Sorting nexin, putative

Overview
NameSorting nexin, putative
Smed IDSMED30021252
Length (bp)641
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sorting nexin, putative (SMED30021252) t-SNE clustered cells

Violin plots show distribution of expression levels for Sorting nexin, putative (SMED30021252) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sorting nexin, putative (SMED30021252) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sorting nexin, putative (SMED30021252) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30021252

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30021252h1SMcG0020913 dd_Smed_v4_1354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30021252h1SMcG0020913 dd_Smed_v4_1354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30021252h1SMcG0020913 dd_Smed_v4_1354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30021252h1SMcG0020913 dd_Smed_v4_1354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30021252h1SMcG0020913 dd_Smed_v4_1354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021252h1SMcG0020913 Contig54178uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30021252h1SMcG0020913 Contig54178newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sorting nexin, putative vs. Ensembl Human
Match: SNX12 (sorting nexin 12 [Source:HGNC Symbol;Acc:HGNC:14976])

HSP 1 Score: 242.276 bits (617), Expect = 6.922e-82
Identity = 110/157 (70.06%), Postives = 134/157 (85.35%), Query Frame = 2
Query:   77 ASSVTSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVK 547
            A + T RL+SK Q + DAY PP+NFLEID+ N QT G+G+AR+T YEVR+ TNLP+FKLK+S VRRRYSDFEWL+ ELERDSKI+VP LP KA  RQLPFRGD GIF++ FIEERR+GLE+FINK+AGHPLAQNE+CLH+FLQ + ID+ Y+PGKV+
Sbjct:    5 AVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVR 161          
BLAST of Sorting nexin, putative vs. Ensembl Human
Match: SNX12 (sorting nexin 12 [Source:HGNC Symbol;Acc:HGNC:14976])

HSP 1 Score: 242.276 bits (617), Expect = 6.922e-82
Identity = 110/157 (70.06%), Postives = 134/157 (85.35%), Query Frame = 2
Query:   77 ASSVTSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVK 547
            A + T RL+SK Q + DAY PP+NFLEID+ N QT G+G+AR+T YEVR+ TNLP+FKLK+S VRRRYSDFEWL+ ELERDSKI+VP LP KA  RQLPFRGD GIF++ FIEERR+GLE+FINK+AGHPLAQNE+CLH+FLQ + ID+ Y+PGKV+
Sbjct:    5 AVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVR 161          
BLAST of Sorting nexin, putative vs. Ensembl Human
Match: SNX3 (sorting nexin 3 [Source:HGNC Symbol;Acc:HGNC:11174])

HSP 1 Score: 241.121 bits (614), Expect = 1.958e-81
Identity = 110/161 (68.32%), Postives = 136/161 (84.47%), Query Frame = 2
Query:   74 MASSV--TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVKN 550
            MA +V  T RL +K Q + DAY PP+NFLEIDV N QT G+G+ R+T YE+R+ TNLP+FKLK+S+VRRRYSDFEWLR ELER+SK++VP LP KA+ RQLPFRGD+GIFDD FIEER++GLE+FINKVAGHPLAQNE+CLH+FLQ + IDK Y P K+++
Sbjct:    1 MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIFKLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIRH 161          
BLAST of Sorting nexin, putative vs. Ensembl Human
Match: SNX12 (sorting nexin 12 [Source:HGNC Symbol;Acc:HGNC:14976])

HSP 1 Score: 238.81 bits (608), Expect = 2.287e-80
Identity = 109/155 (70.32%), Postives = 132/155 (85.16%), Query Frame = 2
Query:   77 ASSVTSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGK 541
            A + T RL+SK Q + DAY PP+NFLEID+ N QT G+G+AR+T YEVR+ TNLP+FKLK+S VRRRYSDFEWL+ ELERDSKI+VP LP KA  RQLPFRGD GIF++ FIEERR+GLE+FINK+AGHPLAQNE+CLH+FLQ + ID+ Y+PGK
Sbjct:    5 AVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGK 159          
BLAST of Sorting nexin, putative vs. Ensembl Human
Match: SNX12 (sorting nexin 12 [Source:HGNC Symbol;Acc:HGNC:14976])

HSP 1 Score: 232.261 bits (591), Expect = 6.636e-78
Identity = 108/157 (68.79%), Postives = 131/157 (83.44%), Query Frame = 2
Query:   77 ASSVTSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVK 547
            A + T RL+SK Q + DAY PP+NFLEID+ N QT G+G+AR+T YE    TNLP+FKLK+S VRRRYSDFEWL+ ELERDSKI+VP LP KA  RQLPFRGD GIF++ FIEERR+GLE+FINK+AGHPLAQNE+CLH+FLQ + ID+ Y+PGKV+
Sbjct:    5 AVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYE----TNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVR 157          
BLAST of Sorting nexin, putative vs. Ensembl Celegans
Match: snx-3 (Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9XW41])

HSP 1 Score: 248.054 bits (632), Expect = 1.293e-84
Identity = 112/158 (70.89%), Postives = 135/158 (85.44%), Query Frame = 2
Query:   77 ASSVTSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVKN 550
             +S T R+ SKRQT+++AY+PPANFLEI+V N  THG+GK RYTDYE+R+ +NLPVFK K+SSVRRRYSDFEW+R ELERDSKI+VPTLP K++ RQLPFR D+GIF++EFIE RRK LE FINKVAGHPLAQNE+ LHIFLQ   IDK Y+PGK++ 
Sbjct:    4 GASATQRIPSKRQTLDEAYAPPANFLEIEVINPITHGVGKMRYTDYEIRMRSNLPVFKQKESSVRRRYSDFEWVRAELERDSKIVVPTLPGKSFKRQLPFRSDDGIFEEEFIENRRKALELFINKVAGHPLAQNERSLHIFLQEPTIDKNYVPGKIRT 161          
BLAST of Sorting nexin, putative vs. Ensembl Celegans
Match: lst-4 (Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4E2])

