Uncoordinated 5

Overview
NameUncoordinated 5
Smed IDSMED30021266
Length (bp)3408
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Uncoordinated 5 (SMED30021266) t-SNE clustered cells

Violin plots show distribution of expression levels for Uncoordinated 5 (SMED30021266) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Uncoordinated 5 (SMED30021266) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Uncoordinated 5 (SMED30021266) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021266

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30021266SMESG000073898.1 SmedASXL_016591SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30021266SMESG000073898.1 dd_Smed_v4_10585_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30021266SMESG000073898.1 dd_Smed_v4_10585_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30021266SMESG000073898.1 dd_Smed_v4_10585_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30021266SMESG000073898.1 dd_Smed_v6_10585_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30021266SMESG000073898.1 SMED30021266smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30021266SMESG000073898.1 SMED30021266smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30021266SMESG000073898.1 OX_Smed_1.0.10326ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30021266SMESG000073898.1 dd_Smed_v4_10585_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal ventral margin of the whole animalSMED30021266SMESG000073898.1 dd_Smed_v4_10585_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal region of the epidermisSMED30021266SMESG000073898.1 dd_Smed_v4_10585_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Uncoordinated 5 vs. Ensembl Human
Match: UNC5D (unc-5 netrin receptor D [Source:HGNC Symbol;Acc:HGNC:18634])

HSP 1 Score: 278.485 bits (711), Expect = 5.568e-78
Identity = 248/959 (25.86%), Postives = 428/959 (44.63%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWF---SEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAIC---QKP----DPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNA----QDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQY---TYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGR 3005
            +P FI EP   Y + KS+P  + C A P   +  F  + ++ + N+ +SE  L           +  G + +  ++   +  +E F    +Y C C AW+ +   +K +K     A ++ +Y +  F+  P   ++     +VL C PP+  P ++V WLKN+E I +     +       LII++   SDSGNYTC+A +    ++S  A + V +   WS+WT+  AC +            C    ++R R C           C+G   +   C   C   +  W  WS W+ +C P C   R+R C +      GK C G  Q+  NC+  +C   +KP     P  +  +    +Y  L   +  + ++++ +      +    +     ++ S+   G  + +  K+ +    LLLN+  +  +   + ++     QD +   L+ E  + ++P+ ++     + +V  +      +  +++Y    +S T P  NN       ++ +    +   P  Q  S            LP+  EL T   G     GGRL +P +G+SL IP GAI   NS E+++++ +   ++   D  E+LLSP + CGPP   +  P  LTIPHCA++    WNI  L  R Q  +    W+E   V  V     + Y  LD  + H+++D      +TG   P++D +V  +L+V  F     + +D+ +RV+ + +T  A + V+  E    GQLL+  K L F  +   +   + D+    WR    +  Q   +S VW  N    Q +H    LE   PT +  SC I ++Q  L  ++ +++V      + R    I+  AQ  S   +Q         F++  + RQ++    D+       WQ LA    +N NL+YF+ + SPS  +L+LWE+R + +G +  L   L  IGR
Sbjct:   48 LPHFIEEPDDAYII-KSNPIALRCKARPAMQI-FFKCNGEWVHQNEHVSEETLD----------ESSGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWSHL-GTSKSRK-----ASVRIAYLRKNFEQDPQGREVPIEGMIVLHCRPPEGVPAAEVEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKRRSLSATVVVYVNGGWSSWTEWSACNV-----------RCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKITCTSLC-PVDGSWEVWSEWS-VCSPECEHLRIRECTAPPPRNGGKFCEGLSQESENCTDGLCILDKKPLHEIKPQSIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSQSDYGV----DVIDSSALTGGFQTFNFKTVRQGNSLLLNSAMQPDLTVSRTYSGPICLQDPLDKELMTES-SLFNPLSDI-----KVKVQSSFMVSLGVSERAEYHGKNHSRTFPHGNN-------HSFSTMHPRNKMPYIQNLS-----------SLPTRTELRTT--GVFGHLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQS-DGSEVLLSPEVTCGPPDMIVTTPFALTIPHCADVSSEHWNIH-LKKRTQQGK----WEE---VMSVEDESTSCYCLLDPFACHVLLDSFGTYALTG--EPITDCAVK-QLKVAVFGCMSCNSLDYNLRVYCVDNTPCAFQEVVSDERHQGGQLLEEPKLLHFKGNTFSLQISVLDIPPFLWRIKPFTACQEVPFSRVWCSNR---QPLHCAFSLERYTPTTTQLSCKICIRQ--LKGHEQILQVQTSILESERET--ITFFAQEDSTFPAQTG----PKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAVILNLWEARHQHDGDLDSLACALEEIGR 922          
BLAST of Uncoordinated 5 vs. Ensembl Human
Match: UNC5D (unc-5 netrin receptor D [Source:HGNC Symbol;Acc:HGNC:18634])

HSP 1 Score: 277.715 bits (709), Expect = 9.832e-78
Identity = 250/962 (25.99%), Postives = 429/962 (44.59%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWF---SEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAIC---QKP----DPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNA----QDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQY---TYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQT---VFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGR 3005
            +P FI EP   Y + KS+P  + C A P   +  F  + ++ + N+ +SE  L           +  G + +  ++   +  +E F    +Y C C AW+ +   +K +K     A ++ +Y +  F+  P   ++     +VL C PP+  P ++V WLKN+E I +     +       LII++   SDSGNYTC+A +    ++S  A + V +   WS+WT+  AC +            C    ++R R C           C+G   +   C   C   +  W  WS W+ +C P C   R+R C +      GK C G  Q+  NC+  +C   +KP     P  +  +    +Y  L   +  + ++++ +      +    +     ++ S+   G  + +  K+ +    LLLN+  +  +   + ++     QD +   L+ E  + ++P+ ++     + +V  +      +  +++Y    +S T P  NN       ++ +    +   P  Q  S            LP+  EL T   G     GGRL +P +G+SL IP GAI   NS E+++++ +   ++   D  E+LLSP + CGPP   +  P  LTIPHCA++    WNI  L  R Q  +    W+E   V  V     + Y  LD  + H+++D      +TG   P++D +V  +L+V  F     + +D+ +RV+ + +T  A + V+  E    GQLL+  K L F  +   +   + D+    WR    +  Q   +S VW    S  Q +H    LE   PT +  SC I ++Q  L  ++ +++V      + R    I+  AQ  S         P QT    F++  + RQ++    D+       WQ LA    +N NL+YF+ + SPS  +L+LWE+R + +G +  L   L  IGR
Sbjct:   53 LPHFIEEPDDAYII-KSNPIALRCKARPAMQI-FFKCNGEWVHQNEHVSEETLD----------ESSGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWSHL-GTSKSRK-----ASVRIAYLRKNFEQDPQGREVPIEGMIVLHCRPPEGVPAAEVEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKRRSLSATVVVYVNGGWSSWTEWSACNV-----------RCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKITCTSLC-PVDGSWEVWSEWS-VCSPECEHLRIRECTAPPPRNGGKFCEGLSQESENCTDGLCILDKKPLHEIKPQSIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSQSDYGV----DVIDSSALTGGFQTFNFKTVRQGNSLLLNSAMQPDLTVSRTYSGPICLQDPLDKELMTES-SLFNPLSDI-----KVKVQSSFMVSLGVSERAEYHGKNHSRTFPHGNN-------HSFSTMHPRNKMPYIQNLS-----------SLPTRTELRTT--GVFGHLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQS-DGSEVLLSPEVTCGPPDMIVTTPFALTIPHCADVSSEHWNIH-LKKRTQQGK----WEE---VMSVEDESTSCYCLLDPFACHVLLDSFGTYALTG--EPITDCAVK-QLKVAVFGCMSCNSLDYNLRVYCVDNTPCAFQEVVSDERHQGGQLLEEPKLLHFKGNTFSLQISVLDIPPFLWRIKPFTACQEVPFSRVW---CSNRQPLHCAFSLERYTPTTTQLSCKICIRQ--LKGHEQILQVQTSILESERET--ITFFAQEDS-------TFPAQTGPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAVILNLWEARHQHDGDLDSLACALEEIGR 927          
BLAST of Uncoordinated 5 vs. Ensembl Human
Match: UNC5D (unc-5 netrin receptor D [Source:HGNC Symbol;Acc:HGNC:18634])

HSP 1 Score: 276.174 bits (705), Expect = 3.169e-77
Identity = 251/963 (26.06%), Postives = 425/963 (44.13%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWF---SEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAIC-QKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRG-------MVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNA----QDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQY---TYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQT---VFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGR 3005
            +P FI EP   Y + KS+P  + C A P   +  F  + ++ + N+ +SE  L           +  G + +  ++   +  +E F    +Y C C AW+ +   +K +K     A ++ +Y +  F+  P   ++     +VL C PP+  P ++V WLKN+E I +     +       LII++   SDSGNYTC+A +    ++S  A + V +   WS+WT+  AC +            C    ++R R C           C+G   +   C   C   +  W  WS W+ +C P C   R+R C +      GK C G  Q+  NC+  +C     P   ++ Q  +       +   L+  +   +  +        L RR        ++ S+   G  + +  K+ +    LLLN+  +  +   + ++     QD +   L+ E  + ++P+ ++     + +V  +      +  +++Y    +S T P  NN       ++ +    +   P  Q  S            LP+  EL T   G     GGRL +P +G+SL IP GAI   NS E+++++ +   ++   D  E+LLSP + CGPP   +  P  LTIPHCA++    WNI  L  R Q  +    W+E   V  V     + Y  LD  + H+++D      +TG   P++D +V  +L+V  F     + +D+ +RV+ + +T  A + V+  E    GQLL+  K L F  +   +   + D+    WR    +  Q   +S VW    S  Q +H    LE   PT +  SC I ++Q  L  ++ +++V      + R    I+  AQ  S         P QT    F++  + RQ++    D+       WQ LA    +N NL+YF+ + SPS  +L+LWE+R + +G +  L   L  IGR
Sbjct:   53 LPHFIEEPDDAYII-KSNPIALRCKARPAMQI-FFKCNGEWVHQNEHVSEETLD----------ESSGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWSHL-GTSKSRK-----ASVRIAYLRKNFEQDPQGREVPIEGMIVLHCRPPEGVPAAEVEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKRRSLSATVVVYVNGGWSSWTEWSACNV-----------RCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKITCTSLC-PVDGSWEVWSEWS-VCSPECEHLRIRECTAPPPRNGGKFCEGLSQESENCTDGLCILDKKPLHEIKPQRWSRRGIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSQSDYGVDVIDSSALTGGFQTFNFKTVRQGNSLLLNSAMQPDLTVSRTYSGPICLQDPLDKELMTES-SLFNPLSDI-----KVKVQSSFMVSLGVSERAEYHGKNHSRTFPHGNN-------HSFSTMHPRNKMPYIQNLS-----------SLPTRTELRTT--GVFGHLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQS-DGSEVLLSPEVTCGPPDMIVTTPFALTIPHCADVSSEHWNIH-LKKRTQQGK----WEE---VMSVEDESTSCYCLLDPFACHVLLDSFGTYALTG--EPITDCAVK-QLKVAVFGCMSCNSLDYNLRVYCVDNTPCAFQEVVSDERHQGGQLLEEPKLLHFKGNTFSLQISVLDIPPFLWRIKPFTACQEVPFSRVW---CSNRQPLHCAFSLERYTPTTTQLSCKICIRQ--LKGHEQILQVQTSILESERET--ITFFAQEDS-------TFPAQTGPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAVILNLWEARHQHDGDLDSLACALEEIGR 932          
BLAST of Uncoordinated 5 vs. Ensembl Human
Match: UNC5C (unc-5 netrin receptor C [Source:HGNC Symbol;Acc:HGNC:12569])

HSP 1 Score: 264.618 bits (675), Expect = 1.368e-73
Identity = 234/970 (24.12%), Postives = 422/970 (43.51%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFC----ADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFS--EYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELIT---NSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAICQKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVAT--SLLNEMPNNYSPVYEMHSHNNRDQVLPA-IYSEYPIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLG-WRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTV--------FRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQE 3035
            +P F++EP+  Y V K+ P  + C A P + +   C      ++   +++ + E+   +V+              + S  +  + + E F   +Y C C AW+      K +K     A ++ +Y +  F+  P   +++  ++++L C PP+  P ++V WLKN+++I    + N+  +TID    LII++   SD+ NYTCVA++    +KS  A + V +   WS WT+   C              C    ++R R C           C+G   +   C   C   + +W  WS W+T C   C+  R R C +      GK C G   Q +NC+  +C +  P    +S    +Y+ + I + +                 IS++    +   NH +  + I  + +        LN   +   V IK    QD++A    L +       PVY +H  +++  +  + I    P +    Y  S        P      +   L+ +   + L  E      +  L +  L    +    A+G+  + GG L +P SG+SL IP GAI  G   EM++ V R     P +D  + LL+PV+ CGPP   L +P++LT+ HCA+    DW I + +   Q       W+++  V   N +    Y QLD+ + H++ ++L    + G     +  + + RL++  F     S +++ IRV+ + DT++A++ ++  E ++ GQLL+  K L F  S  ++   + D++   W+    +K Q   +  VW       + +H              C  T+++  L   + V ++   +      +  ++              LDP  T+        F +    RQ+L   LD+       W+ LA+ + L+  LNYF+ K SP+  +LDLWE++   +G ++ L  +L  +GR++  + +  E
Sbjct:   20 LPHFLIEPEEAYIV-KNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVR--------------EVSIEISRQQVEELFGPEDYWCQCVAWSS-AGTTKSRK-----AYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNF-YITIDH--NLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWSVC-----------NSRCGRGYQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLC-PVDGRWTPWSKWST-CGTECTHWRRRECTAPAPKNGGKDCDGLVLQSKNCTDGLCMQTAP----DSDDVALYVGIVIAVIVCLA--------------ISVVVALFVYRKNHRDFESDIIDSSA--------LNGGFQP--VNIKAAR-QDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNTSGAV----TPQDDLSEFTSKLSPQMTQSLLENE------ALSLKNQSLARQTDPSCTAFGSFNSLGGHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGALLTRPVVLTMHHCADPNTEDWKILLKNQAAQGQ-----WEDVVVVGEENFTTP-CYIQLDAEACHILTENLSTYALVG---HSTTKAAAKRLKLAIFGPLCCSSLEYSIRVYCLDDTQDALKEILHLERQMGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVWS---GSQRNLH--------------CTFTLERFSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPANTITTVTGPSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAE 887          
BLAST of Uncoordinated 5 vs. Ensembl Human
Match: UNC5C (unc-5 netrin receptor C [Source:HGNC Symbol;Acc:HGNC:12569])

HSP 1 Score: 264.618 bits (675), Expect = 2.478e-73
Identity = 234/970 (24.12%), Postives = 422/970 (43.51%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFC----ADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFS--EYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELIT---NSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAICQKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVAT--SLLNEMPNNYSPVYEMHSHNNRDQVLPA-IYSEYPIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLG-WRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTV--------FRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQE 3035
            +P F++EP+  Y V K+ P  + C A P + +   C      ++   +++ + E+   +V+              + S  +  + + E F   +Y C C AW+      K +K     A ++ +Y +  F+  P   +++  ++++L C PP+  P ++V WLKN+++I    + N+  +TID    LII++   SD+ NYTCVA++    +KS  A + V +   WS WT+   C              C    ++R R C           C+G   +   C   C   + +W  WS W+T C   C+  R R C +      GK C G   Q +NC+  +C +  P    +S    +Y+ + I + +                 IS++    +   NH +  + I  + +        LN   +   V IK    QD++A    L +       PVY +H  +++  +  + I    P +    Y  S        P      +   L+ +   + L  E      +  L +  L    +    A+G+  + GG L +P SG+SL IP GAI  G   EM++ V R     P +D  + LL+PV+ CGPP   L +P++LT+ HCA+    DW I + +   Q       W+++  V   N +    Y QLD+ + H++ ++L    + G     +  + + RL++  F     S +++ IRV+ + DT++A++ ++  E ++ GQLL+  K L F  S  ++   + D++   W+    +K Q   +  VW       + +H              C  T+++  L   + V ++   +      +  ++              LDP  T+        F +    RQ+L   LD+       W+ LA+ + L+  LNYF+ K SP+  +LDLWE++   +G ++ L  +L  +GR++  + +  E
Sbjct:   61 LPHFLIEPEEAYIV-KNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVR--------------EVSIEISRQQVEELFGPEDYWCQCVAWSS-AGTTKSRK-----AYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNF-YITIDH--NLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWSVC-----------NSRCGRGYQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLC-PVDGRWTPWSKWST-CGTECTHWRRRECTAPAPKNGGKDCDGLVLQSKNCTDGLCMQTAP----DSDDVALYVGIVIAVIVCLA--------------ISVVVALFVYRKNHRDFESDIIDSSA--------LNGGFQP--VNIKAAR-QDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNTSGAV----TPQDDLSEFTSKLSPQMTQSLLENE------ALSLKNQSLARQTDPSCTAFGSFNSLGGHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGALLTRPVVLTMHHCADPNTEDWKILLKNQAAQGQ-----WEDVVVVGEENFTTP-CYIQLDAEACHILTENLSTYALVG---HSTTKAAAKRLKLAIFGPLCCSSLEYSIRVYCLDDTQDALKEILHLERQMGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVWS---GSQRNLH--------------CTFTLERFSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPANTITTVTGPSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAE 928          
BLAST of Uncoordinated 5 vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 92.8189 bits (229), Expect = 7.989e-19
Identity = 69/253 (27.27%), Postives = 108/253 (42.69%), Query Frame = 3
Query:  492 YKCYCEAWNRIVSINKDKKV-HSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEA-----CPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRC------ESGK-CFGPKQQIRNCSQAIC 1211
            ++C C A     S + D+ V  S  A +  +Y +  F  SP   ++ EG  L L C  P+S P +++TW K+  ++      +   D    LI+     SDSGNYTC A +    +K+    + + +   WS W+         CPL+     +         ++RR R C       D   CKG +     C + C K +  W+SWS W+  C  +C + R R C        G+ CFG     + C   +C
Sbjct:  110 FQCQCYA-----SGDDDQDVVASDVATVHLAYMRKHFLKSPVAQRVQEGTTLQLPCQAPESDPKAELTWYKDGVVVQPDANVIRASD--GSLIMSAARLSDSGNYTCEATNVANSRKTDPVEVQIYVDGGWSEWSPWIGTCHVDCPLLRQHAHRIRDPHDVLPHQRRTRTCNNPAPLNDGEYCKGEEEMTRSCKVPC-KLDGGWSSWSDWSA-CSSSCHRYRTRACTVPPPMNGGQPCFGDDLMTQECPAQLC 353          

HSP 2 Score: 91.6633 bits (226), Expect = 1.858e-18
Identity = 106/444 (23.87%), Postives = 192/444 (43.24%), Query Frame = 3
Query: 1803 ETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCG------PPHTRLLK-PIILTIPHCANIQCSD-WNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSIS--------AHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDH--LIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRV-VKERALNNRSLV------PISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLD------SSWQTLANHMLLNGNLNYFSE--KKSPSDALLDLWESRCREEG-AIADLINILRVIGRNDCAMIVEQ 3032
            + +    I + G RL L +SG  L +P  A+     + ++LAV     + P +  +E  LSPVI+ G        H  +L+ P++++  HCA+    D W   + +           W++  T+   N  + N++ Q +            H++   L  + + G     + LS + R+ +  F     S       +RV+ +P+T  A+E+V   E     +LL  S     +  G ++  C++D+  G+ C             V  ++ +Q++ +          ++G  C++  +  ++  +Q   RV V ++A +   +V      P   DA S  RE     ++     FRL    + +L  LLD      S W+ LA  +  +  L +F+     SP+  LLDLWE+       A+ DL+  LRV+GR D  M++E+
Sbjct:  529 QNIVAAQIDSNGARLSLSKSGARLIVPELAVE--GEKMLYLAVSDTLTDQPHLKPIESALSPVIVIGQCDVSMSAHDNILRRPVVVSFRHCASTFPRDNWQFTLYADEGSG------WQKAVTIGEENL-NTNMFVQFEQPGKKNDGFGWCHVMTYSLARLMLAG-HPRRNSLSAAKRVHLAVFGPTEMSAYRRPFELRVYCVPETGAAMESVWKQED--GSRLLCESNDFILNEKG-NLCICIEDVIPGFSCDG---------PEVVEISETQHRFV---------AQNGLHCSLKFRPKEINGSQFSTRVIVYQKASSTEPMVMEVSNEPELYDATSEEREKGSVCVE-----FRLPFGVKDELARLLDMPNESHSDWRGLAKKLHYDRYLQFFASFPDCSPTSLLLDLWEASSSGSARAVPDLLQTLRVMGRPDAVMVLER 936          
BLAST of Uncoordinated 5 vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 92.8189 bits (229), Expect = 8.294e-19
Identity = 69/253 (27.27%), Postives = 108/253 (42.69%), Query Frame = 3
Query:  492 YKCYCEAWNRIVSINKDKKV-HSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEA-----CPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRC------ESGK-CFGPKQQIRNCSQAIC 1211
            ++C C A     S + D+ V  S  A +  +Y +  F  SP   ++ EG  L L C  P+S P +++TW K+  ++      +   D    LI+     SDSGNYTC A +    +K+    + + +   WS W+         CPL+     +         ++RR R C       D   CKG +     C + C K +  W+SWS W+  C  +C + R R C        G+ CFG     + C   +C
Sbjct:   82 FQCQCYA-----SGDDDQDVVASDVATVHLAYMRKHFLKSPVAQRVQEGTTLQLPCQAPESDPKAELTWYKDGVVVQPDANVIRASD--GSLIMSAARLSDSGNYTCEATNVANSRKTDPVEVQIYVDGGWSEWSPWIGTCHVDCPLLRQHAHRIRDPHDVLPHQRRTRTCNNPAPLNDGEYCKGEEEMTRSCKVPC-KLDGGWSSWSDWSA-CSSSCHRYRTRACTVPPPMNGGQPCFGDDLMTQECPAQLC 325          

HSP 2 Score: 91.6633 bits (226), Expect = 2.014e-18
Identity = 106/444 (23.87%), Postives = 192/444 (43.24%), Query Frame = 3
Query: 1803 ETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCG------PPHTRLLK-PIILTIPHCANIQCSD-WNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSIS--------AHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDH--LIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRV-VKERALNNRSLV------PISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLD------SSWQTLANHMLLNGNLNYFSE--KKSPSDALLDLWESRCREEG-AIADLINILRVIGRNDCAMIVEQ 3032
            + +    I + G RL L +SG  L +P  A+     + ++LAV     + P +  +E  LSPVI+ G        H  +L+ P++++  HCA+    D W   + +           W++  T+   N  + N++ Q +            H++   L  + + G     + LS + R+ +  F     S       +RV+ +P+T  A+E+V   E     +LL  S     +  G ++  C++D+  G+ C             V  ++ +Q++ +          ++G  C++  +  ++  +Q   RV V ++A +   +V      P   DA S  RE     ++     FRL    + +L  LLD      S W+ LA  +  +  L +F+     SP+  LLDLWE+       A+ DL+  LRV+GR D  M++E+
Sbjct:  501 QNIVAAQIDSNGARLSLSKSGARLIVPELAVE--GEKMLYLAVSDTLTDQPHLKPIESALSPVIVIGQCDVSMSAHDNILRRPVVVSFRHCASTFPRDNWQFTLYADEGSG------WQKAVTIGEENL-NTNMFVQFEQPGKKNDGFGWCHVMTYSLARLMLAG-HPRRNSLSAAKRVHLAVFGPTEMSAYRRPFELRVYCVPETGAAMESVWKQED--GSRLLCESNDFILNEKG-NLCICIEDVIPGFSCDG---------PEVVEISETQHRFV---------AQNGLHCSLKFRPKEINGSQFSTRVIVYQKASSTEPMVMEVSNEPELYDATSEEREKGSVCVE-----FRLPFGVKDELARLLDMPNESHSDWRGLAKKLHYDRYLQFFASFPDCSPTSLLLDLWEASSSGSARAVPDLLQTLRVMGRPDAVMVLER 908          
BLAST of Uncoordinated 5 vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 92.0485 bits (227), Expect = 1.135e-18
Identity = 106/444 (23.87%), Postives = 192/444 (43.24%), Query Frame = 3
Query: 1803 ETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCG------PPHTRLLK-PIILTIPHCANIQCSD-WNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSIS--------AHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDH--LIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRV-VKERALNNRSLV------PISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLD------SSWQTLANHMLLNGNLNYFSE--KKSPSDALLDLWESRCREEG-AIADLINILRVIGRNDCAMIVEQ 3032
            + +    I + G RL L +SG  L +P  A+     + ++LAV     + P +  +E  LSPVI+ G        H  +L+ P++++  HCA+    D W   + +           W++  T+   N  + N++ Q +            H++   L  + + G     + LS + R+ +  F     S       +RV+ +P+T  A+E+V   E     +LL  S     +  G ++  C++D+  G+ C             V  ++ +Q++ +          ++G  C++  +  ++  +Q   RV V ++A +   +V      P   DA S  RE     ++     FRL    + +L  LLD      S W+ LA  +  +  L +F+     SP+  LLDLWE+       A+ DL+  LRV+GR D  M++E+
Sbjct:  334 QNIVAAQIDSNGARLSLSKSGARLIVPELAVE--GEKMLYLAVSDTLTDQPHLKPIESALSPVIVIGQCDVSMSAHDNILRRPVVVSFRHCASTFPRDNWQFTLYADEGSG------WQKAVTIGEENL-NTNMFVQFEQPGKKNDGFGWCHVMTYSLARLMLAG-HPRRNSLSAAKRVHLAVFGPTEMSAYRRPFELRVYCVPETGAAMESVWKQED--GSRLLCESNDFILNEKG-NLCICIEDVIPGFSCDG---------PEVVEISETQHRFV---------AQNGLHCSLKFRPKEINGSQFSTRVIVYQKASSTEPMVMEVSNEPELYDATSEEREKGSVCVE-----FRLPFGVKDELARLLDMPNESHSDWRGLAKKLHYDRYLQFFASFPDCSPTSLLLDLWEASSSGSARAVPDLLQTLRVMGRPDAVMVLER 741          

HSP 2 Score: 59.6918 bits (143), Expect = 1.113e-8
Identity = 43/154 (27.92%), Postives = 64/154 (41.56%), Query Frame = 3
Query:  786 SDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEA-----CPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRC------ESGK-CFGPKQQIRNCSQAIC 1211
            SDSGNYTC A +    +K+    + + +   WS W+         CPL+     +         ++RR R C       D   CKG +     C + C K +  W+SWS W+  C  +C + R R C        G+ CFG     + C   +C
Sbjct:    7 SDSGNYTCEATNVANSRKTDPVEVQIYVDGGWSEWSPWIGTCHVDCPLLRQHAHRIRDPHDVLPHQRRTRTCNNPAPLNDGEYCKGEEEMTRSCKVPC-KLDGGWSSWSDWSA-CSSSCHRYRTRACTVPPPMNGGQPCFGDDLMTQECPAQLC 158          
BLAST of Uncoordinated 5 vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 91.6633 bits (226), Expect = 1.598e-18
Identity = 106/444 (23.87%), Postives = 192/444 (43.24%), Query Frame = 3
Query: 1803 ETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCG------PPHTRLLK-PIILTIPHCANIQCSD-WNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSIS--------AHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHL--IRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRV-VKERALNNRSLV------PISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLD------SSWQTLANHMLLNGNLNYFSEKK--SPSDALLDLWESRCREEG-AIADLINILRVIGRNDCAMIVEQ 3032
            + +    I + G RL L +SG  L +P  A+     + ++LAV     + P +  +E  LSPVI+ G        H  +L+ P++++  HCA+    D W   + +           W++  T+   N  + N++ Q +            H++   L  + + G     + LS + R+ +  F     S       +RV+ +P+T  A+E+V   E     +LL  S     +  G ++  C++D+  G+ C             V  ++ +Q++ +          ++G  C++  +  ++  +Q   RV V ++A +   +V      P   DA S  RE     ++     FRL    + +L  LLD      S W+ LA  +  +  L +F+     SP+  LLDLWE+       A+ DL+  LRV+GR D  M++E+
Sbjct:  393 QNIVAAQIDSNGARLSLSKSGARLIVPELAVE--GEKMLYLAVSDTLTDQPHLKPIESALSPVIVIGQCDVSMSAHDNILRRPVVVSFRHCASTFPRDNWQFTLYADEGSG------WQKAVTIGEENL-NTNMFVQFEQPGKKNDGFGWCHVMTYSLARLMLAG-HPRRNSLSAAKRVHLAVFGPTEMSAYRRPFELRVYCVPETGAAMESVWKQED--GSRLLCESNDFILNEKG-NLCICIEDVIPGFSCDG---------PEVVEISETQHRFV---------AQNGLHCSLKFRPKEINGSQFSTRVIVYQKASSTEPMVMEVSNEPELYDATSEEREKGSVCVE-----FRLPFGVKDELARLLDMPNESHSDWRGLAKKLHYDRYLQFFASFPDCSPTSLLLDLWEASSSGSARAVPDLLQTLRVMGRPDAVMVLER 800          

