/70 (61.43%), Query Frame = 1
Query:  646 NTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPL 855
            +TP+ EA+  G+ +LV++L+  GANV+       T L  A   GH DV ++LL+ GAD +  ++  +TPL
Sbjct:  431 STPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPL 500          

HSP 7 Score: 48.9062 bits (115), Expect = 3.610e-6
Identity = 37/117 (31.62%), Postives = 54/117 (46.15%), Query Frame = 1
Query:  649 TPISEASSGGNADLVQFLIDKGANVNC----------------KGQFK-------------------RTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVR 882
            TP+ EA+SGG A++ + L+++GA+VN                 KG +K                    TPL+ AA  GHLDV ++L+ +GAD     +   TPL      G  +VVR
Sbjct: 1137 TPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVR 1253          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003902.1 (pep scaffold:Pmarinus_7.0:GL487589:3324:8008:1 gene:ENSPMAG00000003575.1 transcript:ENSPMAT00000003902.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 3.670e-9
Identity = 29/83 (34.94%), Postives = 43/83 (51.81%), Query Frame = 1
Query:  619 MINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGS 867
            ++ C D    TP+  A SG   D V+ L+  G ++N +    RTPL  AA+ G L+ C  LLRNGA   +   + + PL   +
Sbjct:   34 ILECCDNEGFTPLMHAVSGRRLDTVKLLLKMGTSINTQDACGRTPLSLAAYLGWLEGCLSLLRNGARQNMPDKNGRLPLHAAT 116          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 65.855 bits (159), Expect = 1.614e-11
Identity = 34/71 (47.89%), Postives = 46/71 (64.79%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKG--QFKRTPLYRAAFAGHLDVCEVLLRNGADPKI 828
            IN +D   NT + EA+  G+ ++V+ LI+ GA+VN K    F  TPL  A+  GHLDV + LL+NGADP I
Sbjct:  357 INDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTI 427          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Match: AKR1 (Palmitoyl transferase involved in protein palmitoylation; acts as a negative regulator of pheromone response pathway; required for endocytosis of pheromone receptors; involved in cell shape control; contains ankyrin repeats; AKR1 has a paralog, AKR2, that arose from the whole genome duplication; any of several human homologs encoding DHHC-type zinc fingers (ZDHHC) can complement temperature sensitivity of yeast akr1 null mutant [Source:SGD;Acc:S000002672])

HSP 1 Score: 47.3654 bits (111), Expect = 6.067e-6
Identity = 28/78 (35.90%), Postives = 47/78 (60.26%), Query Frame = 1
Query:  610 LLDMINCEDANQN-TPISEASSGGNADLVQFLIDKGANVNCK-GQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYAD 837
            LL++ N  D+ ++ T +  AS      +V FL+ +GA+VN + G    TPL+ AA  G++ + + LL++GADP +  D
Sbjct:   97 LLEVNNDGDSTEHITGLHWASINNRLSVVDFLVSQGADVNARAGALHATPLHWAARYGYVYIVDFLLKHGADPTMTDD 174          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO28821 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5E2])

HSP 1 Score: 134.806 bits (338), Expect = 2.355e-36
Identity = 59/133 (44.36%), Postives = 96/133 (72.18%), Query Frame = 1
Query: 1225 RLQKREKQKEEGLESGEETTKPGIECHIRELEDVIFKDVGNRLEMSGKWPLVVDPTGQAATFFRYRDTNYVNALDLSQMECNKLRMSLLGALRYGKTFIIDLMEVVQAFRSCVDRLSEIQDNLMDDIINKSIL 1623
            +L+ RE+ K++     EE  + GI+  IR+L+DV+F+D+G ++   G+WPL++DP+GQAA F RYRDTNY+NAL+ +Q+E   +R++LLGA+R+GK F++D+ME V  F + V +  ++Q  L+  I++K I 
Sbjct:   70 KLKLREQIKQDKKGESEENLQ-GIKVMIRDLDDVLFRDIGGKIAAGGRWPLLIDPSGQAAMFLRYRDTNYINALNPTQVEPEVIRLALLGAIRFGKPFVLDMME-VDMFDTMVMKFDDVQKGLLPSIMDKGIF 200          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO47820 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL87])