HSP 1 Score: 47.3654 bits (111), Expect = 2.343e-6
Identity = 29/91 (31.87%), Postives = 48/91 (52.75%), Query Frame = 2
Query:  251 LKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHP-LAQNEKCLHIFLQSDEID 520
            L    V RRY  F+WL  +L     +++P  P       LP +   G ++++ I+ R+  L+ ++NK+  HP L+Q+E  LH    +DE D
Sbjct:   43 LTNIQVSRRYKHFDWLHEQLSAKY-VLIPIPP-------LPEKQVAGRYEEDLIDHRKHILQLWVNKICRHPVLSQSEVWLHFISCTDEKD 125          
BLAST of Sorting nexin, putative vs. Ensembl Celegans
Match: lst-4 (Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4E2])

HSP 1 Score: 47.3654 bits (111), Expect = 2.343e-6
Identity = 29/91 (31.87%), Postives = 48/91 (52.75%), Query Frame = 2
Query:  251 LKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHP-LAQNEKCLHIFLQSDEID 520
            L    V RRY  F+WL  +L     +++P  P       LP +   G ++++ I+ R+  L+ ++NK+  HP L+Q+E  LH    +DE D
Sbjct:   43 LTNIQVSRRYKHFDWLHEQLSAKY-VLIPIPP-------LPEKQVAGRYEEDLIDHRKHILQLWVNKICRHPVLSQSEVWLHFISCTDEKD 125          
BLAST of Sorting nexin, putative vs. Ensembl Celegans
Match: lst-4 (Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4E2])

HSP 1 Score: 47.3654 bits (111), Expect = 2.343e-6
Identity = 29/91 (31.87%), Postives = 48/91 (52.75%), Query Frame = 2
Query:  251 LKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHP-LAQNEKCLHIFLQSDEID 520
            L    V RRY  F+WL  +L     +++P  P       LP +   G ++++ I+ R+  L+ ++NK+  HP L+Q+E  LH    +DE D
Sbjct:   43 LTNIQVSRRYKHFDWLHEQLSAKY-VLIPIPP-------LPEKQVAGRYEEDLIDHRKHILQLWVNKICRHPVLSQSEVWLHFISCTDEKD 125          
BLAST of Sorting nexin, putative vs. Ensembl Celegans
Match: lst-4 (Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;Acc:Q8I4E2])

HSP 1 Score: 47.3654 bits (111), Expect = 2.416e-6
Identity = 28/86 (32.56%), Postives = 47/86 (54.65%), Query Frame = 2
Query:  266 VRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHP-LAQNEKCLHIFLQSDEID 520
            V RRY  F+WL  +L     +++P  P       LP +   G ++++ I+ R+  L+ ++NK+  HP L+Q+E  LH    +DE D
Sbjct:   50 VSRRYKHFDWLHEQLSAKY-VLIPIPP-------LPEKQVAGRYEEDLIDHRKHILQLWVNKICRHPVLSQSEVWLHFISCTDEKD 127          
BLAST of Sorting nexin, putative vs. Ensembl Fly
Match: Snx3 (gene:FBgn0038065 transcript:FBtr0082641)

HSP 1 Score: 249.595 bits (636), Expect = 4.888e-85
Identity = 115/159 (72.33%), Postives = 134/159 (84.28%), Query Frame = 2
Query:   77 ASSVTSRLDSKRQTIEDAYSPPANFLEIDVCNS-QTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVKN 550
             +  T RL+ K+QT++DAY+ PANFLEIDV N   T   GK RYTDYEVR+ TNLPVFK+K+SSVRRRYSDFEWLR ELERDSKI+VP LP KAW RQ+PFRGD GIFD+ FIEERRKGLE FINK+AGHPLAQNE+CLH+FLQ + IDK Y+PGK++N
Sbjct:    8 TADATRRLNVKKQTLDDAYAVPANFLEIDVVNPLTTMAAGKKRYTDYEVRMRTNLPVFKVKESSVRRRYSDFEWLRNELERDSKIVVPPLPGKAWKRQMPFRGDEGIFDESFIEERRKGLEAFINKIAGHPLAQNERCLHMFLQENVIDKNYVPGKIRN 166          
BLAST of Sorting nexin, putative vs. Ensembl Fly
Match: Snx3 (gene:FBgn0038065 transcript:FBtr0082642)

HSP 1 Score: 249.595 bits (636), Expect = 4.888e-85
Identity = 115/159 (72.33%), Postives = 134/159 (84.28%), Query Frame = 2
Query:   77 ASSVTSRLDSKRQTIEDAYSPPANFLEIDVCNS-QTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVKN 550
             +  T RL+ K+QT++DAY+ PANFLEIDV N   T   GK RYTDYEVR+ TNLPVFK+K+SSVRRRYSDFEWLR ELERDSKI+VP LP KAW RQ+PFRGD GIFD+ FIEERRKGLE FINK+AGHPLAQNE+CLH+FLQ + IDK Y+PGK++N
Sbjct:    8 TADATRRLNVKKQTLDDAYAVPANFLEIDVVNPLTTMAAGKKRYTDYEVRMRTNLPVFKVKESSVRRRYSDFEWLRNELERDSKIVVPPLPGKAWKRQMPFRGDEGIFDESFIEERRKGLEAFINKIAGHPLAQNERCLHMFLQENVIDKNYVPGKIRN 166          
BLAST of Sorting nexin, putative vs. Ensembl Fly
Match: Snx1 (gene:FBgn0031534 transcript:FBtr0343238)

HSP 1 Score: 58.151 bits (139), Expect = 9.686e-10
Identity = 43/137 (31.39%), Postives = 66/137 (48.18%), Query Frame = 2
Query:  149 FLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDF---------EWLRLELERDSKIIVPTLPSK-----AWTRQLPFRGDNGI-FDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDE 514
            F+ I V + Q  G G   Y  Y+V   TN+P FK  + S  RR+SDF         +++RL        I+P  PSK        +  P + + G     E++E RR  LE F+++ A HP+ + +     FL+SD+
Sbjct:   74 FISIVVSDPQKIGDGMGSYLAYKVTTKTNIPKFKRSEFSTLRRFSDFLGIHDLLVGKYMRL------GRIIPPAPSKNIIGSTKVKISPQQSEPGTPMTQEWVEIRRAALERFVHRTAQHPVLRVDLDFMNFLESDQ 204          
BLAST of Sorting nexin, putative vs. Ensembl Fly
Match: Snx1 (gene:FBgn0031534 transcript:FBtr0077517)