HSP 2 Score: 84.7297 bits (208), Expect = 2.319e-16
Identity = 60/221 (27.15%), Postives = 93/221 (42.08%), Query Frame = 3
Query:  585 FQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEA-----CPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRC------ESGK-CFGPKQQIRNCSQAIC 1211
             +  F  SP   ++ EG  L L C  P+S P +++TW K+  ++      +   D    LI+     SDSGNYTC A +    +K+    + + +   WS W+         CPL+     +         ++RR R C       D   CKG +     C + C K +  W+SWS W+  C  +C + R R C        G+ CFG     + C   +C
Sbjct:    1 MRKHFLKSPVAQRVQEGTTLQLPCQAPESDPKAELTWYKDGVVVQPDANVIRASD--GSLIMSAARLSDSGNYTCEATNVANSRKTDPVEVQIYVDGGWSEWSPWIGTCHVDCPLLRQHAHRIRDPHDVLPHQRRTRTCNNPAPLNDGEYCKGEEEMTRSCKVPC-KLDGGWSSWSDWSA-CSSSCHRYRTRACTVPPPMNGGQPCFGDDLMTQECPAQLC 217          
BLAST of Uncoordinated 5 vs. Ensembl Celegans
Match: unc-5 (Netrin receptor unc-5 [Source:UniProtKB/Swiss-Prot;Acc:Q26261])

HSP 1 Score: 90.8929 bits (224), Expect = 1.970e-18
Identity = 69/253 (27.27%), Postives = 108/253 (42.69%), Query Frame = 3
Query:  492 YKCYCEAWNRIVSINKDKKV-HSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEA-----CPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRC------ESGK-CFGPKQQIRNCSQAIC 1211
            ++C C A     S + D+ V  S  A +  +Y +  F  SP   ++ EG  L L C  P+S P +++TW K+  ++      +   D    LI+     SDSGNYTC A +    +K+    + + +   WS W+         CPL+     +         ++RR R C       D   CKG +     C + C K +  W+SWS W+  C  +C + R R C        G+ CFG     + C   +C
Sbjct:   82 FQCQCYA-----SGDDDQDVVASDVATVHLAYMRKHFLKSPVAQRVQEGTTLQLPCQAPESDPKAELTWYKDGVVVQPDANVIRASD--GSLIMSAARLSDSGNYTCEATNVANSRKTDPVEVQIYVDGGWSEWSPWIGTCHVDCPLLRQHAHRIRDPHDVLPHQRRTRTCNNPAPLNDGEYCKGEEEMTRSCKVPC-KLDGGWSSWSDWSA-CSSSCHRYRTRACTVPPPMNGGQPCFGDDLMTQECPAQLC 325          
BLAST of Uncoordinated 5 vs. Ensembl Fly
Match: unc-5 (gene:FBgn0034013 transcript:FBtr0339998)

HSP 1 Score: 115.161 bits (287), Expect = 1.644e-25
Identity = 89/328 (27.13%), Postives = 136/328 (41.46%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFC-ADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWF---SEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFEN----------------EPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRC 1151
            +P F++EP+  + V K+ PA + C A     V   C    Q      E        V M E                  ++D+++ F     +KC C AW+          V S AA +  +Y +  F  SPT+ +L  G +  L C PP   P  K+TW KN  +IT  + P +T+     LI ++V+     NY+C A++    + S  AV+ V +   WS W+    C        KC G+   ++ R+R R C           C GPQ +                 +  DI   K  ++W++WS W +IC   C Q R R+C
Sbjct:  127 LPIFLIEPESVFVV-KNRPAVLKCKASHSLQVIFKCSGSSQPPPSTHETHVDPHTGVNMEEVT-------------ATIHRDLVDEFFGDGPFKCECHAWS------SRGVVKSQAATVHIAYIRKSFNQSPTSLRLELGSRAELRCEPPGGFPEPKLTWHKNNAVITADSEPGITVSA-GTLIFRQVALQHMANYSCSAENIAGRRVSDSAVLIVYVNGGWSTWSPWREC--------KCAGK--PSQGRKRSRTCNNPMPLNGGAQCPGPQIQKSADCAACPEDTQIVSPDGFDISSSKRMARWSAWSDW-SICSAECIQVRRRKC 422          

HSP 2 Score: 66.6254 bits (161), Expect = 1.302e-10
Identity = 91/442 (20.59%), Postives = 183/442 (41.40%), Query Frame = 3
Query: 1824 ITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDH-ANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSV---SIRLRVLAFSLPL-SSEVDHLIRVHLI---PDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRV------------VKERALNNRSLVPISLDAQSVSREYSQAYLDP--LQTVFRLSSATRQQLWPLLD------SSWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEG---------AIADLINILRVIGRNDCAMIVEQEI 3038
            + +AGG+L L    + L +P  AI     + + L +  D  + +       +L S V+   P +   +KP+IL IPHC  +    W++ +  A  ++ ++   W+   +V      +  ++ QL++    ++ + L      G  + +++  +   SI++++LAFS     S  +  +R++++   P++++   NV   E KL G  L  S+           AF L+  +L  R  +        Y            E  I  +H+    S   C  ++++ D  QN   +              +   +++  +    S    ++S +    Y++   +    +L  AT++ +   LD        W+ LA  +  +  + YF+ K SP++ +L+LWE R               I  L+  L+ +GR D   I+ + I
Sbjct:  660 LGSAGGQLRLYGGELLLFVPEHAIGKHVKKHVSLLLLSDECSRVSCATESSILCSSVVHSAPRNYSFVKPVILKIPHCL-VAPEQWHVHIYHADSEHDELSVNWRRAVSVGE-ETINTPMFVQLEATHVFIMTEQL------GHFTVVAEPRIQQPSIKMKLLAFSQHTPPSNANCSLRIYVVKDFPNSRDICANV---EAKLGGSFLGESQVF---------AFTLNSRNLNIRVRSADVEAAAPY------------EHAIPYQHILSNNSILHCEFSLRRQD--QNSLCVDFGQGSEDDYYTFNIPAHSMSGSAEELASTTNTTISIDRQGNYVNESCVMDFVQLPHATKRLICGALDPPRADERDWRLLAKKLNTDRYIAYFATKASPTEQILNLWECRANSSPGSSSNSVSHTIMALLLTLKEMGRQDVLDIIVETI 1067          
BLAST of Uncoordinated 5 vs. Ensembl Fly
Match: unc-5 (gene:FBgn0034013 transcript:FBtr0087382)

HSP 1 Score: 115.161 bits (287), Expect = 1.644e-25
Identity = 89/328 (27.13%), Postives = 136/328 (41.46%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFC-ADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWF---SEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFEN----------------EPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRC 1151
            +P F++EP+  + V K+ PA + C A     V   C    Q      E        V M E                  ++D+++ F     +KC C AW+          V S AA +  +Y +  F  SPT+ +L  G +  L C PP   P  K+TW KN  +IT  + P +T+     LI ++V+     NY+C A++    + S  AV+ V +   WS W+    C        KC G+   ++ R+R R C           C GPQ +                 +  DI   K  ++W++WS W +IC   C Q R R+C
Sbjct:  127 LPIFLIEPESVFVV-KNRPAVLKCKASHSLQVIFKCSGSSQPPPSTHETHVDPHTGVNMEEVT-------------ATIHRDLVDEFFGDGPFKCECHAWS------SRGVVKSQAATVHIAYIRKSFNQSPTSLRLELGSRAELRCEPPGGFPEPKLTWHKNNAVITADSEPGITVSA-GTLIFRQVALQHMANYSCSAENIAGRRVSDSAVLIVYVNGGWSTWSPWREC--------KCAGK--PSQGRKRSRTCNNPMPLNGGAQCPGPQIQKSADCAACPEDTQIVSPDGFDISSSKRMARWSAWSDW-SICSAECIQVRRRKC 422          

HSP 2 Score: 66.6254 bits (161), Expect = 1.302e-10
Identity = 91/442 (20.59%), Postives = 183/442 (41.40%), Query Frame = 3
Query: 1824 ITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDH-ANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSV---SIRLRVLAFSLPL-SSEVDHLIRVHLI---PDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRV------------VKERALNNRSLVPISLDAQSVSREYSQAYLDP--LQTVFRLSSATRQQLWPLLD------SSWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEG---------AIADLINILRVIGRNDCAMIVEQEI 3038
            + +AGG+L L    + L +P  AI     + + L +  D  + +       +L S V+   P +   +KP+IL IPHC  +    W++ +  A  ++ ++   W+   +V      +  ++ QL++    ++ + L      G  + +++  +   SI++++LAFS     S  +  +R++++   P++++   NV   E KL G  L  S+           AF L+  +L  R  +        Y            E  I  +H+    S   C  ++++ D  QN   +              +   +++  +    S    ++S +    Y++   +    +L  AT++ +   LD        W+ LA  +  +  + YF+ K SP++ +L+LWE R               I  L+  L+ +GR D   I+ + I
Sbjct:  660 LGSAGGQLRLYGGELLLFVPEHAIGKHVKKHVSLLLLSDECSRVSCATESSILCSSVVHSAPRNYSFVKPVILKIPHCL-VAPEQWHVHIYHADSEHDELSVNWRRAVSVGE-ETINTPMFVQLEATHVFIMTEQL------GHFTVVAEPRIQQPSIKMKLLAFSQHTPPSNANCSLRIYVVKDFPNSRDICANV---EAKLGGSFLGESQVF---------AFTLNSRNLNIRVRSADVEAAAPY------------EHAIPYQHILSNNSILHCEFSLRRQD--QNSLCVDFGQGSEDDYYTFNIPAHSMSGSAEELASTTNTTISIDRQGNYVNESCVMDFVQLPHATKRLICGALDPPRADERDWRLLAKKLNTDRYIAYFATKASPTEQILNLWECRANSSPGSSSNSVSHTIMALLLTLKEMGRQDVLDIIVETI 1067          
BLAST of Uncoordinated 5 vs. Ensembl Fly
Match: robo3 (gene:FBgn0041097 transcript:FBtr0077921)

HSP 1 Score: 63.5438 bits (153), Expect = 1.256e-9
Identity = 36/124 (29.03%), Postives = 62/124 (50.00%), Query Frame = 3
Query:  501 YCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMK 872
            +CEA N +          S  A +Q +  ++EF++ P NT++ +G+  +L C  P   P   VTW K  + +       V I +   L IQ   ++D G Y C+A++   V++S +A + V +K
Sbjct:   97 WCEAKNEL------GVARSRNATLQVAVLRDEFRLEPQNTRIAQGDTALLECAAPRGIPEPTVTWKKGGQKLDLEGSKRVRIVDGGNLAIQDARQTDEGQYQCIAKNPVGVRESSLATLKVHVK 214          
BLAST of Uncoordinated 5 vs. Ensembl Fly
Match: robo3 (gene:FBgn0041097 transcript:FBtr0335384)

HSP 1 Score: 63.5438 bits (153), Expect = 1.256e-9
Identity = 36/124 (29.03%), Postives = 62/124 (50.00%), Query Frame = 3
Query:  501 YCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMK 872
            +CEA N +          S  A +Q +  ++EF++ P NT++ +G+  +L C  P   P   VTW K  + +       V I +   L IQ   ++D G Y C+A++   V++S +A + V +K
Sbjct:   97 WCEAKNEL------GVARSRNATLQVAVLRDEFRLEPQNTRIAQGDTALLECAAPRGIPEPTVTWKKGGQKLDLEGSKRVRIVDGGNLAIQDARQTDEGQYQCIAKNPVGVRESSLATLKVHVK 214          
BLAST of Uncoordinated 5 vs. Ensembl Fly
Match: robo2 (gene:FBgn0002543 transcript:FBtr0077941)

HSP 1 Score: 63.1586 bits (152), Expect = 1.679e-9
Identity = 33/124 (26.61%), Postives = 62/124 (50.00%), Query Frame = 3
Query:  501 YCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMK 872
            +CEA N            S  A +Q ++ ++EF++ P NT++ +GE  ++ C  P   P  +++W KN + +       + I +   L IQ+  +SD G Y CV ++    ++S  A + V ++
Sbjct:  165 WCEAKNEF------GVARSRNATLQVAFLRDEFRLEPANTRVAQGEVALMECGAPRGSPEPQISWRKNGQTLNLVGNKRIRIVDGGNLAIQEARQSDDGRYQCVVKNVVGTRESATAFLKVHVR 282          
BLAST of Uncoordinated 5 vs. Ensembl Zebrafish
Match: unc5db (unc-5 netrin receptor Db [Source:ZFIN;Acc:ZDB-GENE-060531-162])

HSP 1 Score: 278.87 bits (712), Expect = 1.217e-78
Identity = 236/961 (24.56%), Postives = 426/961 (44.33%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFS--EYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAICQKPD-------PSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNA----QDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQY---TYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDSS------WQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDC 3014
            +P F+ EP+  Y + K++P  + C A P   +   C + ++ + N+  S+         E+   +   K  + +  V  + + ++    +Y C C AW+ +   +K ++     A ++ +Y +  F+  P   ++     +VL C PP+  P +KV WLKN+EL++      +       LII +   SDS NYTC+A +    ++S  A + V +   WS WT+  +C + C   G+ +        ++R R C           C+G   +   C+  C   +  W  WS WT +C   C + R R C        GK C G  Q   NC+  +C +         P  +  S    +Y  L   +  + ++I+ I      +    +     ++ S+   G  + +  K+ +    LLLN+  +  +   + +++    QD +   L + +P+             + +V  +      +  +++Y    +  T P   +P       N ++ E +K A +           GL   + P  I+L+T A       GGRL +P +G+SL +P GAI    S EM++ + +   +    +  E+LL P I  GPP   L  P+ +TI HCA +   +WNI++      N      W+E+ +   V+    + Y  +DS S HL++D      + G   P++D ++  RLR+  F    +S +D+ +RVH + DT  A + V+ +E    GQLL+  K L F  +   +   + D+    W     +  Q FS++ VW   +S  Q +H    L+      +  SC I+V+Q+    ++ +++V      N +  VP  + A       + A        F++  + RQ++    D++      WQ LA  + +  NL+YF+++KSPS  +L LWE+R ++ G +  L + L  IG+  C
Sbjct:   14 LPHFLQEPEDAYII-KNNPIKLRCRATPALQIFFKC-NGEWVHQNQHSSQ---------EYMDQNTGVKIREVTINVTRQQVEDFHGPEDYWCLCVAWSHL-GTSKSRR-----ATVRIAYLRKNFEQDPQGKEVPIKGMIVLHCRPPEGVPMAKVEWLKNEELVSALEDDNIDTRADHNLIINEARLSDSANYTCLATNIVAKRRSTTATVVVFVNGGWSLWTEWSSCSVNC---GRGV--------QKRSRTCTNPAPLNGGAFCEGMSVQKIACNAVC-PVDGVWEEWSEWT-MCSAQCERQRWRECNDPPPRHRGKMCEGEGQSTENCTGGLCTQNGKLMHDVKPQSMENSMDVALYSGLAAGVIAVVVLIVAITLYRKSQSEYGV----DVIDSSALAGGFQSFNFKTTRQGNPLLLNSSMQPDITVGQTYSSPICFQDSIDKELFDPLPD-------------KVKVQSSFMVSLGVADRAEYHVKAHPQTLPANLHP-------NYSMVEGKKTATMAPN--------GL---HTPGKIQLKTSA--VFGHLGGRLVIPNAGVSLLVPHGAIADDTSWEMYMLINQGETSAQSEERCEILLGPEITYGPPGLSLSCPVAMTIAHCAEVSAENWNIKLKRQTKDNK-----WEEIMS---VDDESTSCYCLMDSHSCHLLLDQPGCYALVG--EPITDAAIK-RLRIAVFGSMEASSLDYSLRVHCVDDTPHAFQGVVTAETCRGGQLLEEPKTLFFKGNCLSLQVSIQDIPQFLWSIKPFTTCQEFSFTQVW---YSNQQPVHCAFSLQRHSAATNQLSCKISVRQVK--GHEQILQVYTSVGENEKETVPFFMQADCTVTSQTGA------KAFKIPLSIRQRICTTFDTANAKGKDWQLLAQKLHIQRNLSYFTKQKSPSAVILSLWEARHQDSGDLDSLASALEEIGKIHC 885          
BLAST of Uncoordinated 5 vs. Ensembl Zebrafish
Match: unc5db (unc-5 netrin receptor Db [Source:ZFIN;Acc:ZDB-GENE-060531-162])

HSP 1 Score: 278.485 bits (711), Expect = 3.029e-78
Identity = 236/961 (24.56%), Postives = 425/961 (44.22%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFS--EYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAICQKPD-------PSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNA----QDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQY---TYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDSS------WQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDC 3014
            +P F+ EP+  Y + K++P  + C A P   +   C + ++ + N+  S+         E+   +   K  + +  V  + + ++    +Y C C AW+ +   +K ++     A ++ +Y +  F+  P   ++     +VL C PP+  P +KV WLKN+EL++      +       LII +   SDS NYTC+A +    ++S  A + V +   WS WT+  +C + C   G+ +        ++R R C           C+G   +   C+  C   +  W  WS WT +C   C + R R C        GK C G  Q   NC+  +C +         P  +  S    +Y  L   +  + ++I+ I      +    +     ++ S+   G  + +  K+ +    LLLN+  +  +   + +++    QD +   L + +P+               +V  +      +  +++Y    +  T P   +P       N ++ E +K A +           GL   + P  I+L+T A       GGRL +P +G+SL +P GAI    S EM++ + +   +    +  E+LL P I  GPP   L  P+ +TI HCA +   +WNI++      N      W+E+ +   V+    + Y  +DS S HL++D      + G   P++D ++  RLR+  F    +S +D+ +RVH + DT  A + V+ +E    GQLL+  K L F  +   +   + D+    W     +  Q FS++ VW   +S  Q +H    L+      +  SC I+V+Q+    ++ +++V      N +  VP  + A       + A        F++  + RQ++    D++      WQ LA  + +  NL+YF+++KSPS  +L LWE+R ++ G +  L + L  IG+  C
Sbjct:   54 LPHFLQEPEDAYII-KNNPIKLRCRATPALQIFFKC-NGEWVHQNQHSSQ---------EYMDQNTGVKIREVTINVTRQQVEDFHGPEDYWCLCVAWSHL-GTSKSRR-----ATVRIAYLRKNFEQDPQGKEVPIKGMIVLHCRPPEGVPMAKVEWLKNEELVSALEDDNIDTRADHNLIINEARLSDSANYTCLATNIVAKRRSTTATVVVFVNGGWSLWTEWSSCSVNC---GRGV--------QKRSRTCTNPAPLNGGAFCEGMSVQKIACNAVC-PVDGVWEEWSEWT-MCSAQCERQRWRECNDPPPRHRGKMCEGEGQSTENCTGGLCTQNGKLMHDVKPQSMENSMDVALYSGLAAGVIAVVVLIVAITLYRKSQSEYGV----DVIDSSALAGGFQSFNFKTTRQGNPLLLNSSMQPDITVGQTYSSPICFQDSIDKELFDPLPDKV-------------KVQSSFMVSLGVADRAEYHVKAHPQTLPANLHP-------NYSMVEGKKTATMAPN--------GL---HTPGKIQLKTSA--VFGHLGGRLVIPNAGVSLLVPHGAIADDTSWEMYMLINQGETSAQSEERCEILLGPEITYGPPGLSLSCPVAMTIAHCAEVSAENWNIKLKRQTKDNK-----WEEIMS---VDDESTSCYCLMDSHSCHLLLDQPGCYALVG--EPITDAAIK-RLRIAVFGSMEASSLDYSLRVHCVDDTPHAFQGVVTAETCRGGQLLEEPKTLFFKGNCLSLQVSIQDIPQFLWSIKPFTTCQEFSFTQVW---YSNQQPVHCAFSLQRHSAATNQLSCKISVRQVK--GHEQILQVYTSVGENEKETVPFFMQADCTVTSQTGA------KAFKIPLSIRQRICTTFDTANAKGKDWQLLAQKLHIQRNLSYFTKQKSPSAVILSLWEARHQDSGDLDSLASALEEIGKIHC 925          
BLAST of Uncoordinated 5 vs. Ensembl Zebrafish
Match: unc5db (unc-5 netrin receptor Db [Source:ZFIN;Acc:ZDB-GENE-060531-162])

HSP 1 Score: 261.151 bits (666), Expect = 2.958e-73
Identity = 213/844 (25.24%), Postives = 373/844 (44.19%), Query Frame = 3
Query:  573 QESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAICQKPD-------PSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNA----QDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQY---TYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDSS------WQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDC 3014
            Q +  +  F+  P   ++     +VL C PP+  P +KV WLKN+EL++      +       LII +   SDS NYTC+A +    ++S  A + V +   WS WT+  +C + C   G+ +        ++R R C           C+G   +   C+  C   +  W  WS WT +C   C + R R C        GK C G  Q   NC+  +C +         P  +  S    +Y  L   +  + ++I+ I      +    +     ++ S+   G  + +  K+ +    LLLN+  +  +   + +++    QD +   L + +P+             + +V  +      +  +++Y    +  T P   +P       N ++ E +K A +           GL   + P  I+L+T A       GGRL +P +G+SL +P GAI    S EM++ + +   +    +  E+LL P I  GPP   L  P+ +TI HCA +   +WNI++      N      W+E+ +   V+    + Y  +DS S HL++D      + G   P++D ++  RLR+  F    +S +D+ +RVH + DT  A + V+ +E    GQLL+  K L F  +   +   + D+    W     +  Q FS++ VW   +S  Q +H    L+      +  SC I+V+Q+    ++ +++V      N +  VP  + A       + A        F++  + RQ++    D++      WQ LA  + +  NL+YF+++KSPS  +L LWE+R ++ G +  L + L  IG+  C
Sbjct:    3 QNTDLRKNFEQDPQGKEVPIKGMIVLHCRPPEGVPMAKVEWLKNEELVSALEDDNIDTRADHNLIINEARLSDSANYTCLATNIVAKRRSTTATVVVFVNGGWSLWTEWSSCSVNC---GRGV--------QKRSRTCTNPAPLNGGAFCEGMSVQKIACNAVC-PVDGVWEEWSEWT-MCSAQCERQRWRECNDPPPRHRGKMCEGEGQSTENCTGGLCTQNGKLMHDVKPQSMENSMDVALYSGLAAGVIAVVVLIVAITLYRKSQSEYGV----DVIDSSALAGGFQSFNFKTTRQGNPLLLNSSMQPDITVGQTYSSPICFQDSIDKELFDPLPD-------------KVKVQSSFMVSLGVADRAEYHVKAHPQTLPANLHP-------NYSMVEGKKTATMAPN--------GL---HTPGKIQLKTSA--VFGHLGGRLVIPNAGVSLLVPHGAIADDTSWEMYMLINQGETSAQSEERCEILLGPEITYGPPGLSLSCPVAMTIAHCAEVSAENWNIKLKRQTKDNK-----WEEIMS---VDDESTSCYCLMDSHSCHLLLDQPGCYALVG--EPITDAAIK-RLRIAVFGSMEASSLDYSLRVHCVDDTPHAFQGVVTAETCRGGQLLEEPKTLFFKGNCLSLQVSIQDIPQFLWSIKPFTTCQEFSFTQVW---YSNQQPVHCAFSLQRHSAATNQLSCKISVRQVK--GHEQILQVYTSVGENEKETVPFFMQADCTVTSQTGA------KAFKIPLSIRQRICTTFDTANAKGKDWQLLAQKLHIQRNLSYFTKQKSPSAVILSLWEARHQDSGDLDSLASALEEIGKIHC 774          
BLAST of Uncoordinated 5 vs. Ensembl Zebrafish
Match: unc5da (unc-5 netrin receptor Da [Source:ZFIN;Acc:ZDB-GENE-080908-2])

HSP 1 Score: 255.373 bits (651), Expect = 3.556e-70
Identity = 230/956 (24.06%), Postives = 414/956 (43.31%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWF---SEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCESGKCFGPKQQIRNCSQAICQKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISL--------LPRRG-------MVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVATSLLNEM---PNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPI--SLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDSS------WQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGR 3005
            +P F+ EP   Y V KS+P  + C A P   +   C + ++ + N+  S   L  +++         G + +   +   +  +E F    +Y C C AW+ + +    K      A ++ +Y +  F+  P   ++     +VL C PP+  P ++V WLKN+EL+ +     +       LII +   SDSGNYTC+A +    ++S  A++ V +   WS+WTD   C + C   G+ +        ++R R C           C+G   +   C   C   +  W+ W++W+  C   C + R R C   +   PK   R C  A     + +  L  Q   +   + +  + +     + L      G +++        L RR        ++ S+   G  + ++ KS +    LL+N+  +  +   + + +      S+  E+   P  + P+ ++    +   ++    SE       +  Y +  P    P    R   + +           +  +      L+S+       L T   G     GGRL +P +G+SL +P GAI    + E+++++ +  ++    +  E+LLSP +  GPP   L  P+ LT+ HCA++   DWNI++      NS     W+E   V  +     + Y  LD+   HL+V+      + G    LS  +   RLR+ AF     + +++ IRV+ + DT  A + V+  E    G+LL+  K L F ++   +   + D+    W     +  Q FS+S VW  + S  Q     LE   P  +  SC I+V+Q+    ++ +++V    A + +  VP     D    S+  S+A        F++  + RQ++    D++      WQ LA  + ++ NL YF+ + SPS  +L LWE++ +E+G +  L + L  IG+
Sbjct:   43 LPHFLQEPDDAYIV-KSNPIKLRCRARPALQIFFKC-NGEWVHQNQHTS---LEHIELG-------TGLKIREVMINVSRQQVEDFHGPEDYWCLCVAWSHLGTAKSRK------ATVRIAYLRKNFEQEPQGMEVPINGMIVLHCRPPEGVPAAEVEWLKNEELVHSLEDINIDTRADHNLIINEARLSDSGNYTCLASNIVARRRSATAMVIVFVNGGWSSWTDWSECNVRC---GRGV--------QKRTRTCTNPAPLNGGAFCEGMSVQKSTCTSPC-PVDGGWSEWTMWSE-CTSECERQRTRECTDPE---PKHGGRLCDGAALDTDNCTGDLCIQDRKLLHDVKVPQADVESSNDVALYSGLAAGVVTMVVLVIAVTLYRRNQSEYGVDVIDSSALTGGFQSFSFKSARQGNPLLMNSSMQPDLTVSRTYTSPICFPDSMEKELIPEPALFDPLPDLKVKVHSSFMVSLGVSE-------RAEYHAKAPSQTFP----RGVVQEIGGGGGTLGGRGKSQLTSIQPALISSMTNGKRALRTS--GVFGHGGGRLVVPNAGVSLLVPHGAIEEDTTWELYMSITQQDSSALSDEAQEILLSPEVTYGPPGLSLSCPVALTVAHCADVNSEDWNIKLKRQTQDNS-----WEE---VMILEEESTSCYCLLDTQCCHLLVERPGCYALVG--EALSQ-AAGKRLRLAAFGNMEPNFLNYSIRVYCVDDTPHAFQEVVSVERGRGGRLLEEPKTLLFRANSFSLQVSIQDIPQFLWSIKPFTTCQEFSFSQVWCSSQSPLQ-CAFSLERYSPAANQLSCKISVRQVK--GHEQILQVYTTIAESEKDTVPFFTQSDCTITSQTGSRA--------FKIPQSIRQRICATFDTANAKGKDWQLLAQKLHIDRNLGYFARQTSPSAVILSLWEAQHQEQGDLDSLASALEEIGK 929          
BLAST of Uncoordinated 5 vs. Ensembl Zebrafish
Match: unc5b (unc-5 netrin receptor B [Source:ZFIN;Acc:ZDB-GENE-041213-1])