HSP 1 Score: 63.5438 bits (153), Expect = 2.505e-10
Identity = 34/86 (39.53%), Postives = 49/86 (56.98%), Query Frame = 1
Query:  634 DANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFL 891
            D ++ +PI  AS   N  +V  L+D G +VN +G   +TPL+ AA  GH  V  VL+ NGAD  +  D   + +DV S++ VR  L
Sbjct:  253 DGHRYSPIHLASKENNVPIVLALVDGGGDVNVRGCGGKTPLHIAASNGHQSVSGVLVENGADVTLVDDHGYSAMDVTSSQSVRRIL 338          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO30889 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZG9])

HSP 1 Score: 56.9954 bits (136), Expect = 5.048e-10
Identity = 27/77 (35.06%), Postives = 49/77 (63.64%), Query Frame = 1
Query:  634 DANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVG 864
            D + NTP+  A++ G  D+ + LIDK ++VN   +  ++PL+ +A  G  +V ++LL  GADP++    A+TP+++ 
Sbjct:   25 DHHGNTPLHCAAAAGRDDIAKLLIDKWSDVNALNKEDQSPLHLSARVGSSEVTQLLLDKGADPRLLDAQARTPMEMA 101          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO42780 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0Q6])

HSP 1 Score: 54.6842 bits (130), Expect = 1.673e-8
Identity = 33/90 (36.67%), Postives = 46/90 (51.11%), Query Frame = 1
Query:  598 RKRHLLDMINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGS 867
            R + L++ +N E     TP+  A S GN + VQFL   GA++N +    RTPL  AA+ G  D    LL  GAD  I  +  + PL   +
Sbjct:   36 RDKGLIEALNSEGM---TPLFVAVSTGNLECVQFLATSGASLNTRDNLGRTPLALAAYQGWNDGVYYLLAVGADSTIVDNCGRLPLHAAT 122          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Match: EDO39766 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S939])

HSP 1 Score: 56.225 bits (134), Expect = 2.813e-8
Identity = 31/95 (32.63%), Postives = 50/95 (52.63%), Query Frame = 1
Query:  622 INCEDA----NQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLL 894
            +NC       N  TP+  AS  G+ D+V+ LI  GA++N +     T L+ A+F G   V  +LL N AD  I   + +TP  V + + +++ +L
Sbjct:   48 VNCRGKSKANNGWTPVLLASYFGHKDVVEILIKAGADINAQNGMGYTALHLASFTGRTAVVLLLLENNADVTIINGEGKTPSQVANKDEIKQLIL 142          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000036832.1 (myotrophin [Source:NCBI gene;Acc:101157746])

HSP 1 Score: 63.929 bits (154), Expect = 5.615e-12
Identity = 30/84 (35.71%), Postives = 46/84 (54.76%), Query Frame = 1
Query:  640 NQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFL 891
            N   P+  AS  G+ D+V++LI  GA++N K ++  TPL  A F GHL   ++LL  GAD  I   + QT  +   +E ++   
Sbjct:   35 NGRNPLHVASDYGHVDVVEYLISVGADINAKDKYGFTPLISACFEGHLQCVKLLLEKGADRSIKGPNDQTAFEAADSEAIKALF 118          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000035606.1 (myotrophin [Source:NCBI gene;Acc:101157746])