HSP 1 Score: 58.151 bits (139), Expect = 9.887e-10
Identity = 43/137 (31.39%), Postives = 66/137 (48.18%), Query Frame = 2
Query:  149 FLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDF---------EWLRLELERDSKIIVPTLPSK-----AWTRQLPFRGDNGI-FDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDE 514
            F+ I V + Q  G G   Y  Y+V   TN+P FK  + S  RR+SDF         +++RL        I+P  PSK        +  P + + G     E++E RR  LE F+++ A HP+ + +     FL+SD+
Sbjct:   74 FISIVVSDPQKIGDGMGSYLAYKVTTKTNIPKFKRSEFSTLRRFSDFLGIHDLLVGKYMRL------GRIIPPAPSKNIIGSTKVKISPQQSEPGTPMTQEWVEIRRAALERFVHRTAQHPVLRVDLDFMNFLESDQ 204          
BLAST of Sorting nexin, putative vs. Ensembl Fly
Match: SH3PX1 (gene:FBgn0040475 transcript:FBtr0076413)

HSP 1 Score: 46.595 bits (109), Expect = 7.059e-6
Identity = 27/80 (33.75%), Postives = 43/80 (53.75%), Query Frame = 2
Query:  263 SVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFL 502
            SV RRY  F+WL   L  D   ++P  P       LP +  +G ++++F+E RR  L+EF++ V  HP+    +  + FL
Sbjct:  251 SVSRRYKHFDWLHERL-VDKFCLIPVPP-------LPDKQISGRYEEQFVEHRRVQLQEFVDWVCRHPVISKCEVWYHFL 322          
BLAST of Sorting nexin, putative vs. Ensembl Zebrafish
Match: snx12 (sorting nexin 12 [Source:ZFIN;Acc:ZDB-GENE-040426-787])

HSP 1 Score: 236.884 bits (603), Expect = 7.143e-80
Identity = 108/153 (70.59%), Postives = 130/153 (84.97%), Query Frame = 2
Query:   89 TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVK 547
            T RL+SK Q + DAY PP+NFLEIDV + QT G+G+ R+T YEVR+ TNLP+FKLK+S VRRRYSDFEWL+ ELERDSKI+VP LP KA  RQLPFRGD GIF++ FIEERR GLE+FIN++AGHPLAQNE+CLH+FLQ + ID+ YIPGKV+
Sbjct:    9 TRRLNSKPQDLTDAYGPPSNFLEIDVYDPQTIGVGRNRFTTYEVRMRTNLPIFKLKESVVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRAGLEQFINRIAGHPLAQNERCLHMFLQDESIDRNYIPGKVR 161          
BLAST of Sorting nexin, putative vs. Ensembl Zebrafish
Match: snx12 (sorting nexin 12 [Source:ZFIN;Acc:ZDB-GENE-040426-787])

HSP 1 Score: 235.728 bits (600), Expect = 1.769e-79
Identity = 108/152 (71.05%), Postives = 129/152 (84.87%), Query Frame = 2
Query:   89 TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKV 544
            T RL+SK Q + DAY PP+NFLEIDV + QT G+G+ R+T YEVR+ TNLP+FKLK+S VRRRYSDFEWL+ ELERDSKI+VP LP KA  RQLPFRGD GIF++ FIEERR GLE+FIN++AGHPLAQNE+CLH+FLQ + ID+ YIPGKV
Sbjct:    9 TRRLNSKPQDLTDAYGPPSNFLEIDVYDPQTIGVGRNRFTTYEVRMRTNLPIFKLKESVVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRAGLEQFINRIAGHPLAQNERCLHMFLQDESIDRNYIPGKV 160          
BLAST of Sorting nexin, putative vs. Ensembl Zebrafish
Match: snx3 (sorting nexin 3 [Source:ZFIN;Acc:ZDB-GENE-030131-921])

HSP 1 Score: 235.343 bits (599), Expect = 2.433e-79
Identity = 107/160 (66.88%), Postives = 133/160 (83.12%), Query Frame = 2
Query:   74 MASSV--TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVK 547
            MA ++  T RL +K Q + DAY PP+NFLEIDV N +T G+G+ R+T YE++L TNLP+FKLK+S VRRRYSDFEWLR ELER+SK++VP LP KA  RQLPFRGD+GIFDD FIEERR+GLE+F+NKVAGHPLAQNE+CLH+FLQ + +DK Y P K++
Sbjct:    1 MAEAIADTRRLYTKPQNLNDAYGPPSNFLEIDVTNPETVGVGRNRFTTYEIKLKTNLPIFKLKESRVRRRYSDFEWLRGELERESKVVVPPLPGKALFRQLPFRGDDGIFDDSFIEERRQGLEQFLNKVAGHPLAQNERCLHMFLQDESVDKNYTPSKIR 160          
BLAST of Sorting nexin, putative vs. Ensembl Zebrafish
Match: snx12 (sorting nexin 12 [Source:ZFIN;Acc:ZDB-GENE-040426-787])

HSP 1 Score: 234.958 bits (598), Expect = 1.129e-77
Identity = 108/152 (71.05%), Postives = 129/152 (84.87%), Query Frame = 2
Query:   89 TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKV 544
            T RL+SK Q + DAY PP+NFLEIDV + QT G+G+ R+T YEVR+ TNLP+FKLK+S VRRRYSDFEWL+ ELERDSKI+VP LP KA  RQLPFRGD GIF++ FIEERR GLE+FIN++AGHPLAQNE+CLH+FLQ + ID+ YIPGKV
Sbjct:    9 TRRLNSKPQDLTDAYGPPSNFLEIDVYDPQTIGVGRNRFTTYEVRMRTNLPIFKLKESVVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRAGLEQFINRIAGHPLAQNERCLHMFLQDESIDRNYIPGKV 160          
BLAST of Sorting nexin, putative vs. Ensembl Zebrafish
Match: snx12 (sorting nexin 12 [Source:ZFIN;Acc:ZDB-GENE-040426-787])