HSP 1 Score: 253.062 bits (645), Expect = 9.818e-70
Identity = 238/966 (24.64%), Postives = 407/966 (42.13%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFSEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELIT---NSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCESGKCFGPKQQIRNCSQAICQKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVATSLLNEMPNNYSPVYE-----MHSHNNRDQVLPAIYSEYPIISKSQYTYSS-------TTPLINN-PYSKERSYNETLTEKQKA--------APLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLG-WRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIV 3026
            +P+F  EP+  + V K+ P  + C A P + +   C + ++   N  +++  L  +      + D    R +   +   +D       Y C C AW+   +        S  A ++ +Y +  F+  P   ++   ++++L C PP+  P ++V WLKN+ELI    +SN+ L+TI+    LII++   SD+ NYTCVA++    ++S  A + V +   WS+WT+   C              C    +RR R C           C GP F+   C   C   +  W  W+ W+  C   C+  R R C++     P+   R+CS +         ++ES++ T  L        +      +        Y  L+    +           +Y     ++   L       S+ +T   H              P NY P  +     +H     D    A     P+ S  Q T  S       T+PL++  P  K + YN +     +           +    ++G G      + LP   E    A  T+ + GGRL +P +G+SL +P G I  G   EM+L + +        D  + +LSPV+ CGP    L +P++LT+PHCA ++  DW    L+ + QN Q    W+E+ TV   + S +  Y Q++  S H++++ L    + G  +P       ++L + A   P  S +D+ +RV+ I DT  A++ V+  E  L G LL++ K L F  S  ++   + D+    WR    +K Q   +  +W       + +H    LE      S  +C I V+Q++       +    +  L   S +P        S+    A        FRL  + RQ++   LD+       W+ LA  +  +  LNYF+ K SP+  LLDLWE+  + +  +  L   L  +G+++  +++
Sbjct:   21 LPEFQSEPEDAFIV-KNRPVKLSCKAAPATQIYFKC-NGEWVNQNDHVTKESLDHITGLVVREVDISVSRTQVEELFGLED-------YWCQCVAWSSAGTTK------SRRAYVRIAYLRKNFEQEPLGREVRLEQEVLLQCRPPEGSPPAEVDWLKNEELIDPALDSNF-LITIEH--DLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVYVSGGWSSWTEWSEC-----------NAQCGRGWQRRTRSCTNPAPLNGGAFCDGPPFQRVTCTTLC-PVDGGWTEWAKWSA-CGTECTHWRSRECQAPP---PRNGGRHCSGS---------MMESKNCTEGLCARNKKVSVEHTSHPLGSGTGVAVYAGLVGALLLCVILVLCVGILVYR----RSCRHLHGEITDSSSALTAAFH--------------PGNYKPPRQDNPHLLHPTAPPDLTASAGTFRGPLFSLQQATLDSHHKIPMTTSPLLDPLPSLKIKVYNSSTMSSLELPTGLGSVDGDIMSLKTVGSGPKDHHGHTLPR--EPSHSASATLGSLGGRLTIPNTGVSLLVPPGTIPQGKFYEMYLIINKWEKTTLPSDGSQTVLSPVVSCGPSGMLLSRPVVLTLPHCAQLEPPDWT---LTLKMQNHQG--AWEEVLTVGEESLS-SPCYLQVEEQSCHILMEQLGTYGLVGQSAPPRPACKRLQLALFAPRAPCLS-LDYSLRVYCIQDTPHALKEVLEVERSLGGVLLEDPKPLLFKDSYHNMRLSIHDIPHSHWRSKLLAKYQEIPFYHIWS---GSQRPLHCTFSLERGSLVVSQLTCKICVRQVEGEGQIFQLNTDIQETLPPHSPLPAGGSCLPSSQVGPYA--------FRLPVSIRQKICASLDAPSARGCDWRMLARSLAFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVM 905          
BLAST of Uncoordinated 5 vs. Ensembl Xenopus
Match: UNC5D (unc-5 netrin receptor D [Source:NCBI gene;Acc:100490873])

HSP 1 Score: 287.73 bits (735), Expect = 2.299e-81
Identity = 255/959 (26.59%), Postives = 432/959 (45.05%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWF---SEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAICQKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNA----QDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGR--NDCAMIVE 3029
            +P F++EP   Y V KS+P  + C A P   +  F  + ++ + ++ +SE  +           +  G + +  Y+   +  +E F    +Y C C AW+ +   +K ++     A ++ +Y +  F+  P   ++     +VL C PP+  P ++V WLKN+ELI +     +       LII++   SDSGNYTCVA +    ++S  A + V +   WS+W +  AC + C   GK          ++R R C           C GP  +   C+  C   +  W+ WS W+ +C P C Q R R+C +      GK C G  Q+  NC++ +C +       E     +Y  L   I  + ++++ I      +    +     ++ S+   G  + +  K+ +    LLLN+  +  +   + ++     QD +   L+ E  + ++P+ ++        ++    ++ P       T S + P  NN     R +  TL  + K   +    SI                + E  A G     GGRL +P +G+SL IP  AI   NS E+FL V +   ++P ++  E+LL P + CGP    L  P+ LTIPHCA + C  WNIR L  R Q  +    W+E+ +   ++    + Y  LD  S H+++D      + G   PL+D +V   L+V  F     + +D+ +RV+ I +T  A + V+ +E    GQLL+  K L F  +   I   + D+    WR    +  Q   +S VW  N    Q +H    LE   P  +  SC I V+Q+    ++ +++V       + +L   +LD+   +    +A        F++  + RQ++    D+       WQ LA  + +N NL+YF+ K SPS  +LDLWE+R   +G +  L   L  IGR  N  +++ E
Sbjct:   46 LPHFLMEPDDAYIV-KSNPIHLRCRAMPAMQI-FFKCNGEWVHQSEHVSEESVD----------EATGLKIREVYINVTRQQVEDFHGSEDYWCQCIAWSNL-GTSKSRR-----AFVRIAYLRKNFEQDPKGKEVLIDTMIVLHCRPPEGIPTAEVEWLKNEELIDSLMDENIDTRASHNLIIRQARLSDSGNYTCVASNIVAKRRSASATVIVFVHGGWSSWAEWSACNVRC---GKGF--------QKRSRTCTNPAPLNGGTFCDGPSVQKITCNALC-PVDGNWDVWSEWS-VCSPECEQQRDRKCIAPAPTIGGKPCEGLSQESENCTEGLCIQGSHQPQSEPLDIALYSGLGAAIIAVAVLVVGITLYRRSQSEYGV----DVIDSSALTGGFQTFNFKTVRQGNSLLLNSSLQPDLTVSRTYSGPICFQDPMDKELMTES-SIFNPLTDIKVKVQSSFMVSLGVTDRPDFQGK--TISGSFPHGNN-----RCFG-TLHNRNKLPYIQNLTSISS--------------KPEMRASGHFGHQGGRLVMPNTGVSLLIPHKAIAEDNSWEIFLIVNQGEPSLP-LEGAEVLLGPEVTCGPFDINLSTPVALTIPHCAEVSCEHWNIR-LKRRSQQGK----WEEIMS---LDDETTSFYCLLDPFSCHILLDSFGTYALVG--EPLTDCAVK-ELKVAVFGCMSCNSLDYNLRVYCIDNTPCAFQEVLSNERHQGGQLLEEPKLLHFKGNTFSIQISVLDIPPFLWRIKPFTACQEVPFSRVWCSNQ---QPLHCAFSLERYTPATTQLSCKICVRQVK--GHELILQVQTSILEGSMALCSSNLDSNFPAHTGPKA--------FKIPHSIRQRICATFDTPNSKGKDWQLLAQKLSINRNLSYFATKNSPSAVILDLWEARYPYDGNLDSLACALEEIGRTQNKLSLVTE 921          
BLAST of Uncoordinated 5 vs. Ensembl Xenopus
Match: UNC5D (unc-5 netrin receptor D [Source:NCBI gene;Acc:100490873])

HSP 1 Score: 286.574 bits (732), Expect = 5.882e-81
Identity = 259/962 (26.92%), Postives = 432/962 (44.91%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWF---SEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAIC-QKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGM--VFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNA----QDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGR--NDCAMIVE 3029
            +P F++EP   Y V KS+P  + C A P   +  F  + ++ + ++ +SE  +           +  G + +  Y+   +  +E F    +Y C C AW+ +   +K ++     A ++ +Y +  F+  P   ++     +VL C PP+  P ++V WLKN+ELI +     +       LII++   SDSGNYTCVA +    ++S  A + V +   WS+W +  AC + C   GK          ++R R C           C GP  +   C+  C   +  W+ WS W+ +C P C Q R R+C +      GK C G  Q+  NC++ +C Q+  P   +  QS      + +   +   II + + ++    Y       G+  + S+   G  + +  K+ +    LLLN+  +  +   + ++     QD +   L+ E  + ++P+ ++        ++    ++ P       T S + P  NN     R +  TL  + K   +    SI                + E  A G     GGRL +P +G+SL IP  AI   NS E+FL V +   ++P ++  E+LL P + CGP    L  P+ LTIPHCA + C  WNIR L  R Q  +    W+E+ +   ++    + Y  LD  S H+++D      + G   PL+D +V   L+V  F     + +D+ +RV+ I +T  A + V+ +E    GQLL+  K L F  +   I   + D+    WR    +  Q   +S VW    S  Q +H    LE   P  +  SC I V+Q+    ++ +++V      N R  +       S       A+  P    F++  + RQ++    D+       WQ LA  + +N NL+YF+ K SPS  +LDLWE+R   +G +  L   L  IGR  N  +++ E
Sbjct:   37 LPHFLMEPDDAYIV-KSNPIHLRCRAMPAMQI-FFKCNGEWVHQSEHVSEESVD----------EATGLKIREVYINVTRQQVEDFHGSEDYWCQCIAWSNL-GTSKSRR-----AFVRIAYLRKNFEQDPKGKEVLIDTMIVLHCRPPEGIPTAEVEWLKNEELIDSLMDENIDTRASHNLIIRQARLSDSGNYTCVASNIVAKRRSASATVIVFVHGGWSSWAEWSACNVRC---GKGF--------QKRSRTCTNPAPLNGGTFCDGPSVQKITCNALC-PVDGNWDVWSEWS-VCSPECEQQRDRKCIAPAPTIGGKPCEGLSQESENCTEGLCIQEKKPLHEIRPQSAENASDIALYSGLGAAIIAVAVLVVGITLYRRSQSEYGVDVIDSSALTGGFQTFNFKTVRQGNSLLLNSSLQPDLTVSRTYSGPICFQDPMDKELMTES-SIFNPLTDIKVKVQSSFMVSLGVTDRPDFQGK--TISGSFPHGNN-----RCFG-TLHNRNKLPYIQNLTSISS--------------KPEMRASGHFGHQGGRLVMPNTGVSLLIPHKAIAEDNSWEIFLIVNQGEPSLP-LEGAEVLLGPEVTCGPFDINLSTPVALTIPHCAEVSCEHWNIR-LKRRSQQGK----WEEIMS---LDDETTSFYCLLDPFSCHILLDSFGTYALVG--EPLTDCAVK-ELKVAVFGCMSCNSLDYNLRVYCIDNTPCAFQEVLSNERHQGGQLLEEPKLLHFKGNTFSIQISVLDIPPFLWRIKPFTACQEVPFSRVW---CSNQQPLHCAFSLERYTPATTQLSCKICVRQVK--GHELILQVQTSILENERETIAFFAPEDS----NFPAHTGP--KAFKIPHSIRQRICATFDTPNSKGKDWQLLAQKLSINRNLSYFATKNSPSAVILDLWEARYPYDGNLDSLACALEEIGRTQNKLSLVTE 921          
BLAST of Uncoordinated 5 vs. Ensembl Xenopus
Match: UNC5D (unc-5 netrin receptor D [Source:NCBI gene;Acc:100490873])

HSP 1 Score: 286.96 bits (733), Expect = 6.002e-81
Identity = 259/962 (26.92%), Postives = 432/962 (44.91%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWF---SEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAIC-QKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGM--VFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNA----QDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGR--NDCAMIVE 3029
            +P F++EP   Y V KS+P  + C A P   +  F  + ++ + ++ +SE  +           +  G + +  Y+   +  +E F    +Y C C AW+ +   +K ++     A ++ +Y +  F+  P   ++     +VL C PP+  P ++V WLKN+ELI +     +       LII++   SDSGNYTCVA +    ++S  A + V +   WS+W +  AC + C   GK          ++R R C           C GP  +   C+  C   +  W+ WS W+ +C P C Q R R+C +      GK C G  Q+  NC++ +C Q+  P   +  QS      + +   +   II + + ++    Y       G+  + S+   G  + +  K+ +    LLLN+  +  +   + ++     QD +   L+ E  + ++P+ ++        ++    ++ P       T S + P  NN     R +  TL  + K   +    SI                + E  A G     GGRL +P +G+SL IP  AI   NS E+FL V +   ++P ++  E+LL P + CGP    L  P+ LTIPHCA + C  WNIR L  R Q  +    W+E+ +   ++    + Y  LD  S H+++D      + G   PL+D +V   L+V  F     + +D+ +RV+ I +T  A + V+ +E    GQLL+  K L F  +   I   + D+    WR    +  Q   +S VW  N    Q +H    LE   P  +  SC I V+Q+    ++ +++V      N R  +       S       A+  P    F++  + RQ++    D+       WQ LA  + +N NL+YF+ K SPS  +LDLWE+R   +G +  L   L  IGR  N  +++ E
Sbjct:   50 LPHFLMEPDDAYIV-KSNPIHLRCRAMPAMQI-FFKCNGEWVHQSEHVSEESVD----------EATGLKIREVYINVTRQQVEDFHGSEDYWCQCIAWSNL-GTSKSRR-----AFVRIAYLRKNFEQDPKGKEVLIDTMIVLHCRPPEGIPTAEVEWLKNEELIDSLMDENIDTRASHNLIIRQARLSDSGNYTCVASNIVAKRRSASATVIVFVHGGWSSWAEWSACNVRC---GKGF--------QKRSRTCTNPAPLNGGTFCDGPSVQKITCNALC-PVDGNWDVWSEWS-VCSPECEQQRDRKCIAPAPTIGGKPCEGLSQESENCTEGLCIQEKKPLHEIRPQSAENASDIALYSGLGAAIIAVAVLVVGITLYRRSQSEYGVDVIDSSALTGGFQTFNFKTVRQGNSLLLNSSLQPDLTVSRTYSGPICFQDPMDKELMTES-SIFNPLTDIKVKVQSSFMVSLGVTDRPDFQGK--TISGSFPHGNN-----RCFG-TLHNRNKLPYIQNLTSISS--------------KPEMRASGHFGHQGGRLVMPNTGVSLLIPHKAIAEDNSWEIFLIVNQGEPSLP-LEGAEVLLGPEVTCGPFDINLSTPVALTIPHCAEVSCEHWNIR-LKRRSQQGK----WEEIMS---LDDETTSFYCLLDPFSCHILLDSFGTYALVG--EPLTDCAVK-ELKVAVFGCMSCNSLDYNLRVYCIDNTPCAFQEVLSNERHQGGQLLEEPKLLHFKGNTFSIQISVLDIPPFLWRIKPFTACQEVPFSRVWCSNQ---QPLHCAFSLERYTPATTQLSCKICVRQVK--GHELILQVQTSILENERETIAFFAPEDS----NFPAHTGP--KAFKIPHSIRQRICATFDTPNSKGKDWQLLAQKLSINRNLSYFATKNSPSAVILDLWEARYPYDGNLDSLACALEEIGRTQNKLSLVTE 934          
BLAST of Uncoordinated 5 vs. Ensembl Xenopus
Match: UNC5D (unc-5 netrin receptor D [Source:NCBI gene;Acc:100490873])

HSP 1 Score: 275.404 bits (703), Expect = 4.459e-77
Identity = 258/964 (26.76%), Postives = 427/964 (44.29%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWF---SEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCESGKCFGPKQQI--RNCSQAIC---QKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRR------GMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNA----QDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPIS-LDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGR--NDCAMIVE 3029
            +P F++EP   Y V KS+P  + C A P   +  F  + ++ + ++ +SE  +           +  G + +  Y+   +  +E F    +Y C C AW+ +   +K ++     A ++ +Y +  F+  P   ++     +VL C PP+  P ++V WLKN+ELI +     +       LII++   SDSGNYTCVA +    ++S  A + V +   WS+W +  AC + C   GK          ++R R C           C GP  +   C+  C   +  W+ WS W+ +C P C Q R R     KC  P   I  + C  ++    +  +P  L+ S+S     +         +   II   +   G I+L  R        ++ S+   G  + +  K+ +    LLLN+  +  +   + ++     QD +   L+ E  + ++P+ ++        ++    ++ P       T S + P  NN     R +  TL  + K   +    SI                + E  A G     GGRL +P +G+SL IP  AI   NS E+FL V +   ++P ++  E+LL P + CGP    L  P+ LTIPHCA + C  WNIR L  R Q  +    W+E+ +   ++    + Y  LD  S H+++D      + G   PL+D +V   L+V  F     + +D+ +RV+ I +T  A + V+ +E    GQLL+  K L F  +   I   + D+    WR    +  Q   +S VW    S  Q +H    LE   P  +  SC I V+Q+   +   +I  V+   L    ++P   L+    + E S          F++  + RQ++    D+       WQ LA  + +N NL+YF+ K SPS  +LDLWE+R   +G +  L   L  IGR  N  +++ E
Sbjct:   46 LPHFLMEPDDAYIV-KSNPIHLRCRAMPAMQI-FFKCNGEWVHQSEHVSEESVD----------EATGLKIREVYINVTRQQVEDFHGSEDYWCQCIAWSNL-GTSKSRR-----AFVRIAYLRKNFEQDPKGKEVLIDTMIVLHCRPPEGIPTAEVEWLKNEELIDSLMDENIDTRASHNLIIRQARLSDSGNYTCVASNIVAKRRSASATVIVFVHGGWSSWAEWSACNVRC---GKGF--------QKRSRTCTNPAPLNGGTFCDGPSVQKITCNALC-PVDGNWDVWSEWS-VCSPECEQQRDR-----KCIAPAPTIGGKPCEGSLLCFNKTFNPLTLIHSRSHLCAENASDIALYSGLGAAIIAVAVLVVG-ITLYRRSQSEYGVDVIDSSALTGGFQTFNFKTVRQGNSLLLNSSLQPDLTVSRTYSGPICFQDPMDKELMTES-SIFNPLTDIKVKVQSSFMVSLGVTDRPDFQGK--TISGSFPHGNN-----RCFG-TLHNRNKLPYIQNLTSISS--------------KPEMRASGHFGHQGGRLVMPNTGVSLLIPHKAIAEDNSWEIFLIVNQGEPSLP-LEGAEVLLGPEVTCGPFDINLSTPVALTIPHCAEVSCEHWNIR-LKRRSQQGK----WEEIMS---LDDETTSFYCLLDPFSCHILLDSFGTYALVG--EPLTDCAVK-ELKVAVFGCMSCNSLDYNLRVYCIDNTPCAFQEVLSNERHQGGQLLEEPKLLHFKGNTFSIQISVLDIPPFLWRIKPFTACQEVPFSRVW---CSNQQPLHCAFSLERYTPATTQLSCKICVRQV---KGHELILQVQTSILE---ILPFGELEHSFFAPEDSNFPAHTGPKAFKIPHSIRQRICATFDTPNSKGKDWQLLAQKLSINRNLSYFATKNSPSAVILDLWEARYPYDGNLDSLACALEEIGRTQNKLSLVTE 928          
BLAST of Uncoordinated 5 vs. Ensembl Xenopus
Match: ndufaf7 (NADH:ubiquinone oxidoreductase complex assembly factor 7 [Source:Xenbase;Acc:XB-GENE-996599])

HSP 1 Score: 270.781 bits (691), Expect = 1.035e-75
Identity = 238/969 (24.56%), Postives = 432/969 (44.58%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFC----ADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFS--EYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELIT---NSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCE------SGK-CFGPKQQIRNCSQAICQKP-DPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKN------HNAQDIVATS---LLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLG-WRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQE 3035
            +P F++EP+  Y V K+ P  + C A P + +   C      ++   +N+++ E+   +V+              + S  +  + + E F   +Y C C AW+      K +K     A ++ +Y +  F+  P   +++  ++++L C PP+  P ++V WLKN+++I    + N+  +TID    LII++   SD+ NYTCVA++    ++S  A + V +   WS WT+  AC              C    ++R R C           C+G   +   C   C + + +W +WS W+T C   C+  R R C        GK C GP  Q +NC+  +C K  + +    S +  +Y+ + I + +   I +I+   + +K +        ++ ++  NG  +    K+ +  E LL      ++   +        H+  D +  +   LL+ +PN    VY     N+   V P            Q   S  T  +++  ++    N+TL  K ++                    L    +    A+GT  + GG L +P SG+SL IP GA+  G   EM++ V R     P I+  + LL+PV+ CGPP   + +P+ILT+ HCA     DW +++     Q       W+++  V   N +    Y Q++S + H++ + L    + G     +  S + RL++  F     + +++ IRV+ + DT++A++ VI  E K+ GQLLD  K L F  S  ++   + D+    W+    +K Q   +  +W     +N      LE    +     C + V+Q++       +        ++   +P+   A +++       + P  + F +    RQ+L   LD+       W+ LA+ + L+  LNYF+ K SP+  +LDLWE++   EG ++ L  +L  +GR++  + +  E
Sbjct:   29 LPHFLIEPEEAYIV-KNKPVNLYCKASPATQIYFKCNSEWVHQKDHVVNEKVDETSGLIVR--------------EVSIEISRQQVEELFGLEDYWCQCVAWSS-AGTTKSRK-----AYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPGAEVEWLKNEDVIDPVEDRNF-YITIDH--NLIIKQARLSDTANYTCVAKNIVGKRRSTTATVIVYVNGGWSTWTEWSAC-----------SNRCGKGYQKRTRTCTNPAPLNGGYICEGQGVQKMACTSLCPE-DGEWTAWSKWST-CGTECTHWRRRDCANPPPRNGGKDCDGPVLQSKNCTDGLCIKTVNDTSAPSSDNVALYVGIVIAVIVCLAISVIVALFVYRKNHRGF--ESDIIDTSALNGGFQAVNIKAARQGENLLGVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPLLDPLPNLKIKVY-----NSSGTVTP------------QDDLSDYTSKLSSQITQSLLENDTLNMKNQS--------------------LARQTDPSCTAFGTFNSLGGHLIIPNSGVSLLIPAGAVPQGRVYEMYVTVHRKENMRPPIEDSQTLLTPVVSCGPPGALMTRPVILTMHHCAETTGEDWKMQLKEQSVQGQ-----WEDVVFVGEENFTTP-CYIQMESEACHILTETLSTYALVG---QSTSKSSAKRLKLALFGPTSCTSLEYNIRVYCLDDTQDALKEVIQQERKVGGQLLDEPKTLHFKGSTHNLRLSIHDVPHSLWKSKLLAKYQEIPFYHIWS-GCQRNLHCTFTLERFSLSTVELVCKLCVRQVEGEGQIFQLNCTASEEPSSIIDLPLMDSASTIT-----TIVGP--SAFSIPLTIRQKLCSSLDAPQTRGHDWRMLAHKLKLDRYLNYFATKPSPTGVILDLWEAQNYPEGNLSTLAAVLEEMGRHETMISLAGE 904          
BLAST of Uncoordinated 5 vs. Ensembl Mouse
Match: Unc5d (unc-5 netrin receptor D [Source:MGI Symbol;Acc:MGI:2389364])

HSP 1 Score: 280.026 bits (715), Expect = 9.230e-79
Identity = 257/959 (26.80%), Postives = 430/959 (44.84%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWF---SEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAIC---QKP----DPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNA----QDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQY---TYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGR 3005
            +P FI EP+  Y + KS+P  + C A P   +  F  + ++ + N+ +SE  L           +  G + +  ++   +  +E F    +Y C C AW+ +   +K +K     A ++ +Y +  F+  P   ++     +VL C PP+  P ++V WLKN+E I +     +       LII++   SDSGNYTC+A +    ++S  A + V +   WS+WT+  AC +            C    ++R R C           C+G   +   C   C   +  W  WS W+ +C P C   R+R C +      GK C G  Q+  NC+  +C   +KP     P  +  +    +Y  L   +  +                   L RR    S+ + G+  I ++    NS  LLLN   +  +   + ++     QD +   L+ E  + ++P+ ++     + +V  +      +  +++Y    +S T P  NN     R ++ T+  + K  P  Q  S            LP+  EL T   G     GGRL +P +G+SL IP GAI   NS E+++++ +   ++   D  E+LLSP + CGPP   +  P  LTIPHCA++    WNI  L  R Q  +    W+E+ +V   + S    Y  LD  + H+++D      +TG   P++D +V  +L+V  F     + +D+ +RV+ + +T  A + VI  E    GQLL+  K L F  +   +   + D+    WR    +  Q   +S VW  N    Q +H    LE   PT +  SC I ++Q  L  ++ +++V      + R    I+  AQ  S   +Q         F++  + RQ++    D+       WQ LA    +N NL+YF+ + SPS  +L+LWE+R +++G +  L   L  IGR
Sbjct:   51 LPHFIEEPEDAYII-KSNPIALRCKARPAMQI-FFKCNGEWVHQNEHVSEESLD----------ESSGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWSHL-GTSKSRK-----ASVRIAYLRKNFEQDPQGREVPIEGMIVLHCRPPEGVPAAEVEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKRRSLSATVVVYVNGGWSSWTEWSACNV-----------RCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKITCTALC-PVDGSWEVWSEWS-VCSPECEHLRIRECTAPPPRNGGKFCEGLSQESENCTDGLCILDKKPLHEIKPQSIENASDIALYSGLGAAVVAVA-----------VLVIGVTLYRR----SHSDYGVDVIDSSALTGNS--LLLNPAMQPDLTVSRTYSGPICLQDPLDKELMTES-SLFNPLSDI-----KVKVQSSFMVSLGVSERAEYHGKNHSGTFPHGNN-----RGFS-TIHPRNKT-PYIQNLS-----------SLPTRTELRTT--GVFGHLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQS-DGSEVLLSPEVTCGPPDMLVTTPFALTIPHCADVSSEHWNIH-LKKRTQQGK----WEEVMSVEDESTS---CYCLLDPFACHVLLDSFGTYALTG--EPITDCAVK-QLKVAVFGCMSCNSLDYNLRVYCVDNTPCAFQEVISDERHQGGQLLEEPKLLHFKGNTFSLQVSVLDIPPFLWRIKPFTACQEVPFSRVWSSNR---QPLHCAFSLERYTPTTTQLSCKICIRQ--LKGHEQILQVQTSILESERET--ITFFAQEDSTFPAQTG----PKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAVILNLWEARHQQDGDLDSLACALEEIGR 912          
BLAST of Uncoordinated 5 vs. Ensembl Mouse
Match: Unc5d (unc-5 netrin receptor D [Source:MGI Symbol;Acc:MGI:2389364])

HSP 1 Score: 279.641 bits (714), Expect = 1.473e-78
Identity = 256/973 (26.31%), Postives = 435/973 (44.71%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWF---SEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAIC-QKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRG-------MVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNA----QDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQY---TYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAM--IVEQEI 3038
            +P FI EP+  Y + KS+P  + C A P   +  F  + ++ + N+ +SE  L           +  G + +  ++   +  +E F    +Y C C AW+ +   +K +K     A ++ +Y +  F+  P   ++     +VL C PP+  P ++V WLKN+E I +     +       LII++   SDSGNYTC+A +    ++S  A + V +   WS+WT+  AC +            C    ++R R C           C+G   +   C   C   +  W  WS W+ +C P C   R+R C +      GK C G  Q+  NC+  +C     P   ++ Q  +       +   L+  +   +  +        L RR        ++ S+   G  + +  K+ +    LLLN   +  +   + ++     QD +   L+ E  + ++P+ ++     + +V  +      +  +++Y    +S T P  NN     R ++ T+  + K  P  Q  S            LP+  EL T   G     GGRL +P +G+SL IP GAI   NS E+++++ +   ++   D  E+LLSP + CGPP   +  P  LTIPHCA++    WNI  L  R Q  +    W+E+ +V   + S    Y  LD  + H+++D      +TG   P++D +V  +L+V  F     + +D+ +RV+ + +T  A + VI  E    GQLL+  K L F  +   +   + D+    WR    +  Q   +S VW  N    Q +H    LE   PT +  SC I ++Q  L  ++ +++V      + R    I+  AQ  S   +Q         F++  + RQ++    D+       WQ LA    +N NL+YF+ + SPS  +L+LWE+R +++G +  L   L  IGR    +  I E +I
Sbjct:   51 LPHFIEEPEDAYII-KSNPIALRCKARPAMQI-FFKCNGEWVHQNEHVSEESLD----------ESSGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWSHL-GTSKSRK-----ASVRIAYLRKNFEQDPQGREVPIEGMIVLHCRPPEGVPAAEVEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKRRSLSATVVVYVNGGWSSWTEWSACNV-----------RCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKITCTALC-PVDGSWEVWSEWS-VCSPECEHLRIRECTAPPPRNGGKFCEGLSQESENCTDGLCILDKKPLHEIKPQRWSRRGIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSHSDYGVDVIDSSALTGGFQTFNFKTVRQGNSLLLNPAMQPDLTVSRTYSGPICLQDPLDKELMTES-SLFNPLSDI-----KVKVQSSFMVSLGVSERAEYHGKNHSGTFPHGNN-----RGFS-TIHPRNKT-PYIQNLS-----------SLPTRTELRTT--GVFGHLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQS-DGSEVLLSPEVTCGPPDMLVTTPFALTIPHCADVSSEHWNIH-LKKRTQQGK----WEEVMSVEDESTS---CYCLLDPFACHVLLDSFGTYALTG--EPITDCAVK-QLKVAVFGCMSCNSLDYNLRVYCVDNTPCAFQEVISDERHQGGQLLEEPKLLHFKGNTFSLQVSVLDIPPFLWRIKPFTACQEVPFSRVWSSNR---QPLHCAFSLERYTPTTTQLSCKICIRQ--LKGHEQILQVQTSILESERET--ITFFAQEDSTFPAQTG----PKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAVILNLWEARHQQDGDLDSLACALEEIGRTHTKLSNITEPQI 943          
BLAST of Uncoordinated 5 vs. Ensembl Mouse
Match: Unc5c (unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI:1095412])