HSP 1 Score: 63.929 bits (154), Expect = 5.615e-12
Identity = 30/84 (35.71%), Postives = 46/84 (54.76%), Query Frame = 1
Query:  640 NQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFL 891
            N   P+  AS  G+ D+V++LI  GA++N K ++  TPL  A F GHL   ++LL  GAD  I   + QT  +   +E ++   
Sbjct:   35 NGRNPLHVASDYGHVDVVEYLISVGADINAKDKYGFTPLISACFEGHLQCVKLLLEKGADRSIKGPNDQTAFEAADSEAIKALF 118          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000040233.1 (pep primary_assembly:ASM223467v1:19:16412534:16434057:1 gene:ENSORLG00000021910.1 transcript:ENSORLT00000040233.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 1.012e-10
Identity = 44/113 (38.94%), Postives = 59/113 (52.21%), Query Frame = 1
Query:  646 NTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFLLNWDYLDTEKLLKKIQLHQEKLADEKK 972
            NT +  AS  G  ++V+ L+  GANVN + Q   TPLY AA   HLDV ++LL NG+   I  +D  TPL V    G  +VV   L N    DT+  ++   LH     D+ K
Sbjct:   84 NTALHIASLAGQTEVVKELVSNGANVNAQSQNGFTPLYMAAQENHLDVVQLLLENGSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN----DTKGKVRLPALHIAARKDDTK 192          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ankef1a (ankyrin repeat and EF-hand domain containing 1 [Source:NCBI gene;Acc:101165612])

HSP 1 Score: 65.855 bits (159), Expect = 1.070e-10
Identity = 31/78 (39.74%), Postives = 50/78 (64.10%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPL 855
            ++ +D    TP+  A   G+ ++VQ+L+ KGA+VN   QF  TP++ AA AGH+++ E+L++ GAD    + D  TPL
Sbjct:  518 VDVQDTFFRTPMITACDSGSLEVVQYLLSKGADVNRGDQFFWTPIHHAAHAGHVEIVELLVKAGADVNAQSLDGGTPL 595          
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000038944.1 (tankyrase-1 [Source:NCBI gene;Acc:101158122])

HSP 1 Score: 65.4698 bits (158), Expect = 1.583e-10
Identity = 42/120 (35.00%), Postives = 65/120 (54.17%), Query Frame = 1
Query:  607 HLLDM---INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKLLKKIQLHQEKL 957
            HLL M   ++  D     P+  A S G++++V  L+ +GA  N +  +  TPL+ AA  G +DVC VLL++GADP I   D ++ LD+   E   + +L  +Y   E L      ++EKL
Sbjct:  181 HLLQMGANVHARDDGGLIPLHNACSFGHSEVVSLLLCQGAEPNARDNWNYTPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDL--AEPSAKAVLTGEYKKDELLEAARSGNEEKL 298          

HSP 2 Score: 63.929 bits (154), Expect = 4.089e-10
Identity = 31/92 (33.70%), Postives = 51/92 (55.43%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLN 897
            +N +D     P+  A+S G+ D+   LI     VN   ++  TPL+ AA  G   +C +LL +GADP +   + QTPLD+ + + +R  L++
Sbjct:  810 VNAQDKGGLIPLHNAASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLDLATADDIRALLID 901          

HSP 3 Score: 60.4622 bits (145), Expect = 5.085e-9
Identity = 31/88 (35.23%), Postives = 52/88 (59.09%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV---GSTEV 876
            ++ +D     P+  A S G+ ++ + L+  GA+VN    +K TPL+ AA  G  ++C++LL++GADP     D  TPLD+   G T++
Sbjct:  657 VHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKDGDTDI 744          

HSP 4 Score: 53.9138 bits (128), Expect = 5.418e-7
Identity = 39/146 (26.71%), Postives = 76/146 (52.05%), Query Frame = 1
Query:  484 MIEAAFEGNLSEILSVLQLVEDDDNKQDIKRD-----FIGQN-IRKRHLLDM----INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFL 891
            ++EAA  GN  +++++L  +  + +  D ++        G N +R   LL      ++ +D     P+  A S G+ ++ + L+  GA VN    ++ TPL+ AA    ++VC +LL +GADP +    +++ +D+  T  ++E L
Sbjct:  286 LLEAARSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLLNCHSKSSVDMAPTPELKERL 431          