HSP 1 Score: 234.958 bits (598), Expect = 1.686e-77
Identity = 108/152 (71.05%), Postives = 129/152 (84.87%), Query Frame = 2
Query:   89 TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKV 544
            T RL+SK Q + DAY PP+NFLEIDV + QT G+G+ R+T YEVR+ TNLP+FKLK+S VRRRYSDFEWL+ ELERDSKI+VP LP KA  RQLPFRGD GIF++ FIEERR GLE+FIN++AGHPLAQNE+CLH+FLQ + ID+ YIPGKV
Sbjct:    9 TRRLNSKPQDLTDAYGPPSNFLEIDVYDPQTIGVGRNRFTTYEVRMRTNLPIFKLKESVVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRAGLEQFINRIAGHPLAQNERCLHMFLQDESIDRNYIPGKV 160          
BLAST of Sorting nexin, putative vs. Ensembl Xenopus
Match: snx3 (sorting nexin 3 [Source:NCBI gene;Acc:394626])

HSP 1 Score: 239.195 bits (609), Expect = 1.104e-80
Identity = 111/161 (68.94%), Postives = 134/161 (83.23%), Query Frame = 2
Query:   74 MASSV--TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVKN 550
            MA +V  T RL SK Q + DAY PP+NFLEIDV N QT G+G+ RYT YEVRL TNLP+FKLK+S VRRRYSDFEWL+ ELER+SK++VP LP KA+ RQLPFRGD GI+DD FIEER++GLE+FINKVAGHPLAQNE+CLH+FLQ + +DK Y P K+++
Sbjct:    1 MADTVADTRRLLSKPQNLNDAYGPPSNFLEIDVSNPQTIGVGRGRYTTYEVRLKTNLPIFKLKESCVRRRYSDFEWLKSELERESKVVVPPLPGKAFFRQLPFRGDEGIYDDSFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEILDKNYTPSKIRH 161          
BLAST of Sorting nexin, putative vs. Ensembl Xenopus
Match: snx12 (sorting nexin 12 [Source:NCBI gene;Acc:548507])

HSP 1 Score: 236.884 bits (603), Expect = 1.164e-79
Identity = 108/152 (71.05%), Postives = 129/152 (84.87%), Query Frame = 2
Query:   89 TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKV 544
            T RL+SK Q + DAY PP+NFLEID+ N QT G+G+ RYT YEVR+ TNLP+FKLK S VRRRYSDFEWL+ ELERDSKI+VP LP KA  RQLPFRGD GIF++ FIEER++GLE+FINK+AGHPLAQNE+CLH+FLQ + ID+ Y+PGKV
Sbjct:    9 TRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRNRYTVYEVRMRTNLPIFKLKDSCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERKQGLEQFINKIAGHPLAQNERCLHMFLQDETIDRNYVPGKV 160          
BLAST of Sorting nexin, putative vs. Ensembl Xenopus
Match: snx12 (sorting nexin 12 [Source:NCBI gene;Acc:548507])

HSP 1 Score: 238.424 bits (607), Expect = 2.340e-79
Identity = 108/153 (70.59%), Postives = 130/153 (84.97%), Query Frame = 2
Query:   89 TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVK 547
            T RL+SK Q + DAY PP+NFLEID+ N QT G+G+ RYT YEVR+ TNLP+FKLK S VRRRYSDFEWL+ ELERDSKI+VP LP KA  RQLPFRGD GIF++ FIEER++GLE+FINK+AGHPLAQNE+CLH+FLQ + ID+ Y+PGKV+
Sbjct:   84 TRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRNRYTVYEVRMRTNLPIFKLKDSCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERKQGLEQFINKIAGHPLAQNERCLHMFLQDETIDRNYVPGKVR 236          
BLAST of Sorting nexin, putative vs. Ensembl Xenopus
Match: snx11 (sorting nexin 11 [Source:NCBI gene;Acc:100145709])

HSP 1 Score: 84.7297 bits (208), Expect = 3.276e-20
Identity = 49/122 (40.16%), Postives = 74/122 (60.66%), Query Frame = 2
Query:  149 FLEIDVCNSQTHGIGK-ARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKII-VPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQS 508
            F+ I V + +    G  A Y DY++ L TN   F  K S VRRRY +F+WLR  L+++S ++ VP LP K     LPF   N   +D+FIE RR+GL++F+ ++  + +  ++  LH+FLQS
Sbjct:   11 FITIRVQDPRLQNEGSWASYVDYKIFLHTNSKAFTAKTSCVRRRYREFDWLRKRLQKNSGLVPVPALPGK-----LPFLVGN---NDDFIERRRQGLQQFLEQIVQNMVLLSDSQLHLFLQS 124          
BLAST of Sorting nexin, putative vs. Ensembl Xenopus
Match: sars2 (seryl-tRNA synthetase 2, mitochondrial [Source:Xenbase;Acc:XB-GENE-969286])

HSP 1 Score: 68.1662 bits (165), Expect = 6.076e-14
Identity = 42/111 (37.84%), Postives = 66/111 (59.46%), Query Frame = 2
Query:  203 YTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKII-VPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQ----SDEID 520
            Y DYE+ + TN   F LK S VRRR+ +F WLR +L+ ++ +  +P LP +     +PF     I + + +E R +GL+EF+NKV    +  ++  LH+FLQ    ++EID
Sbjct:   24 YVDYEICVHTNSMCFTLKTSCVRRRFREFVWLRQKLQSNAVLTQLPELPPR-----IPF---FKISNSQNLEHRVRGLQEFLNKVLHCSVLLSDSRLHLFLQTQLSTEEID 126          
BLAST of Sorting nexin, putative vs. Ensembl Mouse
Match: Snx12 (sorting nexin 12 [Source:MGI Symbol;Acc:MGI:1919331])