HSP 1 Score: 268.47 bits (685), Expect = 8.572e-75
Identity = 237/971 (24.41%), Postives = 433/971 (44.59%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFC----ADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFS--EYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELIT---NSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAICQKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVAT--SLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEY--PIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLG-WRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTV--------FRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQE 3035
            +P F++EP+  Y V K+ P  + C A P + +   C      ++   +++ + E+   +V+              + S  +  + + E F   +Y C C AW+      K +K     A ++ +Y +  F+  P   +++  ++++L C PP+  P ++V WLKN+++I    + N+  +TID    LII++   SD+ NYTCVA++    +KS  A + V +   WS WT+   C              C    ++R R C           C+G   +   C   C   + +W SWS W+T C   C+  R R C +      GK C G   Q +NC+  +C +  P    +S    +Y+ + I +++   I +++   + +K              NH +  + I  + +        LN   +   V IK    QD++A    L +       PVY +H  +++   +P   S    P+ +     Y+S+  +   P      ++  L+ +   + L  E      +  L +  L    +    A+GT  + GG L +P SG+SL IP GAI  G   EM++ V R     P ++  + LL+PV+ CGPP   L +P+ILT+ HCA+    DW I     + +N  +   W+++  V   N +    Y QLD+ + H++ ++L    + G     +  + + RL++  F     S +++ IRV+ + DT++A++ V+  E ++ GQLL+  K L F  S  ++   + D++   W+    +K Q   +  +W       + +H              C  T++++ L   + V ++   +      +  ++              LDP  T+        F +    RQ+L   LD+       W+ LA+ + L+  LNYF+ K SP+  +LDLWE++   +G ++ L  +L  +GR++  + +  E
Sbjct:   61 LPHFLIEPEEAYIV-KNKPVNLYCKASPATQIYFKCNSEWVHQKDHVVDERVDETSGLIVR--------------EVSIEISRQQVEELFGPEDYWCQCVAWSS-AGTTKSRK-----AYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNF-YITIDH--NLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWSVC-----------NSRCGRGYQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLC-PVDGRWTSWSKWST-CGTECTHWRRRECTAPAPKNGGKDCDGLVLQSKNCTDGLCMQAAP----DSDDVALYVGIVIAVTVCLAITVVVALFVYRK--------------NHRDFESDIIDSSA--------LNGGFQP--VNIKAAR-QDLLAVPPDLTSAAAMYRGPVYALHDVSDK---IPMTNSPILDPLPNLKIKVYNSSGAV--TPQDDLAEFSSKLSPQMTQSLLENE------ALNLKNQSLARQTDPSCTAFGTFNSLGGHLIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPMEDSQTLLTPVVSCGPPGALLTRPVILTLHHCADPSTEDWKI-----QLKNQAVQGQWEDVVVVGEENFTTP-CYIQLDAEACHILTENLSTYALVG---QSTTKAAAKRLKLAIFGPLCCSSLEYSIRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSIHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHIWS---GSQRNLH--------------CTFTLERLSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPASTITTVTGPSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAE 928          
BLAST of Uncoordinated 5 vs. Ensembl Mouse
Match: Unc5c (unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI:1095412])

HSP 1 Score: 262.307 bits (669), Expect = 1.457e-72
Identity = 239/990 (24.14%), Postives = 430/990 (43.43%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFC----ADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFS--EYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELIT---NSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCESGKCFGPKQQIRNCSQAICQKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLL-----PRRGMVFSNH-NNGITKIYTNKSPKNSEKLLLNNEQKSTVVTI----KNHN--AQDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQYTY---SSTTPLINNPYS------KERSYNET--------LTE-KQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLG-WRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTV--------FRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQE 3035
            +P F++EP+  Y V K+ P  + C A P + +   C      ++   +++ + E+   +V+              + S  +  + + E F   +Y C C AW+      K +K     A ++ +Y +  F+  P   +++  ++++L C PP+  P ++V WLKN+++I    + N+  +TID    LII++   SD+ NYTCVA++    +KS  A + V +   WS WT+   C              C    ++R R C           C+G   +   C   C   + +W SWS W+T C   C+  R R C +     PK   ++C           L+L+S++ T                      +  +G+I  +     P+    FS+  ++    +Y       +  L +     + VV +    KNH     DI+ +S LN     + PV    +  +   V P + S   +     Y     S   P+ N+P        K + YN +        L E   K +P   +  +   +  L +  L    +    A+GT  + GG L +P SG+SL IP GAI  G   EM++ V R     P ++  + LL+PV+ CGPP   L +P+ILT+ HCA+    DW I++     +N  +   W+++  V   N +    Y QLD+ + H++ ++L    + G     +  + + RL++  F     S +++ IRV+ + DT++A++ V+  E ++ GQLL+  K L F  S  ++   + D++   W+    +K Q   +  +W       + +H              C  T++++ L   + V ++   +      +  ++              LDP  T+        F +    RQ+L   LD+       W+ LA+ + L+  LNYF+ K SP+  +LDLWE++   +G ++ L  +L  +GR++  + +  E
Sbjct:   61 LPHFLIEPEEAYIV-KNKPVNLYCKASPATQIYFKCNSEWVHQKDHVVDERVDETSGLIVR--------------EVSIEISRQQVEELFGPEDYWCQCVAWSS-AGTTKSRK-----AYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNF-YITIDH--NLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWSVC-----------NSRCGRGYQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLC-PVDGRWTSWSKWST-CGTECTHWRRRECTAP---APKNGGKDCD---------GLVLQSKNCT--------------------DGLCMQGFIYPISTEHRPQNEYGFSSAPDSDDVALYVGIVIAVTVCLAI-----TVVVALFVYRKNHRDFESDIIDSSALN---GGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNSSGAVTPQDDLAEFSSKLSPQMTQSLLENEALNLKNQSLARQTDPSCTAFGTFNSLGGHLIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPMEDSQTLLTPVVSCGPPGALLTRPVILTLHHCADPSTEDWKIQL-----KNQAVQGQWEDVVVVGEENFTTP-CYIQLDAEACHILTENLSTYALVG---QSTTKAAAKRLKLAIFGPLCCSSLEYSIRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSIHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHIWS---GSQRNLH--------------CTFTLERLSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPASTITTVTGPSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAE 947          
BLAST of Uncoordinated 5 vs. Ensembl Mouse
Match: Unc5c (unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI:1095412])

HSP 1 Score: 262.307 bits (669), Expect = 1.457e-72
Identity = 239/990 (24.14%), Postives = 430/990 (43.43%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFC----ADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFS--EYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELIT---NSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCESGKCFGPKQQIRNCSQAICQKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLL-----PRRGMVFSNH-NNGITKIYTNKSPKNSEKLLLNNEQKSTVVTI----KNHN--AQDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQYTY---SSTTPLINNPYS------KERSYNET--------LTE-KQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLG-WRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTV--------FRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQE 3035
            +P F++EP+  Y V K+ P  + C A P + +   C      ++   +++ + E+   +V+              + S  +  + + E F   +Y C C AW+      K +K     A ++ +Y +  F+  P   +++  ++++L C PP+  P ++V WLKN+++I    + N+  +TID    LII++   SD+ NYTCVA++    +KS  A + V +   WS WT+   C              C    ++R R C           C+G   +   C   C   + +W SWS W+T C   C+  R R C +     PK   ++C           L+L+S++ T                      +  +G+I  +     P+    FS+  ++    +Y       +  L +     + VV +    KNH     DI+ +S LN     + PV    +  +   V P + S   +     Y     S   P+ N+P        K + YN +        L E   K +P   +  +   +  L +  L    +    A+GT  + GG L +P SG+SL IP GAI  G   EM++ V R     P ++  + LL+PV+ CGPP   L +P+ILT+ HCA+    DW I++     +N  +   W+++  V   N +    Y QLD+ + H++ ++L    + G     +  + + RL++  F     S +++ IRV+ + DT++A++ V+  E ++ GQLL+  K L F  S  ++   + D++   W+    +K Q   +  +W       + +H              C  T++++ L   + V ++   +      +  ++              LDP  T+        F +    RQ+L   LD+       W+ LA+ + L+  LNYF+ K SP+  +LDLWE++   +G ++ L  +L  +GR++  + +  E
Sbjct:   61 LPHFLIEPEEAYIV-KNKPVNLYCKASPATQIYFKCNSEWVHQKDHVVDERVDETSGLIVR--------------EVSIEISRQQVEELFGPEDYWCQCVAWSS-AGTTKSRK-----AYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNF-YITIDH--NLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWSVC-----------NSRCGRGYQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLC-PVDGRWTSWSKWST-CGTECTHWRRRECTAP---APKNGGKDCD---------GLVLQSKNCT--------------------DGLCMQGFIYPISTEHRPQNEYGFSSAPDSDDVALYVGIVIAVTVCLAI-----TVVVALFVYRKNHRDFESDIIDSSALN---GGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIKVYNSSGAVTPQDDLAEFSSKLSPQMTQSLLENEALNLKNQSLARQTDPSCTAFGTFNSLGGHLIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPMEDSQTLLTPVVSCGPPGALLTRPVILTLHHCADPSTEDWKIQL-----KNQAVQGQWEDVVVVGEENFTTP-CYIQLDAEACHILTENLSTYALVG---QSTTKAAAKRLKLAIFGPLCCSSLEYSIRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSIHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHIWS---GSQRNLH--------------CTFTLERLSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPASTITTVTGPSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAE 947          
BLAST of Uncoordinated 5 vs. UniProt/SwissProt
Match: sp|Q8K1S2|UNC5D_MOUSE (Netrin receptor UNC5D OS=Mus musculus OX=10090 GN=Unc5d PE=1 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 1.030e-77
Identity = 256/973 (26.31%), Postives = 435/973 (44.71%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWF---SEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAIC-QKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRG-------MVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNA----QDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQY---TYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAM--IVEQEI 3038
            +P FI EP+  Y + KS+P  + C A P   +  F  + ++ + N+ +SE  L           +  G + +  ++   +  +E F    +Y C C AW+ +   +K +K     A ++ +Y +  F+  P   ++     +VL C PP+  P ++V WLKN+E I +     +       LII++   SDSGNYTC+A +    ++S  A + V +   WS+WT+  AC +            C    ++R R C           C+G   +   C   C   +  W  WS W+ +C P C   R+R C +      GK C G  Q+  NC+  +C     P   ++ Q  +       +   L+  +   +  +        L RR        ++ S+   G  + +  K+ +    LLLN   +  +   + ++     QD +   L+ E  + ++P+ ++     + +V  +      +  +++Y    +S T P  NN     R ++ T+  + K  P  Q  S            LP+  EL T   G     GGRL +P +G+SL IP GAI   NS E+++++ +   ++   D  E+LLSP + CGPP   +  P  LTIPHCA++    WNI  L  R Q  +    W+E+ +V   + S    Y  LD  + H+++D      +TG   P++D +V  +L+V  F     + +D+ +RV+ + +T  A + VI  E    GQLL+  K L F  +   +   + D+    WR    +  Q   +S VW  N    Q +H    LE   PT +  SC I ++Q  L  ++ +++V      + R    I+  AQ  S   +Q         F++  + RQ++    D+       WQ LA    +N NL+YF+ + SPS  +L+LWE+R +++G +  L   L  IGR    +  I E +I
Sbjct:   51 LPHFIEEPEDAYII-KSNPIALRCKARPAMQI-FFKCNGEWVHQNEHVSEESLD----------ESSGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWSHL-GTSKSRK-----ASVRIAYLRKNFEQDPQGREVPIEGMIVLHCRPPEGVPAAEVEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKRRSLSATVVVYVNGGWSSWTEWSACNV-----------RCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKITCTALC-PVDGSWEVWSEWS-VCSPECEHLRIRECTAPPPRNGGKFCEGLSQESENCTDGLCILDKKPLHEIKPQRWSRRGIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSHSDYGVDVIDSSALTGGFQTFNFKTVRQGNSLLLNPAMQPDLTVSRTYSGPICLQDPLDKELMTES-SLFNPLSDI-----KVKVQSSFMVSLGVSERAEYHGKNHSGTFPHGNN-----RGFS-TIHPRNKT-PYIQNLS-----------SLPTRTELRTT--GVFGHLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQS-DGSEVLLSPEVTCGPPDMLVTTPFALTIPHCADVSSEHWNIH-LKKRTQQGK----WEEVMSVEDESTS---CYCLLDPFACHVLLDSFGTYALTG--EPITDCAVK-QLKVAVFGCMSCNSLDYNLRVYCVDNTPCAFQEVISDERHQGGQLLEEPKLLHFKGNTFSLQVSVLDIPPFLWRIKPFTACQEVPFSRVWSSNR---QPLHCAFSLERYTPTTTQLSCKICIRQ--LKGHEQILQVQTSILESERET--ITFFAQEDSTFPAQTG----PKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAVILNLWEARHQQDGDLDSLACALEEIGRTHTKLSNITEPQI 943          
BLAST of Uncoordinated 5 vs. UniProt/SwissProt
Match: sp|F1LW30|UNC5D_RAT (Netrin receptor UNC5D OS=Rattus norvegicus OX=10116 GN=Unc5d PE=1 SV=4)

HSP 1 Score: 278.1 bits (710), Expect = 3.136e-77
Identity = 252/960 (26.25%), Postives = 429/960 (44.69%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWF---SEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAIC-QKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRG-------MVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNA----QDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQY---TYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGR 3005
            +P FI EP+  Y + KS+P  + C A P   +  F  + ++ + N+ +SE  L           +  G + +  ++   +  +E F    +Y C C AW+ +   +K +K     A ++ +Y +  F+  P   ++     +VL C PP+  P ++V WLKN+E I +     +       LII++   SDSGNYTC+A +    ++S  A + V +   WS+WT+  AC +            C    ++R R C           C+G   +   C   C   +  W  WS W+ +C P C   R+R C +      GK C G  Q+  NC+  +C     P   ++ Q  +       +   L+  +   +  +        L RR        ++ S+   G  + +  K+ +    LLLN      +   + ++     QD +   L+ E  + ++P+ ++     + +V  +      +  +++Y    +S T P  NN     R ++ T+  + K  P  Q  S            LP+  EL T   G     GGRL +P +G+SL IP GAI   NS E+++++ +   ++   D  E+LLSP + CGPP   +  P  LTIPHCA++    WNI  L  R Q  +    W+E+ +V   + S    Y  LD  + H+++D      +TG   P++D +V  +L+V  F     + +D+ +RV+ + +T  A + V+  E    GQLL+  K L F  +   +   + D+    WR    +  Q   +S VW  N    Q +H    LE   PT +  SC I ++Q  L  ++ +++V      + R    I+  AQ  S   +Q         F++  + RQ++    D+       WQ LA    +N NL+YF+ + SPS  +L+LWE+R +++G +  L   L  IGR
Sbjct:   51 LPHFIEEPEDAYII-KSNPIALRCKARPAMQI-FFKCNGEWVHQNEHVSEESLD----------ESSGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWSHL-GTSKSRK-----ASVRIAYLRKNFEQDPQGREVPIEGMIVLHCRPPEGVPAAEVEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKRRSLSATVVVYVNGGWSSWTEWSACNV-----------RCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKITCTALC-PVDGSWEVWSEWS-VCSPECEHLRIRECTAPPPRNGGKFCEGLSQESENCTDGLCILDKKPLHEIKPQRWSRRGIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSHSDYGVDVIDSSALTGGFQTFNFKTVRQGNSLLLNPAMHPDLTVSRTYSGPICLQDPLDKELMTES-SLFNPLSDI-----KVKVQSSFMVSLGVSERAEYHGKNHSGTFPHGNN-----RGFS-TIHPRNKT-PYIQNLS-----------SLPTRTELRTT--GVFGHLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQS-DGSEVLLSPEVTCGPPDMLVTTPFALTIPHCADVSSEHWNIH-LKKRTQQGK----WEEVMSVEDESTS---CYCLLDPFACHVLLDSFGTYALTG--EPITDCAVK-QLKVAVFGCMSCNSLDYNLRVYCVDNTPCAFQEVVSDERHQGGQLLEEPKLLHFKGNTFSLQISVLDIPPFLWRIKPFTACQEVPFSRVWSSNR---QPLHCAFSLERYTPTTTQLSCKICIRQ--LKGHEQILQVQTSILESERET--ITFFAQEDSTFPAQTG----PKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAVILNLWEARHQQDGDLDSLACALEEIGR 930          
BLAST of Uncoordinated 5 vs. UniProt/SwissProt
Match: sp|Q6UXZ4|UNC5D_HUMAN (Netrin receptor UNC5D OS=Homo sapiens OX=9606 GN=UNC5D PE=1 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 4.722e-77
Identity = 250/962 (25.99%), Postives = 429/962 (44.59%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWF---SEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAIC---QKP----DPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNA----QDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQY---TYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQT---VFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGR 3005
            +P FI EP   Y + KS+P  + C A P   +  F  + ++ + N+ +SE  L           +  G + +  ++   +  +E F    +Y C C AW+ +   +K +K     A ++ +Y +  F+  P   ++     +VL C PP+  P ++V WLKN+E I +     +       LII++   SDSGNYTC+A +    ++S  A + V +   WS+WT+  AC +            C    ++R R C           C+G   +   C   C   +  W  WS W+ +C P C   R+R C +      GK C G  Q+  NC+  +C   +KP     P  +  +    +Y  L   +  + ++++ +      +    +     ++ S+   G  + +  K+ +    LLLN+  +  +   + ++     QD +   L+ E  + ++P+ ++     + +V  +      +  +++Y    +S T P  NN       ++ +    +   P  Q  S            LP+  EL T   G     GGRL +P +G+SL IP GAI   NS E+++++ +   ++   D  E+LLSP + CGPP   +  P  LTIPHCA++    WNI  L  R Q  +    W+E   V  V     + Y  LD  + H+++D      +TG   P++D +V  +L+V  F     + +D+ +RV+ + +T  A + V+  E    GQLL+  K L F  +   +   + D+    WR    +  Q   +S VW    S  Q +H    LE   PT +  SC I ++Q  L  ++ +++V      + R    I+  AQ  S         P QT    F++  + RQ++    D+       WQ LA    +N NL+YF+ + SPS  +L+LWE+R + +G +  L   L  IGR
Sbjct:   53 LPHFIEEPDDAYII-KSNPIALRCKARPAMQI-FFKCNGEWVHQNEHVSEETLD----------ESSGLKVREVFINVTRQQVEDFHGPEDYWCQCVAWSHL-GTSKSRK-----ASVRIAYLRKNFEQDPQGREVPIEGMIVLHCRPPEGVPAAEVEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKRRSLSATVVVYVNGGWSSWTEWSACNV-----------RCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKITCTSLC-PVDGSWEVWSEWS-VCSPECEHLRIRECTAPPPRNGGKFCEGLSQESENCTDGLCILDKKPLHEIKPQSIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSQSDYGV----DVIDSSALTGGFQTFNFKTVRQGNSLLLNSAMQPDLTVSRTYSGPICLQDPLDKELMTES-SLFNPLSDI-----KVKVQSSFMVSLGVSERAEYHGKNHSRTFPHGNN-------HSFSTMHPRNKMPYIQNLS-----------SLPTRTELRTT--GVFGHLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQS-DGSEVLLSPEVTCGPPDMIVTTPFALTIPHCADVSSEHWNIH-LKKRTQQGK----WEE---VMSVEDESTSCYCLLDPFACHVLLDSFGTYALTG--EPITDCAVK-QLKVAVFGCMSCNSLDYNLRVYCVDNTPCAFQEVVSDERHQGGQLLEEPKLLHFKGNTFSLQISVLDIPPFLWRIKPFTACQEVPFSRVW---CSNRQPLHCAFSLERYTPTTTQLSCKICIRQ--LKGHEQILQVQTSILESERET--ITFFAQEDS-------TFPAQTGPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAVILNLWEARHQHDGDLDSLACALEEIGR 927          
BLAST of Uncoordinated 5 vs. UniProt/SwissProt
Match: sp|O08747|UNC5C_MOUSE (Netrin receptor UNC5C OS=Mus musculus OX=10090 GN=Unc5c PE=1 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 5.996e-74
Identity = 237/971 (24.41%), Postives = 433/971 (44.59%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFC----ADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFS--EYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELIT---NSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAICQKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVAT--SLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEY--PIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLG-WRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTV--------FRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQE 3035
            +P F++EP+  Y V K+ P  + C A P + +   C      ++   +++ + E+   +V+              + S  +  + + E F   +Y C C AW+      K +K     A ++ +Y +  F+  P   +++  ++++L C PP+  P ++V WLKN+++I    + N+  +TID    LII++   SD+ NYTCVA++    +KS  A + V +   WS WT+   C              C    ++R R C           C+G   +   C   C   + +W SWS W+T C   C+  R R C +      GK C G   Q +NC+  +C +  P    +S    +Y+ + I +++   I +++   + +K              NH +  + I  + +        LN   +   V IK    QD++A    L +       PVY +H  +++   +P   S    P+ +     Y+S+  +   P      ++  L+ +   + L  E      +  L +  L    +    A+GT  + GG L +P SG+SL IP GAI  G   EM++ V R     P ++  + LL+PV+ CGPP   L +P+ILT+ HCA+    DW I     + +N  +   W+++  V   N +    Y QLD+ + H++ ++L    + G     +  + + RL++  F     S +++ IRV+ + DT++A++ V+  E ++ GQLL+  K L F  S  ++   + D++   W+    +K Q   +  +W       + +H              C  T++++ L   + V ++   +      +  ++              LDP  T+        F +    RQ+L   LD+       W+ LA+ + L+  LNYF+ K SP+  +LDLWE++   +G ++ L  +L  +GR++  + +  E
Sbjct:   61 LPHFLIEPEEAYIV-KNKPVNLYCKASPATQIYFKCNSEWVHQKDHVVDERVDETSGLIVR--------------EVSIEISRQQVEELFGPEDYWCQCVAWSS-AGTTKSRK-----AYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPVAEVEWLKNEDIIDPAEDRNF-YITIDH--NLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWTEWSVC-----------NSRCGRGYQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLC-PVDGRWTSWSKWST-CGTECTHWRRRECTAPAPKNGGKDCDGLVLQSKNCTDGLCMQAAP----DSDDVALYVGIVIAVTVCLAITVVVALFVYRK--------------NHRDFESDIIDSSA--------LNGGFQP--VNIKAAR-QDLLAVPPDLTSAAAMYRGPVYALHDVSDK---IPMTNSPILDPLPNLKIKVYNSSGAV--TPQDDLAEFSSKLSPQMTQSLLENE------ALNLKNQSLARQTDPSCTAFGTFNSLGGHLIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPMEDSQTLLTPVVSCGPPGALLTRPVILTLHHCADPSTEDWKI-----QLKNQAVQGQWEDVVVVGEENFTTP-CYIQLDAEACHILTENLSTYALVG---QSTTKAAAKRLKLAIFGPLCCSSLEYSIRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSIHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHIWS---GSQRNLH--------------CTFTLERLSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPASTITTVTGPSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAE 928          
BLAST of Uncoordinated 5 vs. UniProt/SwissProt
Match: sp|Q761X5|UNC5C_RAT (Netrin receptor UNC5C OS=Rattus norvegicus OX=10116 GN=Unc5c PE=1 SV=1)

HSP 1 Score: 267.314 bits (682), Expect = 1.322e-73
Identity = 236/971 (24.30%), Postives = 432/971 (44.49%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFC----ADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFS--EYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELIT---NSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAICQKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVAT--SLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEY--PIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLG-WRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTV--------FRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQE 3035
            +P F++EP+  Y V K+ P  + C A P + +   C      ++   +++ + E+   +V+              + S  +  + + E F   +Y C C AW+      K +K     A ++ +Y +  F+  P   +++  ++++L C PP+  P ++V WLKN+++I    + N+  +TID    LII++   SD+ NYTCVA++    +KS  A + V +   WS W +   C              C    ++R R C           C+G   +   C   C   + +W SWS W+T C   C+  R R C +      GK C G   Q +NC+  +C +  P    +S    +Y+ + I +++   I +++   + +K              NH +  + I  + +        LN   +   V IK    QD++A    L +       PVY +H  +++   +P   S    P+ +     Y+S+  +   P      ++  L+ +   + L  E      +  L +  L    +    A+GT  + GG L +P SG+SL IP GAI  G   EM++ V R     P ++  + LL+PV+ CGPP   L +P+ILT+ HCA+    DW I     + +N  +   W+++  V   N +    Y QLD+ + H++ ++L    + G     +  + + RL++  F     S +++ IRV+ + DT++A++ V+  E ++ GQLL+  K L F  S  ++   + D++   W+    +K Q   +  +W       + +H              C  T++++ L   + V ++   +      +  ++              LDP  T+        F +    RQ+L   LD+       W+ LA+ + L+  LNYF+ K SP+  +LDLWE++   +G ++ L  +L  +GR++  + +  E
Sbjct:   61 LPHFLIEPEEAYIV-KNKPVNLYCKASPATQIYFKCNSEWVHQKDHVVDERVDETSGLIVR--------------EVSIEISRQQVEELFGPEDYWCQCVAWSS-AGTTKSRK-----AYVRIAYLRKTFEQEPLGKEVSLEQEVLLQCRPPEGIPMAEVEWLKNEDIIDPVEDRNF-YITIDH--NLIIKQARLSDTANYTCVAKNIVAKRKSTTATVIVYVNGGWSTWAEWSVC-----------NSRCGRGYQKRTRTCTNPAPLNGGAFCEGQSVQKIACTTLC-PVDGRWTSWSKWST-CGTECTHWRRRECTAPAPKNGGKDCDGLVLQSKNCTDGLCMQAAP----DSDDVALYVGIVIAVTVCLAITVVVALFVYRK--------------NHRDFESNIIDSSA--------LNGGFQP--VNIKAAR-QDLLAVPPDLTSAAAMYRGPVYALHDVSDK---IPMTNSPILDPLPNLKIKVYNSSGAV--TPQDDLAEFSSKLSPQMTQSLLENE------ALNLKNQSLARQTDPSCTAFGTFNSLGGHLIIPNSGVSLLIPAGAIPQGRVYEMYVTVHRKENMRPPMEDSQTLLTPVVSCGPPGALLTRPVILTLHHCADPNTEDWKI-----QLKNQAVQGQWEDVVVVGEENFTTP-CYIQLDAEACHILTENLSTYALVG---QSTTKAAAKRLKLAIFGPLCCSSLEYSIRVYCLDDTQDALKEVLQLERQMGGQLLEEPKALHFKGSIHNLRLSIHDITHSLWKSKLLAKYQEIPFYHIWS---GSQRNLH--------------CTFTLERLSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPASTITTVTGPSAFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQNFPDGNLSMLAAVLEEMGRHETVVSLAAE 928          
BLAST of Uncoordinated 5 vs. TrEMBL
Match: E1CHK7 (Uncoordinated 5 OS=Dugesia japonica OX=6161 GN=Djunc5A PE=2 SV=1)