HSP 5 Score: 50.447 bits (119), Expect = 7.300e-6
Identity = 29/81 (35.80%), Postives = 44/81 (54.32%), Query Frame = 1
Query:  649 TPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFL 891
            TP+  A+   + D+++ L   GA VN      +T L+RAA AGHL  C +LL  GAD  + +    T   +G+ E V++ L
Sbjct:  507 TPLHVAAERAHNDIMEVLQKHGAKVNALDTLGQTALHRAALAGHLQTCRLLLGYGADASLVSLQGFTAAQMGN-EAVQQIL 586          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000057916.1 (SMESG000057916.1)

HSP 1 Score: 814.683 bits (2103), Expect = 0.000e+0
Identity = 391/392 (99.74%), Postives = 392/392 (100.00%), Query Frame = 1
Query:  619 MINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKLLKKIQLHQEKLADEKKKRIEAELNNLDLQIAKAQKEHDSAQHRLQKAYCELNKRIYEHDKAVDKGFEKIDITEKCIHDAEFESESARMDMDKCRDKLSLLRLQKREKQKEEGLESGEETTKPGIECHIRELEDVIFKDVGNRLEMSGKWPLVVDPTGQAATFFRYRDTNYVNALDLSQMECNKLRMSLLGALRYGKTFIIDLMEVVQAFRSCVDRLSEIQDNLMDDIINKSILSFEKYSKLIRPNDDPEYDKNRFNNLRTKKFKFILLTSNSLPPNEILDLFHPVWVRIN 1794
            MINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKLLKKIQLHQEKLADEKKKRIEAELNNLDLQIAKAQKEHDSAQHRLQKAYCELNKRIYEHDKAVDKGFEKIDITEKCIHDAEFE+ESARMDMDKCRDKLSLLRLQKREKQKEEGLESGEETTKPGIECHIRELEDVIFKDVGNRLEMSGKWPLVVDPTGQAATFFRYRDTNYVNALDLSQMECNKLRMSLLGALRYGKTFIIDLMEVVQAFRSCVDRLSEIQDNLMDDIINKSILSFEKYSKLIRPNDDPEYDKNRFNNLRTKKFKFILLTSNSLPPNEILDLFHPVWVRIN
Sbjct:    1 MINCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVGSTEVVREFLLNWDYLDTEKLLKKIQLHQEKLADEKKKRIEAELNNLDLQIAKAQKEHDSAQHRLQKAYCELNKRIYEHDKAVDKGFEKIDITEKCIHDAEFEAESARMDMDKCRDKLSLLRLQKREKQKEEGLESGEETTKPGIECHIRELEDVIFKDVGNRLEMSGKWPLVVDPTGQAATFFRYRDTNYVNALDLSQMECNKLRMSLLGALRYGKTFIIDLMEVVQAFRSCVDRLSEIQDNLMDDIINKSILSFEKYSKLIRPNDDPEYDKNRFNNLRTKKFKFILLTSNSLPPNEILDLFHPVWVRIN 392          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000057915.1 (SMESG000057915.1)

HSP 1 Score: 175.637 bits (444), Expect = 2.125e-51
Identity = 124/126 (98.41%), Postives = 126/126 (100.00%), Query Frame = 1
Query:  166 VIKTVSKNSHSGSLNKKPILTTTEKVWTEKDDKAVIIQKLVRQFLSKTRLKKLKIEKMEYENKMEELERKAYLEIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAMIEAAFEGNLSEILSVLQLV 543
            VIKTVSKNSHSGSLNKKP+LTTTEKVWTEKDDKAVIIQKLVRQFLSKTRL+KLKIEKMEYENKMEELERKAYLEIVKREQQENERQRKIEEEEKRKVVENKRRKKAMIEAAFEGNLSEILSVLQLV
Sbjct:   22 VIKTVSKNSHSGSLNKKPVLTTTEKVWTEKDDKAVIIQKLVRQFLSKTRLEKLKIEKMEYENKMEELERKAYLEIVKREQQENERQRKIEEEEKRKVVENKRRKKAMIEAAFEGNLSEILSVLQLV 147          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000076390.1 (SMESG000076390.1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.954e-13
Identity = 30/81 (37.04%), Postives = 49/81 (60.49%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVG 864
            I CED  QN PI  AS  G+AD+V+ LID+  N+ C+   +  P++ A++ GH ++ ++L+ N    +    D +TPLD+ 
Sbjct:   62 IECEDKWQNRPIHWASWNGHADVVRLLIDRNCNIECENDGQWRPIHYASWNGHAEIIQLLMLNKCQIECKTKDGETPLDLA 142          