HSP 1 Score: 242.276 bits (617), Expect = 4.752e-82
Identity = 110/157 (70.06%), Postives = 134/157 (85.35%), Query Frame = 2
Query:   77 ASSVTSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVK 547
            A + T RL+SK Q + DAY PP+NFLEID+ N QT G+G+AR+T YEVR+ TNLP+FKLK+S VRRRYSDFEWL+ ELERDSKI+VP LP KA  RQLPFRGD GIF++ FIEERR+GLE+FINK+AGHPLAQNE+CLH+FLQ + ID+ Y+PGKV+
Sbjct:    5 AVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVR 161          
BLAST of Sorting nexin, putative vs. Ensembl Mouse
Match: Snx3 (sorting nexin 3 [Source:MGI Symbol;Acc:MGI:1860188])

HSP 1 Score: 241.121 bits (614), Expect = 1.344e-81
Identity = 110/161 (68.32%), Postives = 136/161 (84.47%), Query Frame = 2
Query:   74 MASSV--TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVKN 550
            MA +V  T RL +K Q + DAY PP+NFLEIDV N QT G+G+ R+T YE+R+ TNLP+FKLK+S+VRRRYSDFEWLR ELER+SK++VP LP KA+ RQLPFRGD+GIFDD FIEER++GLE+FINKVAGHPLAQNE+CLH+FLQ + IDK Y P K+++
Sbjct:    1 MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIFKLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIRH 161          
BLAST of Sorting nexin, putative vs. Ensembl Mouse
Match: Snx12 (sorting nexin 12 [Source:MGI Symbol;Acc:MGI:1919331])

HSP 1 Score: 241.121 bits (614), Expect = 1.734e-81
Identity = 110/156 (70.51%), Postives = 133/156 (85.26%), Query Frame = 2
Query:   77 ASSVTSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKV 544
            A + T RL+SK Q + DAY PP+NFLEID+ N QT G+G+AR+T YEVR+ TNLP+FKLK+S VRRRYSDFEWL+ ELERDSKI+VP LP KA  RQLPFRGD GIF++ FIEERR+GLE+FINK+AGHPLAQNE+CLH+FLQ + ID+ Y+PGKV
Sbjct:    5 AVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKV 160          
BLAST of Sorting nexin, putative vs. Ensembl Mouse
Match: Snx12 (sorting nexin 12 [Source:MGI Symbol;Acc:MGI:1919331])

HSP 1 Score: 240.736 bits (613), Expect = 2.236e-81
Identity = 110/156 (70.51%), Postives = 133/156 (85.26%), Query Frame = 2
Query:   77 ASSVTSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKV 544
            A + T RL+SK Q + DAY PP+NFLEID+ N QT G+G+AR+T YEVR+ TNLP+FKLK+S VRRRYSDFEWL+ ELERDSKI+VP LP KA  RQLPFRGD GIF++ FIEERR+GLE+FINK+AGHPLAQNE+CLH+FLQ + ID+ Y+PGKV
Sbjct:    5 AVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKV 160          
BLAST of Sorting nexin, putative vs. Ensembl Mouse
Match: Snx3 (sorting nexin 3 [Source:MGI Symbol;Acc:MGI:1860188])

HSP 1 Score: 201.445 bits (511), Expect = 3.475e-66
Identity = 99/161 (61.49%), Postives = 120/161 (74.53%), Query Frame = 2
Query:   74 MASSV--TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVKN 550
            MA +V  T RL +K Q + DAY PP+NFLEID                      TNLP+FKLK+S+VRRRYSDFEWLR ELER+SK++VP LP KA+ RQLPFRGD+GIFDD FIEER++GLE+FINKVAGHPLAQNE+CLH+FLQ + IDK Y P K+++
Sbjct:    1 MAETVADTRRLITKPQNLNDAYGPPSNFLEID----------------------TNLPIFKLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIRH 139          
BLAST of Sorting nexin, putative vs. UniProt/SwissProt
Match: sp|Q9UMY4|SNX12_HUMAN (Sorting nexin-12 OS=Homo sapiens OX=9606 GN=SNX12 PE=1 SV=4)

HSP 1 Score: 242.276 bits (617), Expect = 3.324e-81
Identity = 110/157 (70.06%), Postives = 134/157 (85.35%), Query Frame = 2
Query:   77 ASSVTSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVK 547
            A + T RL+SK Q + DAY PP+NFLEID+ N QT G+G+AR+T YEVR+ TNLP+FKLK+S VRRRYSDFEWL+ ELERDSKI+VP LP KA  RQLPFRGD GIF++ FIEERR+GLE+FINK+AGHPLAQNE+CLH+FLQ + ID+ Y+PGKV+
Sbjct:    5 AVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKVR 161          
BLAST of Sorting nexin, putative vs. UniProt/SwissProt
Match: sp|Q5U211|SNX3_RAT (Sorting nexin-3 OS=Rattus norvegicus OX=10116 GN=Snx3 PE=1 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 9.402e-81
Identity = 110/161 (68.32%), Postives = 136/161 (84.47%), Query Frame = 2
Query:   74 MASSV--TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVKN 550
            MA +V  T RL +K Q + DAY PP+NFLEIDV N QT G+G+ R+T YE+R+ TNLP+FKLK+S+VRRRYSDFEWLR ELER+SK++VP LP KA+ RQLPFRGD+GIFDD FIEER++GLE+FINKVAGHPLAQNE+CLH+FLQ + IDK Y P K+++
Sbjct:    1 MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIFKLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIRH 161          
BLAST of Sorting nexin, putative vs. UniProt/SwissProt
Match: sp|Q5R5V1|SNX3_PONAB (Sorting nexin-3 OS=Pongo abelii OX=9601 GN=SNX3 PE=2 SV=3)