HSP 1 Score: 1615.51 bits (4182), Expect = 0.000e+0
Identity = 798/1002 (79.64%), Postives = 882/1002 (88.02%), Query Frame = 3
Query:   72 MWRSGNNS-FHFHLITLFLVVIRKSNQQLEEVQ-----ESEVDGKKDLVQPNEKHYDGIPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFSEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCESGKCFGPKQQIRNCSQAICQKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKA---APLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDSSWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQEILKQC 3050
            MW SGN   FH+ ++ + + V +K   QL   +     ESEVDGKKDLVQPNEKHYDGIPKF++EP PFYYVNK+HPA I+C+AEPVSHVNIFCADKQFSYMN E SESGL V+KMN  NQ D KG RWKFS  V+YKD++EWFSEYKCYCEAWN+I  INKDKKVHSSAALIQESYFQN+FK +P + +L EG KL L CTPP+SKPNSKVTWLKN ELIT SN+PL+ IDE KRLII++V KSDSGNYTCVAQSQG+VKKSK AVI +TMKY WS W     CP IC ME KC  E+CS+ +R+R+R+CL +  K +  +CKG   E E CD  CEK ESKWNSWS WTTIC P CSQTRVRRCE G CFGPKQQ RNCSQ ICQ+ DPSL+LESQSTTMYL LFITISILFIIILIILCLITQKGYISLLPRRGMVFSNHNNG+TKIYTNKS KNSEK LLNN+QKST+VTIKNHNAQD+VATSLL+E+PNNYSPVYEMHS+NNRDQVLPAIYS+YP+ISKSQYTY ST PL+N+  S ERSYNET  E QKA   +PLYQE SIGRGSCGLLSNYLP D+EL+T+AWGTIT AGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDH NIPVIDMMEMLLSPVILCGPP  +LLK +ILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELST+RPVNRSD+N+YAQLDS SAHLI+D LQM+CITGCLSPLSD SVSIRLR+LAFSLPLSSE+DH+IRVHLIPDTKEAIENVI SELKLNGQLLDNSKK +FSSSGGDIA CLDDLSLGWRCH+++KMQTFSYS +WRLNHSQNQEIH  LEHVDPTR+GFSCNIT+QQIDLPQNQ ++RV+KER+ NNRS++PISLD++S +RE+SQAYLDPLQTVFRLS  TRQQLWPLLD SWQTLANHMLLNGNLNYFSEK SPSDALLDLWE+RCR+EGAIADLINILRVIGRNDCAMIVEQ+ILKQC
Sbjct:    1 MWWSGNKFLFHYLVVIVLVNVNKKVFSQLGSREWPDNSESEVDGKKDLVQPNEKHYDGIPKFLVEPHPFYYVNKTHPALIICVAEPVSHVNIFCADKQFSYMNTERSESGLIVIKMNHLNQPDSKGNRWKFSLEVKYKDVLEWFSEYKCYCEAWNQITMINKDKKVHSSAALIQESYFQNDFKTTPKSQELREGNKLELQCTPPESKPNSKVTWLKNDELITQSNFPLIIIDESKRLIIEQVLKSDSGNYTCVAQSQGVVKKSKPAVIIITMKYNWSPWAKWNTCPEICKMETKCQNEICSSSHRQRIRYCLNEEIKVEDKHCKGESNEKESCDKACEKEESKWNSWSFWTTICFPNCSQTRVRRCEFGNCFGPKQQSRNCSQIICQRADPSLILESQSTTMYLGLFITISILFIIILIILCLITQKGYISLLPRRGMVFSNHNNGMTKIYTNKSSKNSEKFLLNNDQKSTIVTIKNHNAQDLVATSLLSEIPNNYSPVYEMHSNNNRDQVLPAIYSDYPMISKSQYTYPSTAPLLNSILSPERSYNETSEEDQKANLSSPLYQELSIGRGSCGLLSNYLPPDMELDTIAWGTITTAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHTNIPVIDMMEMLLSPVILCGPPQIQLLKSVILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTIRPVNRSDSNIYAQLDSTSAHLIIDQLQMICITGCLSPLSDSSVSIRLRILAFSLPLSSELDHIIRVHLIPDTKEAIENVIASELKLNGQLLDNSKKFTFSSSGGDIALCLDDLSLGWRCHSSNKMQTFSYSFIWRLNHSQNQEIHFLLEHVDPTRTGFSCNITIQQIDLPQNQVIVRVIKERSPNNRSIIPISLDSRSNNREFSQAYLDPLQTVFRLSFTTRQQLWPLLDPSWQTLANHMLLNGNLNYFSEKMSPSDALLDLWEARCRDEGAIADLINILRVIGRNDCAMIVEQDILKQC 1002          
BLAST of Uncoordinated 5 vs. TrEMBL
Match: A0A267FQL3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019529g1 PE=4 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 1.884e-119
Identity = 308/1032 (29.84%), Postives = 484/1032 (46.90%), Query Frame = 3
Query:  210 EKHYDGIPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFSE-YKCYCEAWNRIVSI-NKDKKVHSSAALIQESYFQNE---FKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKN-KELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICH--MEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES--------------GKCFGPKQQIRNCSQA-ICQKPDPSLLL-----ESQST-------------TMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPK---NSEKLLLNNEQKSTVVTIKNHNAQDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGS-------------CGLLSNYL-----PSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVL----------SARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISA--HLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSS---------GGDIAFC--LDDLSLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQ 3032
            E+   G P+F+ +P+P YYV +S PA+I C A+   +V + C              +G A+ K  E      + +R +F  +V++ D+ +W S  Y C CEAW +I ++ N+ +KV SS+  ++ +YF+++   F   P +  L+  E + L CTPP   P  KV WLK+ K L   S    +TID   +LII+ +   D GNY+C+A+  G+   S  A + + +   WS W+    C   C   +  +C  E C+ + R R R C       +   C G   E  PC+  C  +  +W  WS WT  C   C  +R RRC+S                     Q+ RNCS+  +C++ + +LL+     +SQ +              +Y+ L    +++ II+L+I+  + +K       R+G+ ++ H NG + + ++   +     E LL  +   S   +IKN N   +  ++       +  P+  + S+ +  Q   A+  + P+    Q +Y         P S    Y+    +   A+ L    S G GS               LL  ++     P  +  + VAWGT+  AGGRLCLP+SG++LT+P GA+   + E++FLAVCRD  + P +D    LLS  + CGP    L +P IL++PH A+++   WN+ V+          SA   ++     W+E   V   + + A  Y QLD+  +  HL+ + L   C+ G    L       +LRV AF    S   +  +R+H +PDT +A+  V+ +E     +L+D  ++L F  +             A C  ++DLSLGWRC        F +  VW           + LE VDPTR   SC++ V Q      + V+R+   R      L  +S  + S         +DPLQ VFRL    R  L  LLD+       W+ LA  + L+  + YF+ K SPS+ LLDLWE+RCR  GA+ADL   L+ +GR D A +VEQ
Sbjct:   50 EQLLPGAPRFVEQPRPVYYVTRSTPASIECAADQAMYVTVHC--------------NGRALNKKVEVASDHERPERQRFHALVDFNDVRDWSSSSYYCNCEAWGKIPALKNELRKVISSSGYVRLAYFESDRFQFDPMPRSVPLDASE-VTLSCTPPKGSPKPKVKWLKDGKPLDVRSQSDRITIDHQAQLIIRPLRLDDRGNYSCLAEIPGLTLASGSAELNIYVNGGWSHWSQWLGCDPSCDETVSPECRAE-CAAQQRTRERRCDSPAPAFNGQPCHGAARETAPCNAKCAVH-GQWGQWSQWTQ-CSSDCLSSRQRRCDSPPPSGPGGRPCPGIASSSAAGQEWRNCSEGRLCKRDNAALLMLRNDGQSQGSGSATDSGVGLANLAIYIGLVAAAAVVVIIVLVIVYFVRRKSATFGSNRQGLRYNVHMNGNSSVSSSAGKEAQITHELLLPASSGPSGGCSIKNGNGVMLEMSAAAAAPAPSGMPMPSLGSYQHLQQQQ-ALRVQLPL---PQMSYLQQQQCCPRPASSIGVYSNGQLDGSGASNL----SPGGGSSLSRPCSALYHEPASLLGGHVTAACVPPGLSADQVAWGTVGPAGGRLCLPESGVTLTVPPGAVTSPHGEDLFLAVCRDERDHPSLDGRRTLLSSTVACGPASVSLARPAILSLPHSASLRHGFWNVAVMRRCCEPPSSESAADASTDSAGSWREFLRVGSESAALAPAYCQLDAADSLCHLVTESLGRFCLVG--QSLDGGCAVKQLRVAAFVSSGSGGSELAVRLHALPDTGDALAAVLAAERSSGWRLVDEPRQLLFRDALPQQQQQQQQQQSALCCSVEDLSLGWRCRTRRVEVPFGH--VWSCGPG-GLHCSLSLEQVDPTRMAVSCSLAVYQAGAYSARLVLRLACSRGEQPGLL--MSSHSASPISSTCLPVVDPLQPVFRLQPKLRAALSRLLDAPSARANDWRQLARLLGLDRQVGYFAAKPSPSECLLDLWEARCRGPGALADLAEALKAMGRRDAASLVEQ 1048          
BLAST of Uncoordinated 5 vs. TrEMBL
Match: A0A267H361 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig018893g1 PE=4 SV=1)

HSP 1 Score: 400.979 bits (1029), Expect = 4.398e-118
Identity = 308/1037 (29.70%), Postives = 483/1037 (46.58%), Query Frame = 3
Query:  210 EKHYDGIPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFSE-YKCYCEAWNRIVSI-NKDKKVHSSAALIQESYFQNE---FKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKN-KELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICH--MEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES--------------GKCFGPKQQIRNCSQA-ICQKPDPSLLL-----ESQST-------------TMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPK---NSEKLLLNNEQKSTVVTIKNHNAQDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGS-------------CGLLSNYL-----PSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVL----------SARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISA--HLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSS--------------GGDIAFC--LDDLSLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQ 3032
            E+   G P+F+ +P+  YYV +S PA+I C A+   +V + C              +G A+ K  E      + +R +F  +V++ D+ +W S  Y C CEAW +I ++ N+ +KV SS+  ++ +YF+++   F   P +  L+  E + L CTPP   P  KV WLK+ K L   S    +TID   +LII+ +   D GNY+C+A+  G+   S  A + + +   WS W+    C   C   +  +C  E C+ + R R R C       +   C G   E  PC+  C  +  +W  WS WT  C   C  +R RRC+S                     Q+ RNCS+  +C++ + +LL+     +SQ +              +Y+ L    +++ II+L+I+  + +K       RRG+ ++ H NG + + ++   +     E LL  +   S   +IKN N   +  ++       +  P+  + S+ +  Q   A+  + P+    Q +Y         P S    Y+    +   A+ L    S G GS               LL  ++     P  +  + VAWGT+  AGGRLCLP+SG++LT+P GA+   + E++FLAVCRD  + P +D    LLS  + CGP    L +P IL++PH A+++   WN+ V+          SA   ++     W+E   V   + + A  Y QLD+  +  HL+ + L   C+ G    L       +LRV AF    S   +  +R+H +PDT +A+  V+ +E     +L+D  ++L F  +                  A C  ++DLSLGWRC        F +  VW           + LE VDPTR   SC++ V Q      + V+R+   R      L  +S  + S         +DPLQ VFRL    R  L  LLD+       W+ LA  + L+  + YF+ K SPS+ LLDLWE+RCR  GA+ADL   L+ +GR D A +VEQ
Sbjct:   50 EQLLPGAPRFVEQPRRVYYVTRSTPASIECAADQAMYVTVHC--------------NGRALNKKVEVASDHERPERQRFHALVDFNDVRDWSSSSYYCNCEAWGKIPALKNELRKVISSSGYVRLAYFESDRFQFDPMPRSVPLDASE-VTLSCTPPKGSPKPKVKWLKDGKPLDVRSQSDRITIDHQAQLIIRPLRLDDRGNYSCLAEIPGLTLASGSAELNIYVNGGWSHWSQWLGCDPSCDETVSPECRAE-CAAQQRTRERRCDSPAPAFNGQPCHGAARETAPCNAKCAVH-GQWGQWSQWTQ-CSSDCLSSRQRRCDSPPPSGPGGRPCPGIASSSAAGQEWRNCSEGRLCKRDNAALLMLRNDGQSQGSGSATDSGVGLANLAIYIGLVAAAAVVVIIVLVIVYFVRRKSATFGSNRRGLRYNVHMNGNSSVSSSAGKEAQITHELLLPASSGPSGGCSIKNGNGVMLEMSAAAAAPAPSGMPMPSLGSYQHLQQQQ-ALRVQLPL---PQMSYLQQQQCCPRPASSIGVYSNGQLDGSGASNL----SPGGGSSLSRPCSALYHEPASLLGGHVTAACVPPGLSADQVAWGTVGPAGGRLCLPESGVTLTVPPGAVTSPHGEDLFLAVCRDERDHPSLDGRRTLLSSTVACGPASVSLARPAILSLPHSASLRHGFWNVAVMRRCCEPPSSESAADASTDSAGSWREFLRVGSESAALAPAYCQLDAADSLCHLVTESLGRFCLVG--QSLDGGCAVKQLRVAAFVSSGSGGSELAVRLHALPDTGDALAAVLAAERSSGWRLVDEPRQLLFRDALPQQQQQQQQQQQQQQQSALCCSVEDLSLGWRCRTRRVEVPFGH--VWSCGPG-GLHCSLSLEQVDPTRMAVSCSLAVYQAGAYSARLVLRLACSRGEQPGLL--MSSHSASPISSTCLPVVDPLQPVFRLQPKLRAALSRLLDAPSARANDWRQLARLLGLDRQVGYFAAKPSPSECLLDLWEARCRGPGALADLAEALKAMGRRDAASLVEQ 1053          
BLAST of Uncoordinated 5 vs. TrEMBL
Match: A0A267GZF3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028400g1 PE=4 SV=1)

HSP 1 Score: 377.481 bits (968), Expect = 1.489e-109
Identity = 288/1013 (28.43%), Postives = 475/1013 (46.89%), Query Frame = 3
Query:  210 EKHYDGIPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFS----------EYKCYCEAWNRIVSINKD-KKVHSSAALIQESYFQNE-FKVSPTNTKLNEGEKLVLL-CTPPDSKPNSKVTWLKNKELITNSNYP-LVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRC--------------ESGKCFGPKQQIRNCSQAICQKPDPSLL--LESQSTT-------------MYXXXXXXXXXXXXXXXXXXXXXXQK---GYISLLPRRGMVFSNHNNG--ITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHAN-IPVIDMMEMLLSPVILCGPP--HTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDAN------VYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLS--SEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKER---ALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDS--------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQEI 3038
            E      PK +++P+P YY +   PA I C A+  S+V I C  +    +N++L           E      +  R +FS  +E+ D+ +W +          E+ C CEAWN I  +N   +K+ S  AL++ + F+++ F+  P    +++    V+L CTPP   P  +V WLK+ + +  +     VTID  K+LII+ +   D GNY+CVA+  G+   S+ A + + +   WS WT + +C   C    +C  + C  ++  R R C     +     C+G    +E CD  C      W+ WS W+  C   C   R R C              +SG      +++RNC+   C+K DP+LL  +     T             +Y+ LF+  +++  ++++I+ L+ +K   G+ S   R      +H NG   T    +K  K++ +LLL  E  S+  TIKN N  ++          +       M +  ++  V   + S Y  I+K    +   T   ++P              + ++ LY+  + G          LP   + E +AW  +   GGR+CL ++G+SLT+P   +    S E+FL VC D ++  PV+   + LLSPV+ CG     +RL +P++LT+PH A ++   WN+ VL     ++  P +WKEL  V   N+           + QLD    HL++  L   C+ G    L       +LR+ AF+ PLS  +  D  +R+H++ DT +A++ V+ SE +   +L+D  ++L+F   G  +   +++LSLGWR  +  K Q   +  VW  + +        LEHVDPTR   SC I + Q      + V+ +V  +      N    P    +  +       ++DP  TVFRL    R+    LLD+         W TL+  M +   +NYF+ + SP++ LLDLWE+R REE ++A L+  L+ I R D A ++E ++
Sbjct:   62 EATLSSAPKLVIQPRPLYYTSVKTPAVIECAADTSSYVTILCNGR---VLNRKL-----------EIMSDHERPGRQRFSVPIEFADVQQWKAAGGDGEASGEEFYCNCEAWNHIPQLNNTLRKIVSRRALVRMAAFESDRFQFDPVPMNVSKSANSVILSCTPPKGTPKPQVKWLKDGQPLDMAALGDRVTIDHQKQLIIRPLELHDRGNYSCVAELPGLQLHSRPAELWIRVDGGWSDWTTMRSCHPSCDSGTECSSD-CFAKSSERRRQCTNPEPQFGGQPCQGRAVISEACDAKC-TVNGAWSPWSSWS-YCGEDCRSLRHRSCTNPAPRNGGRTCDTDSGAGAAADKEVRNCTDGQCKKEDPALLRYINGDGKTVSSDHAANLNNLAIYIGLFVAAAVVLTVVMVIVYLVRKKSVSGFASGRRRSLRQHQHHTNGNCSTVSSNDKDVKHTNELLLPPELSSSGTTIKNPNVIEMSQHHG-----HQQQQQVRMQTSESQLPVHLPMSSTYQSIAKHHPVFHYATCYASSPVD---------FSGRPSSALYELAAPGCQLQQQQQPLLPGSAKPEQLAWARLGPGGGRVCLAETGVSLTVPPACLT--ASSEIFLTVCPDPSDRPPVMSDRQTLLSPVVTCGAAAGSSRLARPVVLTLPHAACLRQGFWNVAVLCRSDLDTATPGVWKELLRVGSENQQSQQQQQQSSAFCQLDQNVCHLMLPRLGSFCLVG--QSLDGGCAVKQLRLAAFAAPLSLSASSDFSLRLHVLRDTPDALDQVVASERQAGARLIDAPRQLAFRDCGEKLCLSIEELSLGWR--SKCKHQEVPFGHVWSSHQAGGLHCGFSLEHVDPTRQSVSCKIVIYQSRYYNCRQVVHIVSSKNDLPCVNHEGSPACPTSAMLDPSRLGLHVDPTPTVFRLPPRLRRAACQLLDAPSPRGGGHDWLTLSRMMGIERCVNYFACQVSPTECLLDLWEARSREEDSLARLVESLKAINRQDVASLLEGDL 1037          
BLAST of Uncoordinated 5 vs. TrEMBL
Match: A0A267GQ61 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028400g2 PE=4 SV=1)

HSP 1 Score: 377.481 bits (968), Expect = 1.648e-109
Identity = 288/1014 (28.40%), Postives = 478/1014 (47.14%), Query Frame = 3
Query:  210 EKHYDGIPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFS----------EYKCYCEAWNRIVSINKD-KKVHSSAALIQESYFQNE-FKVSPTNTKLNEGEKLVLL-CTPPDSKPNSKVTWLKNKELITNSNYP-LVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRC--------------ESGKCFGPKQQIRNCSQAICQKPDPSLL--LESQSTT-------------MYXXXXXXXXXXXXXXXXXXXXXXQK---GYISLLPRRGMVFSNHNNGI---TKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHAN-IPVIDMMEMLLSPVILCGPP--HTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDAN------VYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLS--SEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKER---ALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDS--------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQEI 3038
            E      PK +++P+P YY +   PA I C A+  S+V I C  +    +N++L           E      +  R +FS  +E+ D+ +W +          E+ C CEAWN I  +N   +K+ S  AL++ + F+++ F+  P    +++    V+L CTPP   P  +V WLK+ + +  +     VTID  K+LII+ +   D GNY+CVA+  G+   S+ A + + +   WS WT + +C   C    +C  + C  ++  R R C     +     C+G    +E CD  C      W+ WS W+  C   C   R R C              +SG      +++RNC+   C+K DP+LL  +     T             +Y+ LF+  +++  ++++I+ L+ +K   G+ S   RR +    H+  +   T    +K  K++ +LLL  E  S+  TIKN N  ++          +       M +  ++  V   + S Y  I+K Q  +   T   ++P              + ++ LY+  + G          LP   + E +AW  +   GGR+CL ++G+SLT+P   +    S E+FL VC D ++  PV+   + LLSPV+ CG     +RL +P++LT+PH A ++   WN+ VL     ++  P +WKEL  V   N+           + QLD    HL++  L   C+ G    L       +LR+ AF+ PLS  +  D  +R+H++ DT +A++ V+ SE +   +L+D  ++L+F   G  +   +++LSLGWR  +  K Q   +  VW  + +        LEHVDPTR   SC I + Q      + V+ +V  +      N    P    +  +       ++DP  TVFRL    R+ +  LLD+         W TL+  M +   +NYF+ + SP++ LLDLWE+R REE ++A L+  L+ I R D A ++E ++
Sbjct:   62 EAMLSSAPKLVIQPRPLYYTSVKTPAVIECAADTSSYVTILCNGR---VLNRKL-----------EIMSDHERPGRQRFSVPIEFADVQQWKAAGGDGEASGEEFYCNCEAWNHIPQLNNTLRKIVSRRALVRMAAFESDRFQFDPVPMNVSKSANSVILSCTPPKGTPKPQVKWLKDGQPLDMAALGDRVTIDHQKQLIIRPLELHDRGNYSCVAELPGLQLHSRPAELWIRVDGGWSDWTTMRSCHPSCDSGTECSSD-CFAKSSERRRQCTNPEPQFGGQPCQGRAVISEACDAKC-TVNGAWSPWSSWS-YCGEDCRSLRHRSCTNPAPRNGGRTCDTDSGARAAADKEVRNCTDGQCKKEDPALLRYINGDGKTVSSDHAANLNNLAIYIGLFVAAAVVLTVVMVIVYLVRKKSVSGFASGR-RRSLRQHQHHTNVNCSTVSSNDKDVKHTNELLLPPELSSSGTTIKNPNVIEMSQHHG-----HQQQQQVRMQTGESQLPVHLPMSSTYQSIAKHQPVFHYATCYASSPVD---------FSGRPSSALYELAAPGCQLQQQQQPLLPGSAKPEQLAWARLGPGGGRVCLAETGVSLTVPPACLT--ASSEIFLTVCPDPSDRPPVMSDRQTLLSPVVTCGAAAGSSRLARPVVLTLPHAACLRQGFWNVTVLCRSDLDTATPGVWKELLRVGSENQQSQQQQQQSSAFCQLDQTVCHLMLPRLGSFCLVG--QSLDGGCAVKQLRLAAFAAPLSLSASSDFSLRLHVLRDTPDALDQVVASERQAGARLIDAPRQLAFRDCGEKLCLSIEELSLGWR--SKCKHQEVPFGHVWSSHQAGGLHCGFSLEHVDPTRQSVSCKIVIYQSRYYNCRQVVHIVSSKNDLPCVNHEGSPACPTSAMLDPSRLGLHVDPTPTVFRLPPRLRRAVCQLLDAPSPRGGGHDWLTLSRMMGIERCVNYFACQVSPTECLLDLWEARSREEDSLARLVESLKAINRQDVASLLEGDL 1037          
BLAST of Uncoordinated 5 vs. Ensembl Cavefish
Match: unc5c (unc-5 netrin receptor C [Source:ZFIN;Acc:ZDB-GENE-030131-9196])

HSP 1 Score: 280.026 bits (715), Expect = 6.379e-79
Identity = 248/964 (25.73%), Postives = 428/964 (44.40%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFC-----ADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFS--EYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELIT---NSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAICQKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVAT--SLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEY--PIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLG-WRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTV--------FRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRND 3011
            +P F++EP+  Y V K+ P  + C A P + +   C       K+ +   +    SGL V +                S  +  + + E F   ++ C C AW+      K +K H     ++ +Y +  F   P   +++  ++++L C PP+  P ++V WLKN+E+I    + N+  +TID    LII++   SD+ NYTCVA++    ++S  A + V +   WS WT+  AC              C    ++R R C           C+G   +   C+  C   +  W  WS W+T C   C+  R R C +      GK C G   Q +NC+  +C +  PS    +    +Y+ + I + +                 IS++    +   NH +  + I  + +        LN   +   V+IK     D++A    L +       PVY +H   ++   +P   S    P+ +     Y+S+   +  P      ++  L+ K   + L    ++GR +  L+ +  PS       A+G+  + GG L +P SG+SL +P GAI  G   EM++ V R     P +D  + +LSPV+ CGPP   L +P+I+T+ HCA     DW I++ S   Q       W+++  V   N +    Y Q+D  + H++ + L   C+ G        + + RL++  F     + +++ IRV+ + DT++A++ V+  E ++ G+LLD  K L+F  S  ++   L D+    W+    +K Q  S+  VW     +N      LE          C + V+Q++  + Q          LN      +S D+Q +      + LDP   +        FR+  + RQ+L   LD+       W+ LA+ + L+  LNYF+ K SP+  +LDLWE++   +G +  L  +L  +GR++
Sbjct:   57 LPHFLMEPEEAYIV-KNKPVNLYCKATPATQIYFKCNSEWVHQKEHTVEERVDETSGLVVREA---------------SIEITRQQVEELFGLEDFWCQCVAWSS-AGTTKSRKAH-----VRIAYLRKTFDQEPLGKEVSLEQEVLLQCRPPEGIPAAEVEWLKNEEVIDPAEDRNF-YITIDH--NLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSTWTEWSAC-----------NSRCGRGFQKRTRSCTNPAPLNGGAICEGQPIQKLACNPLC-PVDGLWTEWSKWST-CGTECTHWRRRECSAPAPKNGGKDCEGMVLQSKNCTDGLCMQTAPS----TDDVALYVGIVIAVIMCL--------------VISVIVALFVYRKNHRDFDSDIIDSSA--------LNGGFQP--VSIKTARTADLLAAPPDLTSAAAMYRGPVYALHDVADK---IPMTNSPLLDPLPNLKIKVYNSSG--LVTPQEDLSDFSSKLSPKLPHS-LIDSDTMGRRTQSLVRSRDPS-----CTAFGSFNSLGGHLIVPNSGVSLLVPAGAIPQGRVYEMYVTVHRKETMRPSVDDTQTVLSPVVSCGPPGALLTRPVIITMHHCAEADSEDWLIQLRSQSQQGQ-----WEDVVVVGEENFT-TPCYIQMDEEACHILTETLGTYCLVG---QSVSAATTKRLKLAVFGPVTCTALEYNIRVYCLDDTQDALKEVLQMEKQMGGKLLDEPKTLNFKDSTHNLRLSLHDVPHTLWKSKLLAKYQELSFQHVWS-GSQRNLHCTFTLERFSAGTLELGCKLCVRQVE-GEGQIF-------QLNTT----LSEDSQCI----DTSLLDPASNITTLVGPNAFRIPLSIRQKLCSSLDAPQTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGNLNRLAAVLEEMGRHE 917          
BLAST of Uncoordinated 5 vs. Ensembl Cavefish
Match: unc5db (unc-5 netrin receptor Db [Source:ZFIN;Acc:ZDB-GENE-060531-162])

HSP 1 Score: 254.218 bits (648), Expect = 2.497e-70
Identity = 226/952 (23.74%), Postives = 408/952 (42.86%), Query Frame = 3
Query:  237 FILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFS--EYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAICQKPD-------PSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNA----QDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDSS------WQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGR 3005
            F+ EP+  Y + KS+P  + C A P   +   C + ++ + N+  S+         E+   +   K  +    V  + + ++    +Y C C AW+ +   +K +K     A ++ +Y +  F+  P   ++     +VL C PP+  P ++V WLKN+EL+++ +   +       LII +   SDSGNYTC+A +    ++S  A + V +   WS WT+   C + C   G+ +        ++R R C           C+G   +   C+  C   +  W  WS WT +C   C + R R C +      G+ C G    + NC+  +C +         P  +  S    +Y  L   +  + ++I+ +      +    +     ++ S+   G  + +  K+ +    LLLN+  +  +   + ++     QD +   L + +P+                          ++ K Q ++  +  + +      ++  ET    Q   P             L +   P   +L +   G     GGRL +P +G+SL +  GAI    S EM++ + + HA  P  +  E+LL P +  GPP   L  P+ +TI HCA +   +WNI++      N      W+E+ +V   + S    Y  LDS S HL++D      + G   PL++     RL+V  F    +S +++ +RV+ + DT  A + V+ +E    G LL+  K L F  +   +   + DL    W     +  Q FS+  VW  N    Q +H    LE      +  SC I+V+Q+    ++ +++V    A   +  +P  + A       + A        F++  + RQ++    D++      WQ LA  + +  NL+YF++++SPS  +L LWE+R +  G +  L + L  I +
Sbjct:    2 FLQEPEDAYII-KSNPIRLRCRAAPALQIFFKC-NGEWVHQNQHTSQ---------EYMDQNTGLKVREVMINVSRQQVEDFHGPEDYWCLCVAWSHL-GTSKSRK-----ATVRIAYLRKNFEQDPQGKEVPIKGMIVLHCRPPEGVPAAEVEWLKNEELVSSLDDENIDTRADHNLIINEARLSDSGNYTCLASNIVAKRRSATATVVVFVNGGWSLWTEWSPCSVDC---GRGV--------QKRSRTCTNPAPLNGGAFCEGMSVQKSTCNALC-PVDGGWEEWSEWT-MCSAQCERQRWRECNAPAPRNRGRMCEGESHAMENCTGGVCTQNGKMLHDVKPQSMDGSNDVALYSGLAAGVIAVAVLIISVTLYRRSQSEYGV----DVIDSSALAGGFQSFNFKTARQGNPLLLNSSMQPELTAGQTYSGPICFQDSIDKELFDPLPD--------------------------MMVKVQSSFMVSLGVADRAEYHVKAQLETYGGTQGRKP------------NLAAPNGPCKAQLRSS--GVFGHLGGRLVMPNTGVSLLVSHGAIAEDTSWEMYMLINQGHA--PSEERCEILLGPEVTYGPPGLSLSSPVAMTIAHCAEVSAENWNIQLKRQTKDNK-----WEEVMSVEDESTS---CYCLLDSQSCHLLLDEPGSYVLVG--EPLNE-HAGKRLKVAVFGNVEASSLNYGLRVYCVDDTPHAFQGVVSAETSRGGLLLEEPKTLLFKGNTYSLQVSIQDLPQFLWSIKPFTTCQEFSFCQVWSSNQ---QPLHCAFSLERFTTATTQLSCKISVRQVK--GHEQILQVYTTVAEREKETLPFFMQADCTVTSQTGA------KAFKIPLSIRQRICATFDTANAKGKDWQLLAQKLHIQRNLSYFAKQRSPSGVILSLWEARHQASGDLDSLASALEEISK 855          
BLAST of Uncoordinated 5 vs. Ensembl Cavefish
Match: unc5b (unc-5 netrin receptor B [Source:NCBI gene;Acc:103042383])