HSP 2 Score: 47.3654 bits (111), Expect = 5.387e-6
Identity = 24/92 (26.09%), Postives = 45/92 (48.91%), Query Frame = 1
Query:  634 DANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFLLN 897
            DA    PI  A   G   +VQ L++   N+ C+ +++  P++ A++ GH DV  +L+    + +   D    P+      G  E+++  +LN
Sbjct:   33 DAEGKLPIHIACEKGFFSIVQLLMEHNCNIECEDKWQNRPIHWASWNGHADVVRLLIDRNCNIECENDGQWRPIHYASWNGHAEIIQLLMLN 124          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000076390.1 (SMESG000076390.1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.655e-12
Identity = 32/88 (36.36%), Postives = 53/88 (60.23%), Query Frame = 1
Query:  604 RHLLDM-INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVG 864
            R L+D  I CE+  QN PI  AS  G+AD+V+ LID+  N+ C+   +  P++ A++ GH ++ ++L+ N    +    D +TPLD+ 
Sbjct:   86 RLLIDCNIECENDGQNRPIHWASWNGHADVVRLLIDRNCNIECENDGQWRPIHYASWNGHAEIIQLLMLNKCQIECKTKDGETPLDLA 173          

HSP 2 Score: 55.8398 bits (133), Expect = 1.338e-8
Identity = 31/96 (32.29%), Postives = 50/96 (52.08%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDV----GSTEVVREFLLN 897
            I CED  Q  PI  AS  G+AD+V+ LID   N+ C+   +  P++ A++ GH DV  +L+    + +   D    P+      G  E+++  +LN
Sbjct:   62 IECEDKWQTRPIHYASVNGHADVVRLLID--CNIECENDGQNRPIHWASWNGHADVVRLLIDRNCNIECENDGQWRPIHYASWNGHAEIIQLLMLN 155          
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Match: SMESG000076390.1 (SMESG000076390.1)