HSP 1 Score: 241.121 bits (614), Expect = 9.402e-81
Identity = 110/161 (68.32%), Postives = 136/161 (84.47%), Query Frame = 2
Query:   74 MASSV--TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVKN 550
            MA +V  T RL +K Q + DAY PP+NFLEIDV N QT G+G+ R+T YE+R+ TNLP+FKLK+S+VRRRYSDFEWLR ELER+SK++VP LP KA+ RQLPFRGD+GIFDD FIEER++GLE+FINKVAGHPLAQNE+CLH+FLQ + IDK Y P K+++
Sbjct:    1 MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIFKLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIRH 161          
BLAST of Sorting nexin, putative vs. UniProt/SwissProt
Match: sp|O60493|SNX3_HUMAN (Sorting nexin-3 OS=Homo sapiens OX=9606 GN=SNX3 PE=1 SV=3)

HSP 1 Score: 241.121 bits (614), Expect = 9.402e-81
Identity = 110/161 (68.32%), Postives = 136/161 (84.47%), Query Frame = 2
Query:   74 MASSV--TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVKN 550
            MA +V  T RL +K Q + DAY PP+NFLEIDV N QT G+G+ R+T YE+R+ TNLP+FKLK+S+VRRRYSDFEWLR ELER+SK++VP LP KA+ RQLPFRGD+GIFDD FIEER++GLE+FINKVAGHPLAQNE+CLH+FLQ + IDK Y P K+++
Sbjct:    1 MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIFKLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIRH 161          
BLAST of Sorting nexin, putative vs. UniProt/SwissProt
Match: sp|Q1RMH8|SNX3_BOVIN (Sorting nexin-3 OS=Bos taurus OX=9913 GN=SNX3 PE=2 SV=3)

HSP 1 Score: 241.121 bits (614), Expect = 9.402e-81
Identity = 110/161 (68.32%), Postives = 136/161 (84.47%), Query Frame = 2
Query:   74 MASSV--TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVKN 550
            MA +V  T RL +K Q + DAY PP+NFLEIDV N QT G+G+ R+T YE+R+ TNLP+FKLK+S+VRRRYSDFEWLR ELER+SK++VP LP KA+ RQLPFRGD+GIFDD FIEER++GLE+FINKVAGHPLAQNE+CLH+FLQ + IDK Y P K+++
Sbjct:    1 MAETVADTRRLITKPQNLNDAYGPPSNFLEIDVSNPQTVGVGRGRFTTYEIRVKTNLPIFKLKESTVRRRYSDFEWLRSELERESKVVVPPLPGKAFLRQLPFRGDDGIFDDNFIEERKQGLEQFINKVAGHPLAQNERCLHMFLQDEIIDKSYTPSKIRH 161          
BLAST of Sorting nexin, putative vs. TrEMBL
Match: A0A210PRS6 (Sorting nexin-12 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT07157 PE=4 SV=1)

HSP 1 Score: 267.7 bits (683), Expect = 1.061e-88
Identity = 118/160 (73.75%), Postives = 142/160 (88.75%), Query Frame = 2
Query:   71 IMASSVTSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVKN 550
            + A   T+R+ +K+QT+EDAYSPPANFLEID+ + QTHG+ K RYTDYEVR+ TNLPVFK+K+SSVRRRYSDFEWLR ELERDSKI+VP +P KAW RQLPFRGD+GIF+DEFIE+RRKGLE+F+NKVAGHPLAQNE+CLH+FLQ   IDK Y+PGK++N
Sbjct:    1 MTAQPATARITTKKQTLEDAYSPPANFLEIDILDPQTHGVDKKRYTDYEVRMRTNLPVFKVKESSVRRRYSDFEWLRSELERDSKIVVPAMPGKAWKRQLPFRGDDGIFEDEFIEDRRKGLEQFVNKVAGHPLAQNERCLHMFLQEPVIDKNYVPGKIRN 160          
BLAST of Sorting nexin, putative vs. TrEMBL
Match: A0A1S3JL77 (sorting nexin-12 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106173886 PE=4 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 8.788e-88
Identity = 120/160 (75.00%), Postives = 140/160 (87.50%), Query Frame = 2
Query:   71 IMASSVTSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVKN 550
            +     T+R+ SK+QT+EDAYSPPANFLEIDV N++THGIGK R+TDYEVR+ TNLPVFK+K+SS RRRYSDFEWLR ELERDSKI+VP LP KA  RQLPFRGD+GIF+DEFIEERRKGLE+F+NKVAGHPLAQNE+CLH+FLQ   IDK Y+PGKV+ 
Sbjct:    1 MAGVGATARIQSKKQTLEDAYSPPANFLEIDVLNAETHGIGKKRFTDYEVRMRTNLPVFKMKESSTRRRYSDFEWLRNELERDSKIVVPPLPGKALKRQLPFRGDDGIFEDEFIEERRKGLEQFVNKVAGHPLAQNERCLHMFLQEPMIDKNYVPGKVRT 160          
BLAST of Sorting nexin, putative vs. TrEMBL
Match: A0A2C9K4J5 (PX domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106050935 PE=4 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 9.805e-88
Identity = 121/160 (75.62%), Postives = 140/160 (87.50%), Query Frame = 2
Query:   71 IMASSVTSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVKN 550
            +   + T+R+ SK+QT+EDAYSPPANFLEIDV + QTHG+ K RYTDYEVR+ TNLPVFKLK+SSVRRRYSDFEWLR ELERDSKI+VP LP KA  RQLPFRGD+GIF+DEFIE+RRKGLE+FINKVAGHPLAQNEKCLH+FLQ   IDK Y+PGK++ 
Sbjct:    1 MTTPTATARITSKKQTLEDAYSPPANFLEIDVSDPQTHGVAKKRYTDYEVRMKTNLPVFKLKESSVRRRYSDFEWLRNELERDSKIVVPPLPGKALKRQLPFRGDDGIFEDEFIEDRRKGLEQFINKVAGHPLAQNEKCLHMFLQEPVIDKNYVPGKIRT 160          
BLAST of Sorting nexin, putative vs. TrEMBL
Match: A0A267FN58 (PX domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000019g3 PE=4 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 1.654e-87
Identity = 124/155 (80.00%), Postives = 135/155 (87.10%), Query Frame = 2
Query:   83 SVTSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVK 547
            S T RL  K+QT+EDAYSPPANFLEIDVCN +THG+ K RYTDYE+RL TNLPVFKLK+SSVRRRYSDFEWLR ELERDSKI+VP LP KA   QLPFRG +G FDDEFIEERRKGLEEFINKVAGHPLAQNEKCLH+FLQ   IDK Y+PGKV+
Sbjct:   12 SATQRLQPKKQTMEDAYSPPANFLEIDVCNPETHGLNKDRYTDYEIRLRTNLPVFKLKESSVRRRYSDFEWLRAELERDSKIVVPKLPGKALKLQLPFRGGDGRFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHMFLQEQTIDKAYVPGKVR 166          
BLAST of Sorting nexin, putative vs. TrEMBL
Match: A0A433TSQ3 (PX domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_007639 PE=4 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 2.657e-87
Identity = 119/160 (74.38%), Postives = 140/160 (87.50%), Query Frame = 2
Query:   71 IMASSVTSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVKN 550
            +   + T+R+ SK+QT+EDAYSPPANFLEIDV + QTHG+ K RYTDYEVR+ TNLPVFKLK+S VRRRYSDFEWLR ELERDSKI+VP LP KA+ RQLPFRGD+GIF+DEFIE+RRKGLE+F+NKVAGHPLAQNEKCLH+FLQ   IDK Y+PGK++ 
Sbjct:    1 MTTPTATARISSKKQTLEDAYSPPANFLEIDVSDPQTHGVAKKRYTDYEVRMKTNLPVFKLKESGVRRRYSDFEWLRNELERDSKIVVPPLPGKAFKRQLPFRGDDGIFEDEFIEDRRKGLEQFVNKVAGHPLAQNEKCLHMFLQEPVIDKNYVPGKIRT 160          
BLAST of Sorting nexin, putative vs. Ensembl Cavefish
Match: snx3 (sorting nexin 3 [Source:NCBI gene;Acc:103023214])