HSP 1 Score: 246.514 bits (628), Expect = 1.526e-67
Identity = 233/954 (24.42%), Postives = 413/954 (43.29%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFSEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELIT---NSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAICQKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIY--TNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLG-WRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIV 3026
            +P+F  EP+  + V K+ P  + C A P + +   C + ++   N  ++   L  +      + D    R +   +   +D       Y C C AW+  VS  +                 + F+  P   ++   ++++L C PP+  P ++V WLKN++LI    +SN+ L+T+D    LII++   SD+ NYTCVA++    ++S  A + V +   WS+WT+   C              C    +RR R C           C+GP F+   C   C   +  W  W+ W+  C   C+  R R C++      G+ C G   + +NC++ +C + +   L       +Y  L   + +  I++L +  L  ++    L    G + ++ ++ +T  +   N  P   +   L +      +T      +  + +SL             + SH+        +    P +    Y  SST   +  P     S  E ++ K          ++G G+     + LP   E    A  T+   GGRL +P +G+SL +P G I  G   EM+L + +        +  + +LSPV+ CGP    L +P+ILT+PHCA ++  DW+   L+ + Q +Q    W+E+ TV   + S +  Y Q++  + H++++ L    + G   P       ++L + A   P  S +D+ +RV+ I DT  A++ V+  E  L G LL++ K L F  S  ++   + D+    WR    +K Q   +  +W       + +H    LE      S  SC I V+Q++       +    +  L   S +P        S+    A        FRL ++ RQ++   LD+       W+ LA+ +  +  LNYF+ K SP+  LLDLWE+  + +  +  L   L  +G+++  +++
Sbjct:   50 LPEFQSEPEDAFIV-KNRPVKLSCKAAPATQIYFKC-NGEWVNQNDHVTRESLDQITGLVVREVDISVSRTQVEELFGLED-------YWCQCVAWSSAVSTYEKL---------------SNFEQEPLGREVRLEQEVLLQCRPPEGIPPAEVEWLKNEDLIDPTQDSNF-LMTVDH--DLIIKQARLSDTANYTCVARNVVAKRRSSTATLIVYVSGGWSSWTEWSEC-----------NARCGRGWQRRTRSCTNPAPLNGGAFCEGPPFQRVTCTTLC-PVDGGWTEWAKWSA-CGTECTHWRSRECQAPPPRNGGRHCIGSIMESKNCTEGLCARSESHALDSGAGVAVYAGLVGALLLCVILVLCVGILAYRRSCSHL---HGDI-TDSSSALTAAFHPGNYKPPRQDNPHLLHPSAPPDLTASAGTFRGPLFSSLQQST---------LDSHHKIPMTNSPLLDPLPGLKIKVYD-SSTMSSVELPAGPGSSDGEIMSLK----------TVGSGTRDHYGHTLPG--EPGHSASATLGCLGGRLAIPNTGVSLLVPPGTIPQGKFYEMYLIINKWEKTTLPSEGGQTVLSPVVSCGPSGMLLSRPVILTLPHCAQLEPPDWS---LTLKTQTNQA---WEEVLTVGEESLS-SPCYLQVEEQNCHVLMEQLGTYGLVGQSVPPQPACKRLQLALFAPRAPCLS-LDYSLRVYCIHDTPHALKEVLELERSLGGVLLEDPKPLLFKDSYHNLRLSIHDIPHSHWRSKLLAKYQEIPFYHIWS---GSQRPLHCTFSLERGSLAVSQLSCKICVRQVEGEGQIFQLHTDIQETLPPHSPLPAGGTCLPSSQVGPYA--------FRLPASIRQKICASLDAPSARGCDWRLLAHSLGFDRYLNYFATKPSPTGVLLDLWEACHQGDADLVSLATALEEMGKSEVLVVM 918          
BLAST of Uncoordinated 5 vs. Ensembl Cavefish
Match: unc5da (unc-5 netrin receptor Da [Source:ZFIN;Acc:ZDB-GENE-080908-2])

HSP 1 Score: 160.614 bits (405), Expect = 8.579e-40
Identity = 118/419 (28.16%), Postives = 200/419 (47.73%), Query Frame = 3
Query: 1818 GTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDSS------WQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGR---------NDCAMIV 3026
            G     GGRL LP +G+SL +P GAI    S E+ +++ ++   +   D  E+LL P +  GPP   L  P+ +TI HCA++   DW++++     ++S     W++   V  V    A+ Y  L+    HL+VD      + G   PLS+ +   RLR+  F    +  + + +RV+ + DT  A + V+  E    G+LL+  K L F ++   +   + D+    W     +  Q F +S VW  N S  Q     LE      +  SC I+++Q+     + +++V      + + +VP    AQS     SQ         F++  + RQ++    D++      WQ LA  + ++ NL YF+ +KSPS  +L LWE++ ++ G +  L + L  IGR         +DC ++V
Sbjct:  443 GLFGHGGGRLVLPNTGVSLLVPHGAIAEDTSCELHMSINQEDTCVLSEDSQEVLLGPEVSYGPPGLDLSCPVAMTIAHCADMSSDDWSMKLRRQTQEDS-----WED---VMSVEGESASCYCLLEPQCCHLLVDRPGHYTLVG--EPLSE-AAGKRLRLAVFGNLEADALTYSLRVYCVDDTPYAFQEVVWLERGQGGRLLEEPKTLLFKANCFSLQISIQDVPQFLWSIKPFTTCQEFGFSQVWGSNQSPLQ-CAFTLERFSQATNQLSCKISIRQVK--GQEQILQVYTTVGESQKEVVPFF--AQSDCTITSQTG----ARAFKIPLSIRQRICATFDTANAKGKDWQLLAQKLQIDRNLGYFARQKSPSAVILCLWEAQHQDRGDLDSLASALEEIGRVHSKHPCLMSDCQVLV 841          

HSP 2 Score: 92.4337 bits (228), Expect = 1.705e-18
Identity = 78/300 (26.00%), Postives = 130/300 (43.33%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWF---SEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPC--DIGCEKYESKWNSWSLWTTI 1112
            +P F+ EP   Y V KS+P  + C A P   +   C + ++ + N+  S      V+  +       G + +   +   +  +E F    +Y C C AW+ +   +K +K     A ++ +Y +  F+  P   ++     +VL C PP+  P ++V WLKN E I+  +   +       LII +    DSGNYTC+A +    ++S  A + V +   WS WT+   C   C               R+R R C     K     C G   + E C  D+ C + ES  N  +L++ +
Sbjct:    8 LPHFLQEPDDAYIV-KSNPIKLRCRARPALQIFFKC-NGEWVHQNQHTS------VEHTDLG----TGLKIREVMINVSRQQVEDFHGPEDYWCLCVAWSHL-GTSKSRK-----ATVRIAYLRKNFEQEPQGKEVPIKGMIVLHCRPPEGVPPAEVEWLKNDEPISTVDDGNIDTRADHNLIISEARLLDSGNYTCLASNIVARRRSASATVIVYVDGGWSGWTEWSVCSSECE--------------RQRGRECTDPEPKHGGRLCDGAALDTENCTGDL-CTQGESNNNDVALYSGL 274          
BLAST of Uncoordinated 5 vs. Ensembl Cavefish
Match: unc5da (unc-5 netrin receptor Da [Source:ZFIN;Acc:ZDB-GENE-080908-2])

HSP 1 Score: 158.688 bits (400), Expect = 7.152e-39
Identity = 115/403 (28.54%), Postives = 194/403 (48.14%), Query Frame = 3
Query: 1818 GTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDSS------WQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGR 3005
            G     GGRL LP +G+SL +P GAI    S E+ +++ ++   +   D  E+LL P +  GPP   L  P+ +TI HCA++   DW++++     ++S     W++   V  V    A+ Y  L+    HL+VD      + G   PLS+ +   RLR+  F    +  + + +RV+ + DT  A + V+  E    G+LL+  K L F ++   +   + D+    W     +  Q F +S VW  N S  Q     LE      +  SC I+++Q+     + +++V      + + +VP    AQS     SQ         F++  + RQ++    D++      WQ LA  + ++ NL YF+ +KSPS  +L LWE++ ++ G +  L + L  IGR
Sbjct:  531 GLFGHGGGRLVLPNTGVSLLVPHGAIAEDTSCELHMSINQEDTCVLSEDSQEVLLGPEVSYGPPGLDLSCPVAMTIAHCADMSSDDWSMKLRRQTQEDS-----WED---VMSVEGESASCYCLLEPQCCHLLVDRPGHYTLVG--EPLSE-AAGKRLRLAVFGNLEADALTYSLRVYCVDDTPYAFQEVVWLERGQGGRLLEEPKTLLFKANCFSLQISIQDVPQFLWSIKPFTTCQEFGFSQVWGSNQSPLQ-CAFTLERFSQATNQLSCKISIRQVK--GQEQILQVYTTVGESQKEVVPFF--AQSDCTITSQTG----ARAFKIPLSIRQRICATFDTANAKGKDWQLLAQKLQIDRNLGYFARQKSPSAVILCLWEAQHQDRGDLDSLASALEEIGR 913          

HSP 2 Score: 113.62 bits (283), Expect = 5.202e-25
Identity = 88/340 (25.88%), Postives = 147/340 (43.24%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWF---SEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRC------ESGK-CFGPKQQIRNCSQAICQK 1217
            +P F+ EP   Y V KS+P  + C A P   +  F  + ++ + N+  S      V+  +       G + +   +   +  +E F    +Y C C AW+ +   +K +K     A ++ +Y +  F+  P   ++     +VL C PP+  P ++V WLKN E I+  +   +       LII +    DSGNYTC+A +    ++S  A + V +   WS+WTD   C + C   G+ I        +RR R C           C+G   +   C   C   +  W+ W+ W ++C   C + R R C        G+ C G      NC+  +C +
Sbjct:   26 LPHFLQEPDDAYIV-KSNPIKLRCRARPALQI-FFKCNGEWVHQNQHTS------VEHTDLG----TGLKIREVMINVSRQQVEDFHGPEDYWCLCVAWSHL-GTSKSRK-----ATVRIAYLRKNFEQEPQGKEVPIKGMIVLHCRPPEGVPPAEVEWLKNDEPISTVDDGNIDTRADHNLIISEARLLDSGNYTCLASNIVARRRSASATVIVYVNGGWSSWTDWSDCSVRC---GRGI--------QRRSRTCTNPAPLNGGAFCEGMSVQKSTCTSPC-PVDGGWSGWTEW-SVCSSECERQRGRECTDPEPKHGGRLCDGAALDTENCTGDLCTQ 334          
BLAST of Uncoordinated 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010609.1 (pep scaffold:Pmarinus_7.0:GL476332:154004:216612:1 gene:ENSPMAG00000009605.1 transcript:ENSPMAT00000010609.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 171.014 bits (432), Expect = 1.365e-43
Identity = 116/410 (28.29%), Postives = 206/410 (50.24%), Query Frame = 3
Query: 1815 WGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITG-CLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDS------SWQTLANHMLLN-GNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRND 3011
            +GT    GGRL +P SG+SL +P GAI  G   +M+L V RD    PV++  + LLSPV+ CGPP   LL P+IL++ HCA +   DW +  L  +  +      W+E+  +        + + QL+  + H++ +      + G  L P    +   RLR+ AF+  +   +++ +R++ + D  E++  V+  E +L G+LL+    LSF ++ G++   +  +  + W    N  + TF     W +     + +H    LE    + + FSC + VQQ+   + +  +  ++   LN  S    + D+ + +     A + P    F+L  + RQ+L   LDS       W+ LA+ + +N  ++ YF  + SP+  +LDLWE++  E+G +  L ++L  +GR +
Sbjct:  578 YGTFGCMGGRLVIPNSGLSLLVPPGAIPSGQFYQMYLTVHRDEDKRPVLEGSQTLLSPVVSCGPPSVPLLSPVILSLRHCAELNSEDWALG-LKRQLDSGH----WEEVLRLGEEPARPPSCHWQLEERACHVLTETPGTYAVLGEALGP----AAVKRLRLAAFAPSVCPSLEYSLRLYCLNDDAESLAEVVELEKQLGGRLLEEPTTLSFKANSGNLRLSIHAIPDVLW---TNKLLNTFQEIPFWHVWPGCQRLLHCTFALERAGLSSTEFSCKLCVQQL---EGEGQVLQLRTTLLNAPS---ATDDSPTEAASAGSALVGP--QAFKLPYSIRQKLCSSLDSPNPRGNDWRLLAHRLGINSASMEYFETRGSPTGVVLDLWEAQHEEDGDLDSLASVLEEMGRKE 967          

HSP 2 Score: 131.339 bits (329), Expect = 3.464e-31
Identity = 96/340 (28.24%), Postives = 151/340 (44.41%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFS--EYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELI---TNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCE------SGK-CFGPKQQIRNCSQAIC 1211
            +P F+ EP+  Y V ++ P T+ C A P + +   C  +        + E      +++E      +    +    V  + + E F   +Y C C AW+     +K +K     A ++ +Y +  F+  P    +    +++L C PPD+ P ++V WLKN+E+I    + N+  +T+D    LII++   +DS NYTCVA++    ++S  A ITV +   WS WT+   C              C    ++R R C           C G   E  PC   C   +  W  WS W+T C P C+  R R C        GK C G   Q +NCS A+C
Sbjct:   57 LPHFLQEPEDAYIV-RNKPVTMSCAASPATQIYFKCNGEWLHQKAHHIEE------RVDETTGRSVR----EVQTDVSRQQVEELFGLEDYWCQCVAWS-AAGTSKSRK-----AYVRIAYLRKNFEQEPLGKDVLLDHEVLLHCRPPDAIPQAEVEWLKNEEIIDPVIDQNF-YITVDH--NLIIKQTRLADSANYTCVAKNLVAKRRSSTATITVYVNGGWSQWTEWSPC-----------NSKCGRGTQKRTRSCSNPTPLNGGAVCDGQGVEKMPCSSLC-PVDGGWVEWSKWST-CGPDCTHWRSRECSNPAPVNGGKDCHGSPLQSQNCSDALC 363          
BLAST of Uncoordinated 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008404.1 (pep scaffold:Pmarinus_7.0:GL476608:255441:311832:-1 gene:ENSPMAG00000007555.1 transcript:ENSPMAT00000008404.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.132 bits (370), Expect = 3.212e-36
Identity = 117/420 (27.86%), Postives = 199/420 (47.38%), Query Frame = 3
Query: 1803 ETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKEL-----STVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRL---RVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRND 3011
            +T  +GT    GGRL +  SG+SL +P GAI  G   +M++ + R+    P ++  + LLSPV+ CG P   LL P+IL++ HCA +   DW    LS + Q S  P  W+E+        RP +     V   + S +AHL         ++ C    S +SV  R+      +  L +   V H  + +    T +  + V+  E +L G+LL+    L+F ++ G++   +  +  + W    N  + TF     W +     + +H    LE    + + FSC + VQQ++    +  +  ++   LN  S    + D+ + +     A + P    F+L  + RQ+L   LDS       W+ LA+ + +N   NYF  + SP+  +LDLWE++  E+G +  L ++L  +GR +
Sbjct:  509 DTTVFGTFCCLGGRLTIAHSGVSLLVPPGAIPPGQFYQMYITIHREKEKRPALENSQTLLSPVVSCGAPSVPLLSPVILSLRHCAELSPEDW---ALSLKRQLSSGP--WEEVLRQGEEPARPPSCHWQRVSVSVTSTTAHL---------VSFCYYCSSFMSVCGRVCHQDYFSPCLCVCGRVCH--QYYCSSSTHDQFKEVVELEKQLGGRLLEEPTTLNFKANSGNLRLSIHAIPDVLW---TNKLLNTFQEIPFWHVWPGCQRLLHCTFALERASLSSTEFSCKLCVQQLE---GEGQVLQLRTTLLNAPS---ATDDSPTEAASAGSALVGP--QAFKLPYSIRQKLCSSLDSPNPRGNDWRLLAHRLGINRYGNYFEMRGSPTGVVLDLWEAQHEEDGDLDSLASVLEEMGRRE 901          

HSP 2 Score: 124.79 bits (312), Expect = 3.420e-29
Identity = 97/358 (27.09%), Postives = 158/358 (44.13%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFS----YMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFSEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELIT---NSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCE------SGK-CFGPKQQIRNCSQAICQKPDPSLLLESQSTTM 1259
            +P F+ EP   + V ++ P T+ C A P + +   C  +       Y  + LSE    VV+    N      ++ +  Y +E         ++ C C AW+            S  A ++ ++ +  F+  P    +    +++L C PP++ P ++V W+K+KELI    +SN+  +T+D    LII++   SDS NYTCVA++    ++S  A +TV +   WS WT+   C              C    ++R R C           C G   +  PC   C   +  W  WS W+T C P C+  R R C        GK C G   Q +NCS A+C + +  ++ +S S  +
Sbjct:   10 LPIFLTEPNDGFIV-QNKPVTLDCSASPATQIYFKCNGEWLHQKALYTQEHLSEITGKVVREVHTNV---SRQQVEDPYRLE---------DFWCQCVAWS------ASGTTKSRKAFVKVAHLRKNFEQEPLGKDVPLNHEVLLHCRPPEAIPPAEVEWMKDKELIDPEEDSNF-YITVDH--NLIIKQARLSDSANYTCVAKNLVAKRRSSTATVTVYVNGGWSLWTEWSPC-----------NSKCGRGTQKRTRSCTNPAPLNGGAVCNGQGTQKIPCSTIC-PVDGGWVEWSKWST-CGPDCTHWRSRECSNPAPVNGGKDCHGSPLQSQNCSDALCIQSEKIIIGQSTSCVL 332          
BLAST of Uncoordinated 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003861.1 (pep scaffold:Pmarinus_7.0:GL476449:2630:55902:-1 gene:ENSPMAG00000003466.1 transcript:ENSPMAT00000003861.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 132.88 bits (333), Expect = 7.258e-32
Identity = 97/346 (28.03%), Postives = 149/346 (43.06%), Query Frame = 3
Query:  231 PKFILEPQPFY-------YVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSE-----SGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFSEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCE------SGK-CFGPKQQIRNCSQAIC 1211
            P  + EP P +       Y+ ++ P T+ C A P + +   C  +  S     + +     +G +V ++    Q D   ++ +  Y  E          Y C C AW+     +K +K     A ++ +Y    F++ P   +  +G+K+ L C PPD+ P ++V WLKN+ LI         I     LII++   SDS NYTCVA++    ++S  A +TV ++  WS W +   C              C    ++R+R C           C G   EN PC   C   +  W  WS W+T C P C+  R R C        GK C G   Q +NCS A+C
Sbjct:   29 PSALAEPLPHFLQELEDAYIVRNKPVTMSCAASPATQIYFKCNAEWVSQQAHHVQQRTDQGTGRSVREV----QTDVSRQQVEVYYGPE---------PYWCQCVAWS-AAGTSKSRK-----AYVRIAYLHKNFEMEPQGKEEPQGQKIQLHCRPPDAVPPAEVEWLKNEMLIDPEEDSNFHITADHNLIIKQARLSDSANYTCVAKNLVAKRRSSTATVTVYVEGGWSLWNEWAPC-----------NSKCGRGTQKRIRTCTNPAPLNGGPFCDGQASENTPCTSAC-PVDGGWVEWSKWST-CGPDCTHWRSRECSNPAPVNGGKDCHGSPLQSQNCSDALC 342          

HSP 2 Score: 132.109 bits (331), Expect = 1.404e-31
Identity = 88/299 (29.43%), Postives = 147/299 (49.16%), Query Frame = 3
Query: 1776 NYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITG-CLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVW----RLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQID 2654
            N  P   +  T  + T    GGRL +P SG+ L +P GAI HG+  +M+L V R   + PV+D  + LLSPV+ CGPP   LL P+IL++ HCA +   DW    LS + Q S     W+E+  +        + + QL+  + H++ +      + G  L P    +   RLR+ AF+  +   +++ +R++ + D  E++  V+  E +L G ++     L F ++ G +   +  +    W  + +SK+Q   +  VW    RL H         LE    + + FSC + VQQ++
Sbjct:  515 NCAPLHQDKGTSVYATFGCLGGRLLIPSSGVGLLVPPGAIPHGHFYQMYLTVHRGEDSGPVLDGSQTLLSPVVSCGPPSIPLLSPVILSLRHCAELSPEDW---ALSLKRQLSS--GHWEEVLRLGEEPARPPSCHWQLEERACHVLTETPGTYAVLGEALGP----AAVKRLRLAAFAPSVCPSLEYSLRLYCLNDDTESLAEVVELEKRLGGHMVGEPSTLHFKANSGHLQLSMHAVPDTLWTNNVHSKLQEIPFWHVWPGCQRLLHCT-----FALERAGLSSTEFSCKLCVQQLE 799          
BLAST of Uncoordinated 5 vs. Ensembl Sea Lamprey
Match: tjp1a (tight junction protein 1a [Source:ZFIN;Acc:ZDB-GENE-031001-2])

HSP 1 Score: 87.8113 bits (216), Expect = 1.090e-17
Identity = 47/143 (32.87%), Postives = 76/143 (53.15%), Query Frame = 3
Query: 1806 TVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMM--EMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHL 2228
              A G   + GG L   ++G+S+ +PRGAI  G  +E++  VC+D++ IP +D    E LLSP+++CGP   R LKP+ L +PHCA +    W+  + S+       P  W  ++        D N     +S+S  +++DH 
Sbjct: 1636 ATARGVFDSNGGVLSSVETGVSVVVPRGAIPEGLEQEIYFKVCQDNSIIPALDKEKGETLLSPLVMCGPHGLRFLKPVELRLPHCAAMNPDGWSFALKSSESITGD-PRRWHNMALP-----GDPNYNIGANSVS--VLIDHF 1770          
BLAST of Uncoordinated 5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002817.1 (pep scaffold:Pmarinus_7.0:GL476732:495093:569098:-1 gene:ENSPMAG00000002526.1 transcript:ENSPMAT00000002817.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.8626 bits (172), Expect = 1.541e-12
Identity = 43/138 (31.16%), Postives = 73/138 (52.90%), Query Frame = 3
Query: 1686 SYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELET-----VAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMM--EMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDW 2078
            S N T   ++   P +Q  ++      +  +   S +E E+      A G     GG L   ++G+S+ IP+GAI     +E++  VC+D++ +P +D    E LLSP+++CGP   + LKP+ L +PHC   + S+W
Sbjct: 1545 SINITTKPQEPPKPQFQSETMTVAPKAIPVSSSSSALEDESHTVLATARGVFDTHGGVLSSVETGVSIIIPKGAIPPAVEQEIYFKVCKDNSILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHC---EPSNW 1679          
BLAST of Uncoordinated 5 vs. Ensembl Nematostella
Match: EDO46601 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPN0])

HSP 1 Score: 115.161 bits (287), Expect = 6.497e-26
Identity = 117/482 (24.27%), Postives = 202/482 (41.91%), Query Frame = 3
Query: 1704 TEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAH---LIVDHLQMVCITGCLSPLSDLSVS-----IRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAF--CLDDLSLGWRCHANSKMQTFSYSSVW-RLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVV-------KERALNNRSLVPISLDAQSVSREYSQAYLD-----------------PLQTVFRLSSATRQQLWPLLDSSWQTLANHM--LLNGNLNYFSEKK---SPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVE 3029
            + K  A+ L    S+ +  C   S  LP   +    AWG I   GG+L +P +GISL +P  A+  G  E +++A+ +  A  P +   + LLSP ++CGP   +  +P+ L +PH              +A  +N +IP L  +    R    +DA  +  L+S+        + +L    +   L+  SD +V      ++++V+ F     ++ D  ++V+LIP TK A+E  I+   ++     D  K  S  ++  D+    CL ++   W+       Q   +S VW  +    N           P  + F CN  +QQ     + A I V        +E A+ + +  P S   + + R  S + L                   ++   +L  A       L+  SW+ LA  +  +   ++ Y   +K    P  AL+D WE+   E+  +  L  ++  IGR D A +VE
Sbjct:  565 SSKSNASTLSALSSVSKQQCPRPS--LPERADERLCAWGRIDHNGGQLVIPNTGISLYVPPSALPQGQEEVIYIAMMKRSAKYPQLRPGQALLSPAVVCGPEGLQFNEPVFLKLPH--------------NAALKNGEIPHLEGK---TRSGESTDATTWRTLESLDGDPESRPISYLDENSVEMMLTHFSDQTVVGEPEYLKIKVVPFLQCDGAQFDCRVQVYLIPRTKAALEEAILDASRVGLIQADTGKLFSLMNTSRDVRVKACLHEVDTKWK-PVTPVQQALPFSQVWSSVEDMPNVTFGFAPIPDQPNLTTFRCNFEIQQYG-ETDLARIFVTYCIKDHEEEGAVGSSASTPTSSPQRKLERWDSSSTLGIGSEMQGPNENKIPRDIRIKLCIKLEPADN-----LMIGSWKDLAGKIPGITTDHIRYLEGRKVGDGPVGALIDYWETSLSEKIPLHQLAQLMEDIGRRDAAELVE 1020          
BLAST of Uncoordinated 5 vs. Ensembl Nematostella
Match: EDO41849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S398])

HSP 1 Score: 95.5153 bits (236), Expect = 6.580e-20
Identity = 66/259 (25.48%), Postives = 114/259 (44.02%), Query Frame = 3
Query: 1782 LPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMM--EMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLGWRCHANSKMQTFSYSSVW 2552
            L  D ++   A G  T  GG L   +SG+S+ IP GAI  G  +E++  VC+++  +P +D    E LLSP+++CGP  T+ LK + L +PHCA +    W+   L +    + +P  W+ +S    +   +     Q+D  S  ++VDH     + G     +  + + R+    F+ P  +  + L  V L  +   A   V  +E             +       D+   L D++ GW   +  K +   +   W
Sbjct:  803 LEDDTQVVATARGIFTHEGGVLSSEESGVSIFIPEGAIPKGVEQEIYFKVCKENNIMPPLDTEKGETLLSPLVMCGPHGTKFLKSVELRLPHCAAMTPDGWSF-ALKSSDTPTGMPTQWRNVS----LPGQEHKDKCQVDPNSVSVLVDHFSSFSLAG----EARSNATKRMVASVFAQPPMTNSEWLFHVVLADNMDSARREVQQAETACGRLQFSPFVPIDVHGDAKDVRVQLRDIADGWISRSACK-KYIEFQDTW 1051          
BLAST of Uncoordinated 5 vs. Ensembl Nematostella
Match: EDO41850 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S399])

HSP 1 Score: 57.3806 bits (137), Expect = 2.187e-10
Identity = 28/73 (38.36%), Postives = 44/73 (60.27%), Query Frame = 3
Query: 1791 DIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMM--EMLLSPVILCG 2003
            D ++   A G  T  GG L   +SG+S+ IP GAI  G  +E++  VC+++  +P +D    E LLSP+++CG
Sbjct:    3 DTQVVATARGIFTHEGGVLSSEESGVSIFIPEGAIPKGVEQEIYFKVCKENNIMPPLDTEKGETLLSPLVMCG 75          
BLAST of Uncoordinated 5 vs. Ensembl Nematostella
Match: EDO35240 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM31])

HSP 1 Score: 58.5362 bits (140), Expect = 1.207e-9
Identity = 29/98 (29.59%), Postives = 49/98 (50.00%), Query Frame = 3
Query:  585 FQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYE 878
             +++F+  P +  +  G + +L C PP  +P   VTWLKN +        +  +     L+I    K+D G Y CVA +    +KS++A +T+  K E
Sbjct:    1 LRSKFRAEPKDLSITIGNRAILKCNPPKGRPAPTVTWLKNTKAYVPDGVRIQKVSP-GNLVISIAQKADMGTYQCVAANAVGRRKSRVATVTIKAKPE 97          
BLAST of Uncoordinated 5 vs. Ensembl Nematostella
Match: EDO31173 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYQ3])