HSP 1 Score: 67.781 bits (164), Expect = 6.715e-12
Identity = 30/81 (37.04%), Postives = 49/81 (60.49%), Query Frame = 1
Query:  622 INCEDANQNTPISEASSGGNADLVQFLIDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTPLDVG 864
            I CED  QN PI  AS  G+AD+V+ LID+  N+ C+   +  P++ A++ GH ++ ++L+ N    +    D +TPLD+ 
Sbjct:  238 IECEDKWQNRPIHWASWNGHADVVRLLIDRNCNIECENDGQWRPIHYASWNGHAEIIQLLMLNKCQIECKTKDGETPLDLA 318          
The following BLAST results are available for this feature:
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
IQANK19.647e-10237.21IQ motif and ankyrin repeat containing 1 [Source:H... [more]
ANK38.176e-1138.94ankyrin 3 [Source:HGNC Symbol;Acc:HGNC:494][more]
ANK11.181e-1039.02ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
TNKS1.292e-1035.00tankyrase [Source:HGNC Symbol;Acc:HGNC:11941][more]
TNKS1.503e-1039.77tankyrase [Source:HGNC Symbol;Acc:HGNC:11941][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C43H6.32.062e-1232.46pep chromosome:WBcel235:X:2407467:2409567:1 gene:W... [more]
unc-445.146e-837.50AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
unc-445.146e-837.50AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
fem-16.922e-835.42Sex-determining protein fem-1 [Source:UniProtKB/S... [more]
unc-442.155e-737.04AO49 ankyrin [Source:UniProtKB/TrEMBL;Acc:Q7JP86][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG31045.063e-1238.30gene:FBgn0031473 transcript:FBtr0335132[more]
CG31045.063e-1238.30gene:FBgn0031473 transcript:FBtr0077686[more]
CG31045.063e-1238.30gene:FBgn0031473 transcript:FBtr0077687[more]
Tnks1.676e-941.43gene:FBgn0027508 transcript:FBtr0330383[more]
Tnks2.580e-940.85gene:FBgn0027508 transcript:FBtr0084890[more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank3b9.216e-1239.82ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank3b9.655e-1239.82ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ank3b1.513e-1146.58ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ankrd394.844e-1141.56ankyrin repeat domain 39 [Source:ZFIN;Acc:ZDB-GENE... [more]
ankrd394.844e-1141.56ankyrin repeat domain 39 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
bcorl18.552e-1239.00BCL6 corepressor like 1 [Source:NCBI gene;Acc:1002... [more]
bcorl19.271e-1239.00BCL6 corepressor like 1 [Source:NCBI gene;Acc:1002... [more]
anks61.659e-1136.45ankyrin repeat and sterile alpha motif domain cont... [more]
anks62.248e-1136.45ankyrin repeat and sterile alpha motif domain cont... [more]
anks62.729e-1136.45ankyrin repeat and sterile alpha motif domain cont... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Iqank12.223e-12340.33IQ motif and ankyrin repeat containing 1 [Source:M... [more]
Iqank12.198e-3249.58IQ motif and ankyrin repeat containing 1 [Source:M... [more]
Ank34.858e-1138.94ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank37.456e-1138.94ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Tnks1.067e-1039.77tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8MXQ7|YH010_HUMAN9.753e-9735.75Putative IQ motif and ankyrin repeat domain-contai... [more]
sp|Q3TYL0|YH010_MOUSE7.940e-3942.98Putative IQ motif and ankyrin repeat domain-contai... [more]
sp|O95271|TNKS1_HUMAN7.219e-1039.77Poly [ADP-ribose] polymerase tankyrase-1 OS=Homo s... [more]
sp|Q6PFX9|TNKS1_MOUSE7.460e-1039.77Poly [ADP-ribose] polymerase tankyrase-1 OS=Mus mu... [more]
sp|P16157|ANK1_HUMAN9.261e-1039.02Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HW651.974e-16149.90putative IQ motif and ankyrin repeat domain-contai... [more]
K1S0J42.615e-15349.23ANK_REP_REGION domain-containing protein OS=Crasso... [more]
A0A433SUC43.987e-15248.06ANK_REP_REGION domain-containing protein OS=Elysia... [more]
A0A2C9KSV22.255e-15146.10ANK_REP_REGION domain-containing protein OS=Biomph... [more]
V4ALM52.770e-15047.10ANK_REP_REGION domain-containing protein OS=Lottia... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tnksa1.935e-1029.76tankyrase, TRF1-interacting ankyrin-related ADP-ri... [more]
ank3b2.409e-1039.82ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ANKRD502.945e-1033.93ankyrin repeat domain 50 [Source:NCBI gene;Acc:103... [more]