HSP 1 Score: 238.81 bits (608), Expect = 8.261e-81
Identity = 110/160 (68.75%), Postives = 134/160 (83.75%), Query Frame = 2
Query:   74 MASSV--TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVK 547
            MA +V  T RL +K Q + DAY PP+NFLEIDV + +T G+G+ R+T YE+RL TNLP+FKLK+SSVRRRYSDFEWLR ELER+SK++VP LP KA  RQLPFRGD+GIFDD FIEERR+GLE+F+NKVAGHPLAQNE+CLH+FLQ + +DK Y P KV+
Sbjct:    1 MADTVADTRRLFTKPQNLSDAYGPPSNFLEIDVGSPETVGVGRGRFTTYEIRLKTNLPIFKLKESSVRRRYSDFEWLRGELERESKVVVPPLPGKALFRQLPFRGDDGIFDDSFIEERRQGLEQFLNKVAGHPLAQNERCLHMFLQDESVDKNYTPSKVR 160          
BLAST of Sorting nexin, putative vs. Ensembl Cavefish
Match: snx12 (sorting nexin 12 [Source:NCBI gene;Acc:103033647])

HSP 1 Score: 234.187 bits (596), Expect = 7.100e-79
Identity = 107/153 (69.93%), Postives = 129/153 (84.31%), Query Frame = 2
Query:   89 TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVK 547
            T RL+SK Q + DAY PP+NFLEIDV + QT G+G+ R+T YEVR+ TNLP+FKLK+S VRRRYSDFEWL+ ELERDSKI+VP LP KA  RQLPFRGD GIF++ FIEERR GLE+FIN++AGHPLAQNE+CLH+FLQ +  D+ YIPGKV+
Sbjct:    9 TRRLNSKPQDLTDAYGPPSNFLEIDVYDPQTIGVGRNRFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRVGLEQFINRIAGHPLAQNERCLHMFLQEESTDRNYIPGKVR 161          
BLAST of Sorting nexin, putative vs. Ensembl Cavefish
Match: snx12 (sorting nexin 12 [Source:NCBI gene;Acc:103033647])

HSP 1 Score: 232.261 bits (591), Expect = 4.093e-78
Identity = 106/152 (69.74%), Postives = 128/152 (84.21%), Query Frame = 2
Query:   89 TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKV 544
            T RL+SK Q + DAY PP+NFLEIDV + QT G+G+ R+T YEVR+ TNLP+FKLK+S VRRRYSDFEWL+ ELERDSKI+VP LP KA  RQLPFRGD GIF++ FIEERR GLE+FIN++AGHPLAQNE+CLH+FLQ +  D+ YIPGK+
Sbjct:    9 TRRLNSKPQDLTDAYGPPSNFLEIDVYDPQTIGVGRNRFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRVGLEQFINRIAGHPLAQNERCLHMFLQEESTDRNYIPGKM 160          
BLAST of Sorting nexin, putative vs. Ensembl Cavefish
Match: snx11 (sorting nexin 11 [Source:ZFIN;Acc:ZDB-GENE-041111-253])

HSP 1 Score: 75.485 bits (184), Expect = 1.934e-16
Identity = 41/103 (39.81%), Postives = 65/103 (63.11%), Query Frame = 2
Query:  203 YTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKII-VPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQS 508
            Y D+++ L TN   F  K S VRRRYS+F WL+ +L++++ ++ VP LP K+      F  +N     +FIE+RRKGL+ F++KV    +  ++  LH+FLQ+
Sbjct:   59 YVDFKIFLHTNSKAFTAKTSCVRRRYSEFVWLKRKLQKNAGLVPVPDLPGKS-----VFAFNNT----DFIEKRRKGLQNFLDKVVHMTVCLSDSQLHLFLQT 152          
BLAST of Sorting nexin, putative vs. Ensembl Cavefish
Match: snx10a (sorting nexin-10A-like [Source:NCBI gene;Acc:103047354])