HSP 1 Score: 51.9878 bits (123), Expect = 6.802e-8
Identity = 36/134 (26.87%), Postives = 48/134 (35.82%), Query Frame = 3
Query:  867 MKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTC---SQTRVRRCES-------GKCFGPKQQIRNCSQAICQKPDPSLLL 1238
            M   W  WT   AC            + C +  + R R C     K     C G   + + C I     +  W SW+ W+  C  TC   +QTR R C+          C G   Q + C  A C   + SL L
Sbjct:    1 MDGHWGRWTAWSAC-----------SKTCGDGTQTRTRVCDDPAPKNGGSACVGDSSQTQACKIATSPVDGHWGSWTAWSA-CSKTCGDGTQTRTRMCDDPAPKNGGSACVGDSSQTQACKIATCWIGEQSLKL 122          
BLAST of Uncoordinated 5 vs. Ensembl Medaka
Match: si:ch73-72b7.1 (netrin receptor UNC5C [Source:NCBI gene;Acc:101174433])

HSP 1 Score: 270.011 bits (689), Expect = 1.685e-75
Identity = 244/963 (25.34%), Postives = 423/963 (43.93%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSE-----SGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFS--EYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELIT---NSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCE------SGK-CFGPKQQIRNCSQAICQKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVAT--SLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEY--PIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALN--NRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAM 3020
            +P F+ EP+  Y V K+ P  + C A P + +   C  +     +  + E     SGL V +                S  +  + + E F   +Y C C AW+      K +K H     ++ +Y +  F+  P   +++  ++++L C PP+  P ++V WLKN+E+I    + N+  +TID    LII++   SD+ NYTCVA++    ++S  A + V +   WS WT+   C              C    ++R R C           C G   +  PC   C   +  W  WS W+  C   C+Q R R C        GK C G   Q +NC+  +C +  PS    +    +Y+ + I + +                 IS++    +    H +  + I    +        LN   +S  V IK   + D++     L N       PVY +H  +++   +P   S    P+ +     Y+S+  L+         +   L+ K     + Q       +  L +  L    +    A G+  + GG L +P SG+SL +P GAI  G   EM + V R  +  P ++ ++ +LSPV+ CGP    L +P+ILTI HCA+    DW I+ L  R    +    W+++  V   N +    Y Q+DS + H++ + L   C+ G        + + RL++  F     + +D+ IRV+ + DT++A++ V+  E ++ G+LLD  K L+F  S  ++   + D+  + W+    +K Q   +  VW       + +H    LE + P     SC + V+Q++       +    E  L   + SL+  + +  +++              FR+  + RQ+L   LD+       W+ LA+ + L+  LNYF+ K SP+  +LDLWE++   +G + +L  +L  +GR+D ++
Sbjct:   49 LPHFLFEPEEGYIV-KNKPVNLYCKATPATQIYFKCNSEWVHQKDHTVEERVDENSGLVVREA---------------SIEITRQQVEELFGPEDYWCQCVAWSS-AGTTKSRKAH-----VRIAYLKKSFEQEPLGKEVSLEQEVLLQCRPPEGIPAAEVEWLKNEEVIDPAEDRNF-YITIDH--NLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSTWTEWSPC-----------NSRCGRGFQKRTRSCTNPTPLNGGLPCDGQAIQKLPCTTLC-TVDGVWTEWSKWSA-CGTECTQWRRRECNNPAPKNGGKDCEGLVLQSQNCTDGLCMQTAPS----TDDVALYVGIVIAVIMCL--------------VISVIVALFVYRKTHRDFDSDIIDTSA--------LNGGFQS--VNIKTARSADLLTAPPDLTNAAAMYRGPVYALHDVSDK---IPMTNSPLLDPLPNLKIKVYNSSG-LVTPQDDLGGDFTSKLSPK-----ITQSLLENSDTMNLRNQSLARSRDPSCTAHGSFNSQGGHLIVPNSGVSLLVPAGAIPQGRVYEMCVTVHRKDSLRPPVEDIQTVLSPVVSCGPAGALLTRPVILTIHHCADNVQEDWLIQ-LKNRLSMGE----WEDVVVVGEENFT-TPCYVQMDSEACHILTETLGTYCLVG---QSIGKAAAKRLKLAVFGPVSCTTLDYHIRVYCLDDTQDALKEVLQMETQMGGKLLDEPKTLNFKDSTHNLRLSIHDVPHMQWKSKLIAKYQEIPFHQVWS---GSQRSLHCTFTLERLTPATMELSCKLCVRQVEGEGQIFQLSNTLEEELQCIDTSLMDPASNITTLTGP----------NAFRIPLSIRQKLCGSLDAPQTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGDLNELAAVLEEMGRHDSSL 914          
BLAST of Uncoordinated 5 vs. Ensembl Medaka
Match: si:ch73-72b7.1 (netrin receptor UNC5C [Source:NCBI gene;Acc:101174433])

HSP 1 Score: 270.011 bits (689), Expect = 2.033e-75
Identity = 244/963 (25.34%), Postives = 423/963 (43.93%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSE-----SGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFS--EYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELIT---NSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCE------SGK-CFGPKQQIRNCSQAICQKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVAT--SLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEY--PIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLS-LGWRCHANSKMQTFSYSSVWRLNHSQNQEIH--IQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALN--NRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAM 3020
            +P F+ EP+  Y V K+ P  + C A P + +   C  +     +  + E     SGL V +                S  +  + + E F   +Y C C AW+      K +K H     ++ +Y +  F+  P   +++  ++++L C PP+  P ++V WLKN+E+I    + N+  +TID    LII++   SD+ NYTCVA++    ++S  A + V +   WS WT+   C              C    ++R R C           C G   +  PC   C   +  W  WS W+  C   C+Q R R C        GK C G   Q +NC+  +C +  PS    +    +Y+ + I + +                 IS++    +    H +  + I    +        LN   +S  V IK   + D++     L N       PVY +H  +++   +P   S    P+ +     Y+S+  L+         +   L+ K     + Q       +  L +  L    +    A G+  + GG L +P SG+SL +P GAI  G   EM + V R  +  P ++ ++ +LSPV+ CGP    L +P+ILTI HCA+    DW I+ L  R    +    W+++  V   N +    Y Q+DS + H++ + L   C+ G        + + RL++  F     + +D+ IRV+ + DT++A++ V+  E ++ G+LLD  K L+F  S  ++   + D+  + W+    +K Q   +  VW       + +H    LE + P     SC + V+Q++       +    E  L   + SL+  + +  +++              FR+  + RQ+L   LD+       W+ LA+ + L+  LNYF+ K SP+  +LDLWE++   +G + +L  +L  +GR+D ++
Sbjct:   64 LPHFLFEPEEGYIV-KNKPVNLYCKATPATQIYFKCNSEWVHQKDHTVEERVDENSGLVVREA---------------SIEITRQQVEELFGPEDYWCQCVAWSS-AGTTKSRKAH-----VRIAYLKKSFEQEPLGKEVSLEQEVLLQCRPPEGIPAAEVEWLKNEEVIDPAEDRNF-YITIDH--NLIIKQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSTWTEWSPC-----------NSRCGRGFQKRTRSCTNPTPLNGGLPCDGQAIQKLPCTTLC-TVDGVWTEWSKWSA-CGTECTQWRRRECNNPAPKNGGKDCEGLVLQSQNCTDGLCMQTAPS----TDDVALYVGIVIAVIMCL--------------VISVIVALFVYRKTHRDFDSDIIDTSA--------LNGGFQS--VNIKTARSADLLTAPPDLTNAAAMYRGPVYALHDVSDK---IPMTNSPLLDPLPNLKIKVYNSSG-LVTPQDDLGGDFTSKLSPK-----ITQSLLENSDTMNLRNQSLARSRDPSCTAHGSFNSQGGHLIVPNSGVSLLVPAGAIPQGRVYEMCVTVHRKDSLRPPVEDIQTVLSPVVSCGPAGALLTRPVILTIHHCADNVQEDWLIQ-LKNRLSMGE----WEDVVVVGEENFT-TPCYVQMDSEACHILTETLGTYCLVG---QSIGKAAAKRLKLAVFGPVSCTTLDYHIRVYCLDDTQDALKEVLQMETQMGGKLLDEPKTLNFKDSTHNLRLSIHDVPHMQWKSKLIAKYQEIPFHQVWS---GSQRSLHCTFTLERLTPATMELSCKLCVRQVEGEGQIFQLSNTLEEELQCIDTSLMDPASNITTLTGP----------NAFRIPLSIRQKLCGSLDAPQTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGDLNELAAVLEEMGRHDSSL 929          
BLAST of Uncoordinated 5 vs. Ensembl Medaka
Match: unc5da (netrin receptor UNC5D [Source:NCBI gene;Acc:101173079])

HSP 1 Score: 246.514 bits (628), Expect = 2.081e-67
Identity = 226/965 (23.42%), Postives = 413/965 (42.80%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADK---QFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWF---SEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCESGK-------CFGPKQQIRNCSQAICQKPDPSLLLE--------SQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVATSLLNEMPNNYS---PVYEMHSHNNRDQVLPAIYSEYPIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETV-----AWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLP-LSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDL-SLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPI--SLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDSS------WQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGR 3005
            +P+F+ EP   Y + KS+P  + C A P   +   C  +   Q  +M++E +++G               G + +   +   +  +E F    +Y C C AW+ +   +K +K     A ++ +Y +  F+  P  T++     +VL C PP+  P ++V WLKN + +  ++  +V +     LII +   SDSGNYTCVA +    ++S  A + V +   WS+WTD   C + C   G+ +        ++R R C           C+G   +   C+  C   +  W  WS W+  C   C + R R C S +       C G      NC+  +C + +  LL +        S    +Y  L   +  + ++I+ +      +    +     ++ S+   G  + ++ K+ + +  LL+N+  +  +   + + +      S+  E+   +S   P+ E+ S    ++      +EY ++S  Q                        T  +  AP Y+  ++G        N     + L        A      AGGRL +P +GISL +P G I    + EM++++ ++  +    D  E+ LSP +  GPP   L   + +TI HCA +    W IR+      N      W+E   V   +    + Y  L++   H+++       + G   PL+    + RLR+  F  P   + +   +RV+ + DT  A + V V E    G+LL+  K + F  +   +   + D+  L W     +  Q FS+S VW  N    Q     LE    + S  SC I+++Q+     + ++++      + +++VP     D    S+  S+A        F++  + R+++    D++      WQ LA  + ++ NL YF+ ++SPS  +L LWE++ ++ G +  L + L  IG+
Sbjct:   53 LPRFVEEPVDAYII-KSNPIQLRCQARPALQIFFKCNGEWVHQSQHMSREHTDTG--------------SGLKIREVMINVSRQQVEDFHGPEDYWCLCVAWSHL-GTSKSRK-----AAVRIAYLRKNFEQDPQGTEVPLNGMIVLHCRPPEGVPVAEVEWLKNDDPLNYADDSIVDLRGDHSLIISEARLSDSGNYTCVASNIVAKRRSSTATVVVYVNGGWSSWTDWSTCSVRC---GRGV--------QKRSRTCTNPAPLNGGSFCEGMSVQKSTCNTVC-PVDGGWGDWSEWSA-CSSDCERQRSRECTSPEPKHGGRLCDGVAVATDNCTGGLCTQ-NRKLLHDAKQQGAESSSDVALYSGLAAGVVTVVLLIVAVTLYRRSQSEYGV----DVIDSSALTGGFQSFSFKTSRQANPLLINSSMQPDLTVSRTYTSPMCFQDSIDKEIMAEHSLLRPLPELKSKGAAER------AEYHVMSHPQ------------------------TFPRGLAPDYRGVAVGTTLGIRGKNLFTPTVSLTPSRPLHKATAVFGHAGGRLVVPNTGISLLVPHGGIAEDTTWEMYMSISQEDCSALSEDGSEVFLSPAVTYGPPGLDLSCSVAMTIAHCAEVSADSWTIRLKRQILDNK-----WEE---VMCTDEESTSCYCLLETQRCHVLLGQPGRYALVG--EPLNQ-EAAKRLRLAVFGGPDTGNSLGFTLRVYCVDDTPHAFQEVAVGERSRGGRLLEEPKIMLFKGNNFSLQVSIQDIPQLVWSIKPFTTCQEFSFSQVWASNQHPLQ-CAFSLERYSHSSSQLSCKISIRQVT--GEEHILQIYTSVVESEKAVVPFFTQSDCTITSQTGSRA--------FKIPPSIRRRIIATFDAANANGKDWQLLAQKLHIDRNLCYFACQESPSSVILSLWEAQHQDSGDLDSLASALEEIGK 926          
BLAST of Uncoordinated 5 vs. Ensembl Medaka
Match: unc5c (netrin receptor UNC5C [Source:NCBI gene;Acc:101157960])

HSP 1 Score: 181.8 bits (460), Expect = 1.830e-46
Identity = 123/417 (29.50%), Postives = 212/417 (50.84%), Query Frame = 3
Query: 1809 VAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQC-SDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLS-LGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTV--------FRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRND 3011
             A G+ ++ GG+L +P SG+SL IP GA+  G   EM++ V R     P ++  + +LSPV+ CGPP   L +P+++T+ HCA      DW I++ S   QN      W+++  V   N +    Y Q+D  + H++ + L   C+ G    LS  ++  RL++  F     + +++ IRV+ + DT++A++ V+  E ++ G+LLD  K LSF  S  ++   + D+  + W+    +K Q  S+  VW     +N      LE    +    +C I V+Q+   + +  I  +            +S D+QS+      + LDP   +        FR+  + RQ+L   LD+       W+ LA+ + L+  LNYF+ K SP+  +LDLWE++   +G ++ L  +L  +GR+D
Sbjct:  491 TALGSFSSQGGQLIVPNSGVSLLIPAGAVPQGRVYEMYVTVQRKENLRPSVEDGQTVLSPVVSCGPPGALLTRPVVITMHHCAVCDGQQDWLIQLKSQSQQNQ-----WEDVVVVGEENFT-TPCYVQMDDEACHILTETLGTYCLVG--QSLSAATIK-RLKLAIFGPVTCAAMEYHIRVYCLDDTQDALKEVLQMEKQMGGKLLDEPKTLSFKDSTHNLRLSIHDVPHMMWKSKLLAKYQELSFQQVWS-GSQRNLHCCFTLERFSTSTVDLTCKICVRQV---EGEGQIFQLD---------TTLSEDSQSI----DTSLLDPASNITTLVGPNAFRIPVSIRQKLCSSLDAPQTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGNLSRLAQVLEEMGRHD 881          

HSP 2 Score: 112.849 bits (281), Expect = 8.473e-25
Identity = 90/342 (26.32%), Postives = 146/342 (42.69%), Query Frame = 3
Query:  243 LEPQPFYYVNKSHPATIVCIAEPVSHVNIFC-----ADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFS--EYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELIT---NSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCES------GK-CFGPKQQIRNCSQAICQK 1217
            +EP+  Y V K+ P  + C A P + +   C       K+ +   +    SGL V +                S  +  + + E F   ++ C C AW+      K +K H     ++ +Y +  F   P   +++  ++++L C PP+  P ++V WLKN E+I    + N+  +TID    LII++   SD+ NYTCVA++    + S  A + V +   WS WT+   C              C    ++R R C           C G   +  PC+  C   +  W  WS W+T C   C+  R R C +      GK C G   Q +NC+  +C +
Sbjct:    1 MEPEEAYIV-KNKPVNLYCKATPATQIYFKCNSEWVHQKEHTVEERVDENSGLVVREA---------------SIEITRQQVEELFGPEDFWCQCVAWSS-AGTTKSRKAH-----VRIAYLRKPFDQEPLGKEVSIEQEVLLQCRPPEGIPPAEVEWLKNDEIIDPAEDRNF-YITIDH--NLIIKQARLSDTANYTCVAKNIVAKRYSTTATVIVYVNGGWSTWTEWSVC-----------NSRCGRGYQKRTRSCTNPAPLNGGAICDGQGIQKLPCNPLC-PVDGLWTEWSKWST-CGTECTHWRRRDCGAPAPKNGGKDCEGTVLQSKNCTDGLCMQ 304          
BLAST of Uncoordinated 5 vs. Ensembl Medaka
Match: unc5c (netrin receptor UNC5C [Source:NCBI gene;Acc:101157960])

HSP 1 Score: 181.415 bits (459), Expect = 2.240e-46
Identity = 123/416 (29.57%), Postives = 212/416 (50.96%), Query Frame = 3
Query: 1812 AWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQC-SDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLS-LGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTV--------FRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRND 3011
            A G+ ++ GG+L +P SG+SL IP GA+  G   EM++ V R     P ++  + +LSPV+ CGPP   L +P+++T+ HCA      DW I++ S   QN      W+++  V   N +    Y Q+D  + H++ + L   C+ G    LS  ++  RL++  F     + +++ IRV+ + DT++A++ V+  E ++ G+LLD  K LSF  S  ++   + D+  + W+    +K Q  S+  VW     +N      LE    +    +C I V+Q+   + +  I  +            +S D+QS+      + LDP   +        FR+  + RQ+L   LD+       W+ LA+ + L+  LNYF+ K SP+  +LDLWE++   +G ++ L  +L  +GR+D
Sbjct:  484 ALGSFSSQGGQLIVPNSGVSLLIPAGAVPQGRVYEMYVTVQRKENLRPSVEDGQTVLSPVVSCGPPGALLTRPVVITMHHCAVCDGQQDWLIQLKSQSQQNQ-----WEDVVVVGEENFT-TPCYVQMDDEACHILTETLGTYCLVG--QSLSAATIK-RLKLAIFGPVTCAAMEYHIRVYCLDDTQDALKEVLQMEKQMGGKLLDEPKTLSFKDSTHNLRLSIHDVPHMMWKSKLLAKYQELSFQQVWS-GSQRNLHCCFTLERFSTSTVDLTCKICVRQV---EGEGQIFQLD---------TTLSEDSQSI----DTSLLDPASNITTLVGPNAFRIPVSIRQKLCSSLDAPQTRGNDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQHFPDGNLSRLAQVLEEMGRHD 873          

HSP 2 Score: 96.6709 bits (239), Expect = 7.152e-20
Identity = 74/289 (25.61%), Postives = 124/289 (42.91%), Query Frame = 3
Query:  228 IPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFC-----ADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFS--EYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELIT---NSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGC 1064
            +P F++EP+  Y V K+ P  + C A P + +   C       K+ +   +    SGL V +                S  +  + + E F   ++ C C AW+      K +K H     ++ +Y +  F   P   +++  ++++L C PP+  P ++V WLKN E+I    + N+  +TID    LII++   SD+ NYTCVA++    + S  A + V +   WS WT+   C              C    ++R R C           C G   +  PC+  C
Sbjct:   43 LPVFLMEPEEAYIV-KNKPVNLYCKATPATQIYFKCNSEWVHQKEHTVEERVDENSGLVVREA---------------SIEITRQQVEELFGPEDFWCQCVAWSS-AGTTKSRKAH-----VRIAYLRKPFDQEPLGKEVSIEQEVLLQCRPPEGIPPAEVEWLKNDEIIDPAEDRNF-YITIDH--NLIIKQARLSDTANYTCVAKNIVAKRYSTTATVIVYVNGGWSTWTEWSVC-----------NSRCGRGYQKRTRSCTNPAPLNGGAICDGQGIQKLPCNPLC 295          
BLAST of Uncoordinated 5 vs. Planmine SMEST
Match: SMESG000073898.1 (SMESG000073898.1)

HSP 1 Score: 2006.88 bits (5198), Expect = 0.000e+0
Identity = 993/993 (100.00%), Postives = 993/993 (100.00%), Query Frame = 3
Query:   72 MWRSGNNSFHFHLITLFLVVIRKSNQQLEEVQESEVDGKKDLVQPNEKHYDGIPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFSEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCESGKCFGPKQQIRNCSQAICQKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDSSWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQEILKQC 3050
            MWRSGNNSFHFHLITLFLVVIRKSNQQLEEVQESEVDGKKDLVQPNEKHYDGIPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFSEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCESGKCFGPKQQIRNCSQAICQKPDPSLLLESQSTTMYLSLFITISILFIIILIILCLITQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDSSWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQEILKQC
Sbjct:    1 MWRSGNNSFHFHLITLFLVVIRKSNQQLEEVQESEVDGKKDLVQPNEKHYDGIPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFSEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCESGKCFGPKQQIRNCSQAICQKPDPSLLLESQSTTMYLSLFITISILFIIILIILCLITQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEYPIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLDSSWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQEILKQC 993          
BLAST of Uncoordinated 5 vs. Planmine SMEST
Match: SMESG000040323.1 (SMESG000040323.1)

HSP 1 Score: 498.049 bits (1281), Expect = 4.998e-158
Identity = 328/1025 (32.00%), Postives = 529/1025 (51.61%), Query Frame = 3
Query:  174 EVDGKKDLVQPNEKHYDGIPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFSEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVK--KSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVPTCSQTRVRRCESGKCFGPKQ-QIRNCSQAICQKPDPSLLLESQ-----STTMYXXXXXXXXXXXXXXXXXXXXXX-------QKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVATSLLNEMPNNYSPVYEMHSHNNRDQVLPAIYSEY----PIISKSQYTYSSTTPLINNPYSKERSYNE-----TLTEKQKAAPL---------YQEFSIGRGSC---GLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCA-NIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLS---SEVDHLIRVHLIPDTKEAIENVIVSEL-KLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLGWRCHANSKMQTFSYSSVW-------------RLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQA---YLDP-----LQTVFRLSSATRQQLWPLLDS------SWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQEILK 3044
            EVD KKDLV P+EKH +G+PKFI +P+  YYV+KSHPA I CIA+PVSHVNIFCADKQ+SYMN+E+S +GL V+KM+   +   KG RWKFS  V++KD+IEWFSEY+C+CEAWN+I  + K KKV SS+A+I +SY   +FK  P N K++    + L C PPD+KP +++ W+KN E IT  ++P   I+EY  L++  +  +DSGNY+CVA S G+ +   ++I V  V    +WS WT +  CP IC     C  ++CS   ++R+R+C  +       NC G + E + CD+ C+   + W  WS W+      C + R R+C +  C      +I NC+ A C     S +  ++     ST++Y++  + + I   + + +  ++        ++  I   P R   +S   NGI   Y +K+ K +    L+N+Q + +   +    + IV  + L  +P+N S      ++ +    +  I   +    P+I+    +    T  I   YS  +  +       L +     P+         YQE            +    LP +   E + W TI ++GGR+ L  S I+LT P  +   G SE +FLA C    ++P +   E LLSPV++CGP +    KP IL IPHCA N    +W I VL++ +   +  P W++   +   ++     YAQL      LI + LQ  C+ G  S   +   +  LR+ A+   L    ++   ++R++LIPD  E I  V   E  +L  +L+ N K+       G+I   + DL++ W+  + +  Q   +  VW             RL ++ + E+ I +  +D     + C +++ Q +   N+  + +      ++ S+   S    + S   SQ+   ++D       ++VF+L   T+ +L  LLDS       W+ LA H+ +  +L +FS K S ++ LLDLWE++     ++ +LI+ILR +GR DC  I+E+++++
Sbjct:   36 EVDSKKDLVLPSEKHLEGVPKFIQQPKSMYYVSKSHPAVITCIAQPVSHVNIFCADKQYSYMNEEVSATGLKVIKMDNEGRLAVKGNRWKFSLEVQHKDVIEWFSEYRCHCEAWNQIEQLQKVKKVESSSAVIYDSYINKDFKTVPKNQKVSVRGSVKLSCIPPDAKPPAEIHWVKNGEKITGKSHPQFEINEYGELLLSNIRLTDSGNYSCVASSFGLERHATAQILVFEVGQWSDWSEWTGI--CPNICSKGSNC-PKVCSTSRQQRVRYC--NQINNQKANCIGSEIEYKRCDLICD--SNLWTFWSEWSKCSGNPCKKERTRQCTTNNCGKASSVEIDNCTLAECGGFVASFINSNKKYPESSTSIYITHDVAMYIGLFVAVSVFLMVVAIIFCLIRRRVIGFSPNRVWRYSTTANGIQMFYPDKNLKKNLS-NLSNKQINLIDINQPSLYRSIVLPNSLPFLPSNQSDASSNSAYTDVGNDITYIQRNHLPSLPMIATPLLSSMKPTLKIRPSYSDSKVSSTLYPQMGLVKHVSTLPIPVSSSLSDHYQELGNTDNETSDQSVTEPCLPYNFNGENMIWATIDSSGGRISLALSDINLTCPPNSFAPGISEPIFLATCNSEQDLPNLSTNETLLSPVVVCGPTNVIAFKPFILNIPHCAYNTDSGNWAISVLTS-YSPLKQKPYWQKYLDLDAEDKDSPPGYAQLAKDRLFLITNQLQRFCVVG--SSYRNKRATKVLRIAAYCTGLDRRHADEQIVVRLYLIPDIAECISKVHNFETNRLGARLVTNQKQFFCEDEAGNITVVISDLAMDWQASSANNYQEIPFKDVWHSPTLHCSFNFIKRLINANSSELKISVNSLD---FNWFCTLSIYQTNSHHNKQTVLLSTPNGSSHTSISATSTQFSNYSAGGSQSFPYFVDDCSKTNFESVFKLPEQTKIKLCKLLDSLTPLDNDWRQLARHLSITRSLQFFSNKLSSTEILLDLWEAQNHSRKSLNNLIDILRKMGRLDCVAILEKDLIQ 1046          
BLAST of Uncoordinated 5 vs. Planmine SMEST
Match: SMESG000025091.1 (SMESG000025091.1)

HSP 1 Score: 316.62 bits (810), Expect = 8.356e-92
Identity = 230/692 (33.24%), Postives = 365/692 (52.75%), Query Frame = 3
Query: 1065 EKYESKWNSWSLWTTICVPTCSQTRVRRCES-GKCFGPKQQIRNCSQAICQKPDPSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVATSLLNEMPNNYSP---VYEMHSHNNRDQVLPAIYSEY-------PIISKSQYTY----SSTTPLINNPYSKE-RSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARF--QNSQIP-----PLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEV---DHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVK---ERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLD------SSWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQE 3035
            E   ++W++WS     C   C +TR R C S G C    ++I +C++  C+    SL  +++   MY+ LF+ ++IL ++I II CLI +K  + L        + + NG+     N   KNS  +   N       ++ N   Q     S L++ P N  P   + E+ S N     +   Y+         P+IS S        S  T L N  +  +  + + T    +  + LY E S+ R S      ++  +I++ T+AWGTI+  GGRLCLPQSGI+LTI  G+  + +S EM+LAV R+  N P++   E LL+P++L GP    +LKP +L++PH A+++  +W IR+LS     QN ++      P+WK ++T+         +Y  LD  +A +++D  Q +C+ G   P      + RLR+ AF  PLS+     ++ IR+++  DTKEA E+V   E KL   LLD + ++ FS S G++ FC+++LS GW+    +K Q   +  +W  + S+        +++DP++   +C IT  Q      + VI + +   +R+ + R L  I  +   +  E +  YLDPL TVFR+S+ATR++L  LLD      + W+ L   + LNG LNYF  K SP+DAL+ LWESR R E A+ DLI  L+ IGR DC+ ++E +
Sbjct:  269 ENPATQWSAWS----ACDGNCKKTRTRNCNSKGVC----KEIDSCTKKECELSTSSLQ-DARDIAMYVGLFVAVTILVMVITIIFCLIRRKALLPLRSTMRYPLNINGNGVAYDVKNSLIKNSNTISTKNPYIMDT-SLANLTQQ----RSYLSQSPPNLPPPTCLSEISSTNAYSTGIDFSYNSTGSGKFSQPLISNSSSASTTNKSKATSLSNTDHKPDPLTVSGTPINSRPPSALYHELSLDRESICNSPPFVSENIDISTLAWGTISTIGGRLCLPQSGITLTIAPGSFINSSSSEMYLAVSRNDPNPPILSDNETLLTPIVLFGPKDVPILKPCVLSVPHSADLRQGNWVIRLLSCVLPDQNDELKEPLCQPIWKNIATIG-CETDQTPIYTHLDPYAAFIMLDQPQKICLVGQSYPGG--KATKRLRLAAFGRPLSTSSYLPNYNIRIYVFSDTKEAFESVSTIETKLGSTLLDITYQIIFSDSMGNLFFCIEELSTGWKSQLTTKYQEIPFQDIWSGSQSETLHCAFTFDNIDPSQQSLTCRITAYQSGFYSQKQVITIKQDKLDRSNHKRDL--IQHEKVLLYSESNNTYLDPLMTVFRISNATRKKLCFLLDNVTPRGNDWKQLCRQLSLNGYLNYFMSKVSPTDALVTLWESRNRNENALIDLIISLKAIGRTDCSTLLESD 941          