ankef1a4.316e-1039.74ankyrin repeat and EF-hand domain-containing prote... [more]
ankef1a4.429e-1039.74ankyrin repeat and EF-hand domain-containing prote... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009608.11.257e-1135.64pep scaffold:Pmarinus_7.0:GL477242:23155:61557:-1 ... [more]
ENSPMAT00000000095.14.942e-1039.53pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000000093.15.916e-1039.53pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000002048.11.171e-939.80pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 g... [more]
ENSPMAT00000003902.13.670e-934.94pep scaffold:Pmarinus_7.0:GL487589:3324:8008:1 gen... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
HOS41.614e-1147.89Subunit of the Set3 complex; complex is a meiotic-... [more]
AKR16.067e-635.90Palmitoyl transferase involved in protein palmitoy... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO288212.355e-3644.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478202.505e-1039.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308895.048e-1035.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427801.673e-836.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO397662.813e-832.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000036832.15.615e-1235.71myotrophin [Source:NCBI gene;Acc:101157746][more]
ENSORLT00000035606.15.615e-1235.71myotrophin [Source:NCBI gene;Acc:101157746][more]
ENSORLT00000040233.11.012e-1038.94pep primary_assembly:ASM223467v1:19:16412534:16434... [more]
ankef1a1.070e-1039.74ankyrin repeat and EF-hand domain containing 1 [So... [more]
ENSORLT00000038944.11.583e-1035.00tankyrase-1 [Source:NCBI gene;Acc:101158122][more]
back to top
BLAST of ANK_REP_REGION domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057916.10.000e+099.74SMESG000057916.1[more]
SMESG000057915.12.125e-5198.41SMESG000057915.1[more]
SMESG000076390.16.954e-1337.04SMESG000076390.1[more]
SMESG000076390.12.655e-1236.36SMESG000076390.1[more]
SMESG000076390.16.715e-1237.04SMESG000076390.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021270 ID=SMED30021270|Name=ANK_REP_REGION domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1971bp
GAATTTTGACTGATTATTTTAAATAGTAAAATTACGTAATAATTTGATTC
ACAGAATTTTATTTTAATTAGTATACAATTAAAGTAATGCAATTATTTTT
TAATGGCCCCAAAAAAGGACAAAAAACCGAAACCGAAACCAACTCCATCT
AAAGTACCCCAGAAGGTTATTAAAACTGTGTCAAAAAATAGCCATTCGGG
ATCACTGAATAAAAAACCAATTCTAACTACAACTGAAAAAGTGTGGACTG
AAAAAGATGACAAAGCTGTTATTATTCAAAAATTGGTTAGACAGTTTTTG
TCTAAAACACGACTAAAGAAATTAAAAATAGAAAAAATGGAATACGAGAA
TAAAATGGAAGAATTAGAACGGAAAGCGTATTTGGAAATTGTTAAGCGAG
AACAACAAGAAAACGAAAGGCAACGAAAAATTGAAGAAGAAGAGAAACGA
AAAGTCGTGGAAAATAAACGAAGAAAGAAAGCAATGATTGAAGCGGCTTT
CGAAGGAAATTTATCTGAGATTTTGTCGGTGCTTCAGTTGGTCGAAGATG
ATGATAATAAACAAGATATCAAACGGGATTTCATCGGACAAAATATACGA
AAAAGACATTTATTAGATATGATAAATTGTGAAGATGCCAATCAAAACAC
GCCTATTTCAGAAGCTTCTAGTGGTGGAAATGCTGATCTGGTTCAATTTC
TTATTGATAAAGGAGCAAATGTCAATTGTAAAGGGCAATTTAAAAGAACA
CCACTCTACAGAGCGGCGTTTGCTGGTCATCTAGATGTTTGTGAAGTATT
ATTGCGCAACGGGGCTGATCCTAAAATATATGCAGATGATGCTCAGACAC
CATTGGATGTAGGATCCACAGAGGTTGTGAGAGAATTTCTATTAAACTGG
GATTACTTGGATACCGAAAAATTACTCAAAAAAATTCAACTCCACCAAGA
AAAGCTTGCTGATGAAAAGAAAAAGCGAATTGAAGCAGAATTAAATAATC
TTGACTTACAAATCGCAAAAGCACAGAAGGAACATGACAGTGCTCAGCAT
AGACTGCAAAAAGCTTACTGTGAGCTCAACAAACGAATTTATGAACACGA
TAAAGCCGTGGATAAAGGATTTGAAAAGATTGATATTACTGAGAAGTGCA
TACATGATGCTGAATTTGAGTCTGAATCTGCAAGAATGGATATGGATAAA
TGTCGAGATAAATTATCATTGTTGAGACTACAGAAACGTGAAAAACAAAA
GGAAGAAGGCTTAGAAAGTGGTGAAGAGACTACTAAACCGGGGATTGAGT
GTCACATTCGAGAATTAGAAGATGTGATATTTAAAGATGTTGGAAACAGA
CTTGAAATGTCTGGAAAGTGGCCATTAGTAGTTGACCCTACTGGTCAAGC
CGCCACGTTTTTCAGATATCGTGATACAAATTACGTCAATGCTCTTGATT
TGTCTCAAATGGAATGTAATAAATTGAGAATGTCTCTTTTGGGAGCACTT
AGATACGGAAAAACATTTATTATTGATTTAATGGAGGTTGTGCAAGCCTT
CCGAAGTTGTGTAGATCGATTGTCAGAAATCCAAGACAACTTAATGGATG
ACATAATCAATAAGTCTATATTATCATTTGAAAAATACTCAAAACTGATC
CGACCGAATGATGATCCAGAGTATGACAAAAACAGATTTAATAACTTACG
AACTAAAAAGTTTAAATTTATTTTGTTGACCAGTAACAGTTTGCCTCCAA
ATGAAATATTAGATTTGTTTCATCCTGTTTGGGTTCGAATTAATTGATAT
ATTTGTAGGAATATTCTGTTATTTTCAATAAATACACATAACAAACTGAG
ACACATGATTTCCGGACTACCCGATAAAAATGACTGGAATATTTGATGCT
ATTTTCCCAATGCCAATTATGTTGTTTTCTCGCAGCCCCAGTGAAATGTG
AGAAGTAGTTTTATTTGGAAC
back to top