HSP 2 Score: 218.394 bits (555), Expect = 2.913e-58
Identity = 121/289 (41.87%), Postives = 172/289 (59.52%), Query Frame = 3
Query:  174 EVDGKKDLVQPNEKHYDGIPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFD-PKGKRWKFSYVVEYKDIIEWFSEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKY------EWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDG--KKTDS 1013
            E++ + D V+ NE   +GIP FI EP+  YYV +  PA IVCIAEPVSHVNI C  + FSYM+ ELSES L V KMN+ N+ D   G RW FS  + Y  + EWF+ + C CEAWN+I S+   KKVHS   +I+E+YF++ FK  P +  + +G+ L+L C PP+SKP ++V W+KNK+ +  +N   + I E  +L+I+    +DSGNY+C+A S    + S IA++ +          +WSAW+   AC      +G C         + R R+C   G  K+ DS
Sbjct:   35 EIEDENDFVKLNESKLEGIPSFIKEPESVYYVYEKKPAKIVCIAEPVSHVNIICNKEVFSYMDLELSESNLRVRKMNKNNEDDLTNGHRWMFSLEITYNQVTEWFNTFSCVCEAWNQIPSLRLAKKVHSRYGVIKEAYFKSNFKKVPQSKTVVKGQSLILTCVPPESKPKAQVQWMKNKKRLFENNR--IKIVEEHQLLIEDTLLTDSGNYSCIAISLEEKRYSPIAIVKIQESVTENPATQWSAWS---AC------DGNC--------KKTRTRNCNSKGVCKEIDS 304          
BLAST of Uncoordinated 5 vs. Planmine SMEST
Match: SMESG000025091.1 (SMESG000025091.1)

HSP 1 Score: 311.227 bits (796), Expect = 7.613e-90
Identity = 231/704 (32.81%), Postives = 365/704 (51.85%), Query Frame = 3
Query: 1074 ESKWNSWSLWTTICVPTCSQTRVRRCES-GKCFGPKQQIRNCSQAICQ----------KPD-----PSLLLESQSTTMYXXXXXXXXXXXXXXXXXXXXXXQKGYISLLPRRGMVFSNHNNGITKIYTNKSPKNSEKLLLNNEQKSTVVTIKNHNAQDIVATSLLNEMPNNYSP---VYEMHSHNNRDQVLPAIYSEY-------PIISKSQYTY----SSTTPLINNPYSKE-RSYNETLTEKQKAAPLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARF--QNSQIP-----PLWKELSTVRPVNRSDANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLSSEV---DHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVK---ERALNNRSLVPISLDAQSVSREYSQAYLDPLQTVFRLSSATRQQLWPLLD------SSWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQE 3035
            E+    WS W+  C   C +TR R C S G C    ++I +C++  C+           P+      S L +++   MY+ LF+ ++IL ++I II CLI +K  + L        + + NG+     N   KNS  +   N       ++ N   Q     S L++ P N  P   + E+ S N     +   Y+         P+IS S        S  T L N  +  +  + + T    +  + LY E S+ R S      ++  +I++ T+AWGTI+  GGRLCLPQSGI+LTI  G+  + +S EM+LAV R+  N P++   E LL+P++L GP    +LKP +L++PH A+++  +W IR+LS     QN ++      P+WK ++T+         +Y  LD  +A +++D  Q +C+ G   P      + RLR+ AF  PLS+     ++ IR+++  DTKEA E+V   E KL   LLD + ++ FS S G++ FC+++LS GW+    +K Q   +  +W  + S+        +++DP++   +C IT  Q      + VI + +   +R+ + R L  I  +   +  E +  YLDPL TVFR+S+ATR++L  LLD      + W+ L   + LNG LNYF  K SP+DAL+ LWESR R E A+ DLI  L+ IGR DC+ ++E +
Sbjct:  269 ENPATQWSAWSA-CDGNCKKTRTRNCNSKGVC----KEIDSCTKKECEYNRAVAPFVKNPNKNGVSTSSLQDARDIAMYVGLFVAVTILVMVITIIFCLIRRKALLPLRSTMRYPLNINGNGVAYDVKNSLIKNSNTISTKNPYIMDT-SLANLTQQ----RSYLSQSPPNLPPPTCLSEISSTNAYSTGIDFSYNSTGSGKFSQPLISNSSSASTTNKSKATSLSNTDHKPDPLTVSGTPINSRPPSALYHELSLDRESICNSPPFVSENIDISTLAWGTISTIGGRLCLPQSGITLTIAPGSFINSSSSEMYLAVSRNDPNPPILSDNETLLTPIVLFGPKDVPILKPCVLSVPHSADLRQGNWVIRLLSCVLPDQNDELKEPLCQPIWKNIATIG-CETDQTPIYTHLDPYAAFIMLDQPQKICLVGQSYPGG--KATKRLRLAAFGRPLSTSSYLPNYNIRIYVFSDTKEAFESVSTIETKLGSTLLDITYQIIFSDSMGNLFFCIEELSTGWKSQLTTKYQEIPFQDIWSGSQSETLHCAFTFDNIDPSQQSLTCRITAYQSGFYSQKQVITIKQDKLDRSNHKRDL--IQHEKVLLYSESNNTYLDPLMTVFRISNATRKKLCFLLDNVTPRGNDWKQLCRQLSLNGYLNYFMSKVSPTDALVTLWESRNRNENALIDLIISLKAIGRTDCSTLLESD 957          

HSP 2 Score: 218.394 bits (555), Expect = 3.088e-58
Identity = 121/289 (41.87%), Postives = 172/289 (59.52%), Query Frame = 3
Query:  174 EVDGKKDLVQPNEKHYDGIPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFD-PKGKRWKFSYVVEYKDIIEWFSEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITVTMKY------EWSAWTDLEACPLICHMEGKCIGELCSNRNRRRLRHCLFDG--KKTDS 1013
            E++ + D V+ NE   +GIP FI EP+  YYV +  PA IVCIAEPVSHVNI C  + FSYM+ ELSES L V KMN+ N+ D   G RW FS  + Y  + EWF+ + C CEAWN+I S+   KKVHS   +I+E+YF++ FK  P +  + +G+ L+L C PP+SKP ++V W+KNK+ +  +N   + I E  +L+I+    +DSGNY+C+A S    + S IA++ +          +WSAW+   AC      +G C         + R R+C   G  K+ DS
Sbjct:   35 EIEDENDFVKLNESKLEGIPSFIKEPESVYYVYEKKPAKIVCIAEPVSHVNIICNKEVFSYMDLELSESNLRVRKMNKNNEDDLTNGHRWMFSLEITYNQVTEWFNTFSCVCEAWNQIPSLRLAKKVHSRYGVIKEAYFKSNFKKVPQSKTVVKGQSLILTCVPPESKPKAQVQWMKNKKRLFENNR--IKIVEEHQLLIEDTLLTDSGNYSCIAISLEEKRYSPIAIVKIQESVTENPATQWSAWS---AC------DGNC--------KKTRTRNCNSKGVCKEIDS 304          
BLAST of Uncoordinated 5 vs. Planmine SMEST
Match: SMESG000046884.1 (SMESG000046884.1)

HSP 1 Score: 222.246 bits (565), Expect = 1.117e-59
Identity = 105/226 (46.46%), Postives = 149/226 (65.93%), Query Frame = 3
Query:  186 KKDLVQPNEKHYDGIPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKELSESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFSEYKCYCEAWNRIVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDSKPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQSQGIVKKSKIAVITV 863
            + DL+ P E   +G+PKF+++ + FYYV   H  TI C+A+PVSH NI CA KQFSYM + +S++GL V K N  NQ DP+G +W  S +V++K + EWFS+Y+C CEAWN+I ++ + KKV S  + I ESYF++ FK  P +  L   +KL L C PP++KP + V WLKNK+ I  + +P + + +   LII+ V++SD G Y C A S  IV+KS  A I V
Sbjct:   20 QTDLILPEEMDLEGVPKFLVQLREFYYVKSDHSVTISCMADPVSHANIICATKQFSYMGRPVSDTGLIVTKFNRSNQIDPQGTKWNISLIVDHKSVSEWFSKYECVCEAWNQIPALGRAKKVFSRTSTILESYFRSNFKRIPISQNLLVNQKLELECVPPNAKPTAFVIWLKNKKKINEAVFPHIKVIDQSSLIIENVTESDIGQYCCEAYSLDIVRKSPCADINV 245          

HSP 2 Score: 197.208 bits (500), Expect = 1.382e-51
Identity = 133/424 (31.37%), Postives = 230/424 (54.25%), Query Frame = 3
Query: 1800 LETVAWGTITAAGGRLCLPQSGISLTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRLLKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSD--ANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLS--VSIRLRVLAFSLPLSSEVDHL-IRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIAFCLDDLSLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSGFSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAY--LDPLQTVFRLSSATRQQLWPLL------DSSWQTLANHMLLNGNLNYFSEKKSPSDALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQ 3032
             + +AWGT ++ GG L +P+SG+SL IPR AI  G S+ +FL V R  A+ P+++  E LLSPVI+CGP      K +IL +PH A +  S W+ R+L +++ NS   P W+ LST    N  D   +VY  +    + +++  L M C+ G   PLS  S   SI ++++ FS     E D+  IR++ IP+TKEA E++   E K  G+L   SK L+F   G ++   +++++ GW+ +   + Q   + +VW+ + S         +    + + FSC++   Q     N+  + +   +++N+ +        ++V+ + S AY  + P+   F LSS T+++L  LL       + W+ LA  M +     YF  K+ P+D+LL+LW+++  ++  I DL+++ +   R DC  ++E+
Sbjct:  468 FDGMAWGTFSSIGGHLDIPESGVSLFIPRDAIPIGLSQRIFLTVSRCSAHKPILNDNEALLSPVIICGPEIVDFEKSVILIVPHNAAVTHSQWHFRLLRSKYVNSSEKPDWEILST---TNNDDFGQHVYIHVTREKSCIMLKSLDMYCVIG--QPLSTNSNKASIFIQIIVFSENFYQECDNYSIRIYTIPNTKEAFESIYFVENKSGGKLWSCSKNLNFFDGGENLILRINEIAKGWKINQTPQTQLVKFQTVWKSHDSLGIMNSFHFDRSSSSLNSFSCSLVAYQNGNYSNRVTLELKSGKSINHSNSSFSRSSDKTVNND-STAYPFIHPIFENFSLSSQTKKELSKLLKIYDPSGNDWRILAREMNIKKT-EYFL-KEDPTDSLLNLWQAQNPQKFYIKDLMSVFQRYKRFDCVSVLER 883          
The following BLAST results are available for this feature:
BLAST of Uncoordinated 5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UNC5D5.568e-7825.86unc-5 netrin receptor D [Source:HGNC Symbol;Acc:HG... [more]
UNC5D9.832e-7825.99unc-5 netrin receptor D [Source:HGNC Symbol;Acc:HG... [more]
UNC5D3.169e-7726.06unc-5 netrin receptor D [Source:HGNC Symbol;Acc:HG... [more]
UNC5C1.368e-7324.12unc-5 netrin receptor C [Source:HGNC Symbol;Acc:HG... [more]
UNC5C2.478e-7324.12unc-5 netrin receptor C [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Uncoordinated 5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-57.989e-1927.27Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
unc-58.294e-1927.27Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
unc-51.135e-1823.87Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
unc-51.598e-1823.87Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
unc-51.970e-1827.27Netrin receptor unc-5 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of Uncoordinated 5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-51.644e-2527.13gene:FBgn0034013 transcript:FBtr0339998[more]
unc-51.644e-2527.13gene:FBgn0034013 transcript:FBtr0087382[more]
robo31.256e-929.03gene:FBgn0041097 transcript:FBtr0077921[more]
robo31.256e-929.03gene:FBgn0041097 transcript:FBtr0335384[more]
robo21.679e-926.61gene:FBgn0002543 transcript:FBtr0077941[more]
back to top
BLAST of Uncoordinated 5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc5db1.217e-7824.56unc-5 netrin receptor Db [Source:ZFIN;Acc:ZDB-GENE... [more]
unc5db3.029e-7824.56unc-5 netrin receptor Db [Source:ZFIN;Acc:ZDB-GENE... [more]
unc5db2.958e-7325.24unc-5 netrin receptor Db [Source:ZFIN;Acc:ZDB-GENE... [more]
unc5da3.556e-7024.06unc-5 netrin receptor Da [Source:ZFIN;Acc:ZDB-GENE... [more]
unc5b9.818e-7024.64unc-5 netrin receptor B [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Uncoordinated 5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UNC5D2.299e-8126.59unc-5 netrin receptor D [Source:NCBI gene;Acc:1004... [more]
UNC5D5.882e-8126.92unc-5 netrin receptor D [Source:NCBI gene;Acc:1004... [more]
UNC5D6.002e-8126.92unc-5 netrin receptor D [Source:NCBI gene;Acc:1004... [more]
UNC5D4.459e-7726.76unc-5 netrin receptor D [Source:NCBI gene;Acc:1004... [more]
ndufaf71.035e-7524.56NADH:ubiquinone oxidoreductase complex assembly fa... [more]
back to top
BLAST of Uncoordinated 5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Unc5d9.230e-7926.80unc-5 netrin receptor D [Source:MGI Symbol;Acc:MGI... [more]
Unc5d1.473e-7826.31unc-5 netrin receptor D [Source:MGI Symbol;Acc:MGI... [more]
Unc5c8.572e-7524.41unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI... [more]
Unc5c1.457e-7224.14unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI... [more]
Unc5c1.457e-7224.14unc-5 netrin receptor C [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Uncoordinated 5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8K1S2|UNC5D_MOUSE1.030e-7726.31Netrin receptor UNC5D OS=Mus musculus OX=10090 GN=... [more]
sp|F1LW30|UNC5D_RAT3.136e-7726.25Netrin receptor UNC5D OS=Rattus norvegicus OX=1011... [more]
sp|Q6UXZ4|UNC5D_HUMAN4.722e-7725.99Netrin receptor UNC5D OS=Homo sapiens OX=9606 GN=U... [more]
sp|O08747|UNC5C_MOUSE5.996e-7424.41Netrin receptor UNC5C OS=Mus musculus OX=10090 GN=... [more]
sp|Q761X5|UNC5C_RAT1.322e-7324.30Netrin receptor UNC5C OS=Rattus norvegicus OX=1011... [more]
back to top
BLAST of Uncoordinated 5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E1CHK70.000e+079.64Uncoordinated 5 OS=Dugesia japonica OX=6161 GN=Dju... [more]
A0A267FQL31.884e-11929.84Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H3614.398e-11829.70Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GZF31.489e-10928.43Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GQ611.648e-10928.40Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Uncoordinated 5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc5c6.379e-7925.73unc-5 netrin receptor C [Source:ZFIN;Acc:ZDB-GENE-... [more]
unc5db2.497e-7023.74unc-5 netrin receptor Db [Source:ZFIN;Acc:ZDB-GENE... [more]
unc5b1.526e-6724.42unc-5 netrin receptor B [Source:NCBI gene;Acc:1030... [more]
unc5da8.579e-4028.16unc-5 netrin receptor Da [Source:ZFIN;Acc:ZDB-GENE... [more]
unc5da7.152e-3928.54unc-5 netrin receptor Da [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Uncoordinated 5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010609.11.365e-4328.29pep scaffold:Pmarinus_7.0:GL476332:154004:216612:1... [more]
ENSPMAT00000008404.13.212e-3627.86pep scaffold:Pmarinus_7.0:GL476608:255441:311832:-... [more]
ENSPMAT00000003861.17.258e-3228.03pep scaffold:Pmarinus_7.0:GL476449:2630:55902:-1 g... [more]
tjp1a1.090e-1732.87tight junction protein 1a [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSPMAT00000002817.11.541e-1231.16pep scaffold:Pmarinus_7.0:GL476732:495093:569098:-... [more]
back to top
BLAST of Uncoordinated 5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Uncoordinated 5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO466016.497e-2624.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418496.580e-2025.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418502.187e-1038.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352401.207e-929.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311736.802e-826.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Uncoordinated 5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-72b7.11.685e-7525.34netrin receptor UNC5C [Source:NCBI gene;Acc:101174... [more]
si:ch73-72b7.12.033e-7525.34netrin receptor UNC5C [Source:NCBI gene;Acc:101174... [more]
unc5da2.081e-6723.42netrin receptor UNC5D [Source:NCBI gene;Acc:101173... [more]
unc5c1.830e-4629.50netrin receptor UNC5C [Source:NCBI gene;Acc:101157... [more]
unc5c2.240e-4629.57netrin receptor UNC5C [Source:NCBI gene;Acc:101157... [more]
back to top
BLAST of Uncoordinated 5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073898.10.000e+0100.00SMESG000073898.1[more]
SMESG000040323.14.998e-15832.00SMESG000040323.1[more]
SMESG000025091.18.356e-9233.24SMESG000025091.1[more]
SMESG000025091.17.613e-9032.81SMESG000025091.1[more]
SMESG000046884.11.117e-5946.46SMESG000046884.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021266 ID=SMED30021266|Name=Uncoordinated 5|organism=Schmidtea mediterranea sexual|type=transcript|length=3408bp
TTAAATATAAATTATTCAATAAACATTAATTACTTAAATGAATTTAAACA
ATCTGTTTGACTTTCACAAAAATGTGGCGTTCTGGAAATAATTCTTTTCA
CTTTCATCTAATCACTTTATTCTTGGTTGTCATAAGAAAATCAAACCAAC
AATTAGAAGAAGTGCAAGAGTCAGAAGTCGATGGTAAAAAAGATCTCGTT
CAACCAAATGAAAAACATTATGATGGTATACCAAAGTTCATTCTTGAGCC
ACAACCCTTTTATTATGTAAATAAAAGTCATCCAGCAACAATTGTTTGTA
TTGCTGAACCTGTGTCACATGTAAACATTTTCTGTGCCGATAAACAATTC
TCTTACATGAACAAAGAATTATCAGAAAGTGGATTAGCAGTTGTAAAAAT
GAATGAATTCAATCAGTTTGATCCCAAAGGAAAAAGGTGGAAATTCAGTT
ACGTGGTTGAATACAAGGATATTATCGAATGGTTCAGTGAGTACAAATGT
TATTGTGAAGCTTGGAATAGAATAGTATCGATAAACAAAGACAAAAAAGT
CCACAGTTCTGCCGCATTAATTCAAGAATCATATTTTCAAAATGAATTCA
AAGTGAGCCCCACAAACACCAAATTAAATGAAGGTGAAAAACTAGTATTG
TTATGCACTCCACCGGATTCCAAGCCTAATTCAAAGGTGACATGGCTCAA
AAATAAAGAATTAATAACAAATTCAAATTATCCACTTGTAACTATTGATG
AATATAAACGGCTAATAATTCAAAAAGTATCCAAATCTGACAGTGGAAAT
TATACATGTGTCGCGCAAAGTCAGGGCATTGTGAAAAAATCAAAAATAGC
TGTTATAACGGTCACAATGAAATATGAATGGTCTGCATGGACAGATCTGG
AAGCATGCCCCTTAATTTGTCACATGGAAGGCAAATGTATTGGTGAATTG
TGTAGCAATAGAAATCGCAGACGTCTAAGACATTGTTTATTTGATGGAAA
AAAAACTGATTCAGGAAATTGTAAAGGGCCACAGTTTGAAAATGAACCCT
GTGATATCGGATGTGAAAAATATGAAAGTAAATGGAATAGTTGGTCATTG
TGGACAACAATTTGCGTTCCAACTTGTTCACAAACTCGAGTCAGACGTTG
TGAAAGTGGGAAATGTTTTGGTCCAAAACAACAAATCCGAAACTGTAGTC
AAGCGATTTGCCAAAAACCAGATCCCAGCCTGTTGCTAGAATCGCAAAGT
ACAACAATGTATTTGAGCTTGTTCATTACAATATCCATTCTTTTTATAAT
TATTCTAATTATACTTTGTCTTATAACTCAGAAGGGATACATCAGTCTAC
TCCCTCGCAGAGGAATGGTGTTTTCTAATCATAATAATGGTATAACGAAG
ATATATACCAATAAAAGTCCTAAAAATAGTGAGAAACTATTATTAAACAA
CGAACAAAAGTCTACAGTTGTCACGATAAAGAATCACAACGCTCAAGATA
TTGTTGCAACTTCATTGTTAAACGAAATGCCAAACAATTACAGTCCAGTT
TATGAAATGCATTCGCATAATAATCGCGATCAAGTACTTCCGGCGATTTA
TTCGGAGTATCCTATTATATCAAAGTCTCAGTATACGTATTCATCAACGA
CACCCTTAATAAATAATCCTTATTCAAAAGAAAGATCTTATAATGAAACT
CTAACGGAAAAACAGAAAGCAGCTCCACTCTATCAAGAATTTTCAATTGG
TCGAGGTTCATGTGGATTATTGTCCAATTATCTTCCTTCGGATATCGAAC
TGGAAACAGTGGCATGGGGAACTATTACAGCAGCAGGAGGTAGATTGTGT
CTTCCTCAATCAGGAATCAGTTTAACAATTCCTAGAGGCGCAATTCACCA
TGGAAACTCAGAGGAGATGTTTCTTGCGGTTTGTCGCGATCATGCAAATA
TTCCAGTAATAGACATGATGGAAATGCTACTTAGTCCTGTTATTTTATGT
GGCCCTCCTCATACACGGCTTCTTAAACCAATAATACTCACAATACCGCA
TTGTGCTAATATCCAGTGTAGTGACTGGAATATTCGTGTCCTTAGCGCTA
GGTTTCAAAATAGTCAAATTCCTCCTTTATGGAAGGAACTCTCTACTGTT
CGCCCTGTAAATAGATCAGACGCAAATGTTTATGCTCAACTTGATTCAAT
TTCAGCTCATTTAATTGTAGACCACCTTCAAATGGTCTGTATAACTGGTT
GTTTATCTCCTTTATCAGATTTATCCGTTTCTATCCGACTAAGAGTTTTG
GCATTTTCTTTACCACTTTCGTCAGAAGTTGATCATTTGATACGAGTTCA
CTTAATTCCTGATACTAAAGAAGCCATTGAAAATGTAATTGTGTCAGAAC
TAAAATTGAATGGTCAATTGTTAGACAATAGTAAAAAGTTGTCATTCTCA
AGTTCTGGTGGAGATATTGCATTTTGTTTGGATGATCTCTCTTTGGGATG
GAGATGTCACGCAAATAGTAAAATGCAGACATTTTCATACTCTTCGGTGT
GGAGATTAAATCATAGTCAAAATCAAGAAATCCACATTCAATTGGAACAT
GTTGATCCAACAAGATCTGGTTTCAGTTGTAATATTACAGTTCAGCAAAT
TGACTTACCTCAAAATCAGGCTGTCATTAGAGTGGTCAAAGAGCGAGCTC
TCAATAATAGGTCCCTTGTTCCGATTTCTCTTGATGCACAATCAGTCAGT
CGAGAATATTCACAAGCATATCTTGATCCTCTTCAAACGGTTTTCAGACT
TTCTTCAGCTACTAGACAGCAGCTGTGGCCTCTTTTAGATTCAAGCTGGC
AAACTTTGGCAAATCATATGTTACTTAATGGGAATTTGAATTATTTTTCT
GAAAAAAAGAGTCCCAGTGATGCCTTGTTAGATTTATGGGAATCAAGATG
CCGTGAAGAAGGTGCAATCGCGGATCTGATAAATATTCTTAGAGTAATTG
GCAGAAATGATTGTGCAATGATCGTTGAACAGGAAATTCTGAAACAATGC
TGAAATCTTGATTTAAAATCTGTGATAATAATTTTATTTACATTTTCAAC
AAAAAAAAACAATTATTAATACGAGCTTACCAAAGTCACCAATAGAAAAC
TGCTTTTTTCATGATTATCAGTACCAAAACAAAAGAATTTCATAGAATAC
TAAAAGTATTATTGTCGACGAAGCTGTGTAAATTAAAAAAAACGTTTTTG
GAAATAATATAGATGTGCACAATTAGTGAATTTTAGCCTCCGGTTCTAAA
TTTCGCTAATAAAATGATAAATTATAATGTCTCATTTTGTGTTTATATTC
TTTATGAGATTTCATAGATAAATCAATATTTTGCACTTGTTTTCTCTATT
TCTGGTGT
back to top

protein sequence of SMED30021266-orf-1

>SMED30021266-orf-1 ID=SMED30021266-orf-1|Name=SMED30021266-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=994bp
MWRSGNNSFHFHLITLFLVVIRKSNQQLEEVQESEVDGKKDLVQPNEKHY
DGIPKFILEPQPFYYVNKSHPATIVCIAEPVSHVNIFCADKQFSYMNKEL
SESGLAVVKMNEFNQFDPKGKRWKFSYVVEYKDIIEWFSEYKCYCEAWNR
IVSINKDKKVHSSAALIQESYFQNEFKVSPTNTKLNEGEKLVLLCTPPDS
KPNSKVTWLKNKELITNSNYPLVTIDEYKRLIIQKVSKSDSGNYTCVAQS
QGIVKKSKIAVITVTMKYEWSAWTDLEACPLICHMEGKCIGELCSNRNRR
RLRHCLFDGKKTDSGNCKGPQFENEPCDIGCEKYESKWNSWSLWTTICVP
TCSQTRVRRCESGKCFGPKQQIRNCSQAICQKPDPSLLLESQSTTMYLSL
FITISILFIIILIILCLITQKGYISLLPRRGMVFSNHNNGITKIYTNKSP
KNSEKLLLNNEQKSTVVTIKNHNAQDIVATSLLNEMPNNYSPVYEMHSHN
NRDQVLPAIYSEYPIISKSQYTYSSTTPLINNPYSKERSYNETLTEKQKA
APLYQEFSIGRGSCGLLSNYLPSDIELETVAWGTITAAGGRLCLPQSGIS
LTIPRGAIHHGNSEEMFLAVCRDHANIPVIDMMEMLLSPVILCGPPHTRL
LKPIILTIPHCANIQCSDWNIRVLSARFQNSQIPPLWKELSTVRPVNRSD
ANVYAQLDSISAHLIVDHLQMVCITGCLSPLSDLSVSIRLRVLAFSLPLS
SEVDHLIRVHLIPDTKEAIENVIVSELKLNGQLLDNSKKLSFSSSGGDIA
FCLDDLSLGWRCHANSKMQTFSYSSVWRLNHSQNQEIHIQLEHVDPTRSG
FSCNITVQQIDLPQNQAVIRVVKERALNNRSLVPISLDAQSVSREYSQAY
LDPLQTVFRLSSATRQQLWPLLDSSWQTLANHMLLNGNLNYFSEKKSPSD
ALLDLWESRCREEGAIADLINILRVIGRNDCAMIVEQEILKQC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005042netrin receptor activity
GO:0005515protein binding
Vocabulary: biological process
TermDefinition
GO:0038007netrin-activated signaling pathway
GO:0007165signal transduction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000034epidermis
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002075pigment cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR033772UPA
IPR037936UNC5
IPR036179Ig-like_dom_sf
IPR003599Ig_sub
IPR003598Ig_sub2
IPR000488Death_domain
IPR000906ZU5_dom
IPR011029DEATH-like_dom_sf
IPR013783Ig-like_fold
IPR000884TSP1_rpt
IPR007110Ig-like_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 145..230
e-value: 1.2E-11
score: 54.7
IPR000488Death domainSMARTSM00005DEATH_4coord: 869..954
e-value: 6.8E-6
score: 35.6
IPR000488Death domainPFAMPF00531Deathcoord: 886..952
e-value: 2.3E-10
score: 40.5
IPR000488Death domainPROSITEPS50017DEATH_DOMAINcoord: 912..954
score: 10.656
IPR000906ZU5 domainSMARTSM00218zu_1coord: 542..645
e-value: 8.5E-23
score: 91.7
IPR000906ZU5 domainPFAMPF00791ZU5coord: 546..640
e-value: 1.1E-29
score: 102.6
IPR000906ZU5 domainPROSITEPS51145ZU5coord: 544..657
score: 21.182
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 151..218
e-value: 1.3E-5
score: 34.6
NoneNo IPR availablePFAMPF13927Ig_3coord: 142..214
e-value: 7.4E-13
score: 48.9
NoneNo IPR availableGENE3DG3DSA:1.10.533.10coord: 867..956
e-value: 5.2E-18
score: 66.8
NoneNo IPR availableGENE3DG3DSA:2.60.220.30coord: 534..693
e-value: 2.7E-29
score: 103.5
NoneNo IPR availablePANTHERPTHR12582:SF5NETRIN RECEPTOR UNC5Dcoord: 16..948
NoneNo IPR availableCDDcd08781Death_UNC5-likecoord: 875..951
e-value: 1.61526E-32
score: 118.918
NoneNo IPR availableTMHMMTMhelixcoord: 362..384
IPR033772UPA domainPFAMPF17217UPAcoord: 704..826
e-value: 5.7E-16
score: 58.7
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 15..140
e-value: 1.1E-23
score: 85.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 141..232
e-value: 8.5E-18
score: 66.0
IPR037936Netrin receptor UNC5PANTHERPTHR12582NETRIN RECEPTOR UNC5coord: 16..948
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 139..225
score: 12.114
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 300..346
score: 8.118
IPR011029Death-like domain superfamilySUPERFAMILYSSF47986DEATH domaincoord: 872..951
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 141..230