protein sequence of SMED30021270-orf-1

>SMED30021270-orf-1 ID=SMED30021270-orf-1|Name=SMED30021270-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=565bp
MAPKKDKKPKPKPTPSKVPQKVIKTVSKNSHSGSLNKKPILTTTEKVWTE
KDDKAVIIQKLVRQFLSKTRLKKLKIEKMEYENKMEELERKAYLEIVKRE
QQENERQRKIEEEEKRKVVENKRRKKAMIEAAFEGNLSEILSVLQLVEDD
DNKQDIKRDFIGQNIRKRHLLDMINCEDANQNTPISEASSGGNADLVQFL
IDKGANVNCKGQFKRTPLYRAAFAGHLDVCEVLLRNGADPKIYADDAQTP
LDVGSTEVVREFLLNWDYLDTEKLLKKIQLHQEKLADEKKKRIEAELNNL
DLQIAKAQKEHDSAQHRLQKAYCELNKRIYEHDKAVDKGFEKIDITEKCI
HDAEFESESARMDMDKCRDKLSLLRLQKREKQKEEGLESGEETTKPGIEC
HIRELEDVIFKDVGNRLEMSGKWPLVVDPTGQAATFFRYRDTNYVNALDL
SQMECNKLRMSLLGALRYGKTFIIDLMEVVQAFRSCVDRLSEIQDNLMDD
IINKSILSFEKYSKLIRPNDDPEYDKNRFNNLRTKKFKFILLTSNSLPPN
EILDLFHPVWVRIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003676nucleic acid binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0045087innate immune response
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 71..122
NoneNo IPR availableCOILSCoilCoilcoord: 271..324
NoneNo IPR availableCOILSCoilCoilcoord: 364..384
NoneNo IPR availableGENE3DG3DSA:3.40.50.11510coord: 407..507
e-value: 4.0E-5
score: 25.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 20..38
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..38
NoneNo IPR availablePANTHERPTHR24189:SF55IQ MOTIF AND ANKYRIN REPEAT DOMAIN-CONTAINING PROTEIN LOC642574-RELATEDcoord: 37..470
NoneNo IPR availablePANTHERPTHR24189FAMILY NOT NAMEDcoord: 37..470
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 213..242
e-value: 7.6E-4
score: 28.8
coord: 180..209
e-value: 5.8E-4
score: 29.2
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 213..245
score: 10.686
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 180..212
score: 11.167
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 85..265
e-value: 3.0E-29
score: 103.6
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 117..261
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 175..242
e-value: 1.2E-10
score: 41.8
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 180..251
score: 22.012