HSP 1 Score: 69.3218 bits (168), Expect = 2.943e-14
Identity = 41/103 (39.81%), Postives = 59/103 (57.28%), Query Frame = 2
Query:  203 YTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKII-VPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQS 508
            Y DYE+ L TN   F+ K S VRRRYS+F WLR  L+ ++ +I +P LP        PF   N  +    + +R +GL++F+  V   PL  ++  LH+FLQS
Sbjct:   18 YIDYEICLHTNSMCFRKKTSCVRRRYSEFVWLRQRLQDNALLIQLPKLPPAN-----PFFSLNNPYQ---VTQRMQGLQKFLEIVLQMPLLLSDSRLHLFLQS 112          
BLAST of Sorting nexin, putative vs. Ensembl Sea Lamprey
Match: snx3 (sorting nexin 3 [Source:ZFIN;Acc:ZDB-GENE-030131-921])

HSP 1 Score: 180.259 bits (456), Expect = 3.995e-59
Identity = 81/106 (76.42%), Postives = 96/106 (90.57%), Query Frame = 2
Query:  230 TNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVK 547
            TNLP+FKLK+++VRRRYSDFEWL+ ELERDSKI+VP LP KA+TR LPFRGD+GIFDD FI ERR GLE+FINK+AGHPLAQNE+CLH+FLQ + IDK Y+PGKV+
Sbjct:    2 TNLPIFKLKEATVRRRYSDFEWLKNELERDSKIVVPPLPGKAFTRLLPFRGDDGIFDDSFIAERRSGLEQFINKIAGHPLAQNERCLHMFLQDETIDKGYVPGKVR 107          
BLAST of Sorting nexin, putative vs. Ensembl Sea Lamprey
Match: SNX10 (sorting nexin 10 [Source:HGNC Symbol;Acc:HGNC:14974])

HSP 1 Score: 71.633 bits (174), Expect = 2.820e-16
Identity = 48/104 (46.15%), Postives = 61/104 (58.65%), Query Frame = 2
Query:  203 YTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKII--VPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQS 508
            Y  YE+ L TN   F  K S VRRR+S+F WLR ++ +++ +I  VP LP K     L F   N   DDE IEERRKGL+ F+NKV        +  LH+FLQS
Sbjct:   23 YISYEIFLHTNSISFTRKTSRVRRRFSEFVWLRQKMMKNASMIRAVPRLPPK----DLFF---NCWCDDE-IEERRKGLQTFLNKVVEIAPLLADSLLHLFLQS 118          
BLAST of Sorting nexin, putative vs. Ensembl Sea Lamprey
Match: snx1a (sorting nexin 1a [Source:ZFIN;Acc:ZDB-GENE-060302-3])

HSP 1 Score: 67.781 bits (164), Expect = 1.013e-13
Identity = 48/153 (31.37%), Postives = 72/153 (47.06%), Query Frame = 2
Query:   71 IMASSVTSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERD---SKIIVPTLPSKAWTRQLPFR-GDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEI 517
            + A+S        R  IE+  S     L I + N +  G G   Y  Y V  +T+LP+FK K+ +V+RR+SDF  L  +L      S  IVP  P K+       + G +     EF+E RR  LE ++ + + HP    +     FL+ DE+
Sbjct:  142 VPAASKLVSFQRTRDEIEEEESGDTFDLRITITNPEKVGDGMNAYMAYNVTTTTSLPMFKRKEFTVKRRFSDFLGLYEKLTEKFSHSGFIVPPAPEKSVLGMTKVKVGKDDPSSVEFVERRRAALERYLQRTSKHPTLMQDPDFRDFLERDEL 294          
BLAST of Sorting nexin, putative vs. Ensembl Sea Lamprey
Match: snx30 (sorting nexin family member 30 [Source:NCBI gene;Acc:550496])

HSP 1 Score: 65.855 bits (159), Expect = 3.967e-13
Identity = 42/143 (29.37%), Postives = 69/143 (48.25%), Query Frame = 2
Query:   92 SRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKI-IVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEI 517
            + L ++ Q  E+  S P +   + V + + H      Y  Y V + T    +   +  VRRRY DF+WLR +LE      I+P LP K        +G    F ++F+  R+K L++F+N++A HP        H FL + ++
Sbjct:    7 ASLLNRLQLGEETESEPTDLF-VRVDSPEKHVTAMETYITYRVTVRTTRSEYDGMEFVVRRRYQDFDWLRTKLEETQPTHIIPPLPEK-----FVMKGVVDRFTEDFVTTRQKALDKFLNRLANHPTLSFSSYFHSFLTAKDL 143          
BLAST of Sorting nexin, putative vs. Ensembl Sea Lamprey
Match: SNX10 (sorting nexin 10 [Source:HGNC Symbol;Acc:HGNC:14974])

HSP 1 Score: 58.9214 bits (141), Expect = 1.667e-11
Identity = 39/125 (31.20%), Postives = 64/125 (51.20%), Query Frame = 2
Query:  140 PANFLEIDVCNSQTHGIGKAR-YTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKI-IVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQS 508
            P  F+E+ V + Q         + DYE+ L TN   F  K S  RRR+ +F WLR  LE+ + +  +P LP        P       +++  +E RR+GL+ F++++    +  ++  LH+FLQS
Sbjct:    3 PQEFVEVRVRDPQIQNRNSWHPHVDYEIFLHTNSISFTRKVSCTRRRFREFVWLRKCLEKSTNLEQLPDLP--------PGNLFFSCYNENDVEMRRQGLQNFLHRIVKMIVVLSDSRLHLFLQS 119          
BLAST of Sorting nexin, putative vs. Ensembl Yeast
Match: SNX3 (Sorting nexin for late-Golgi enzymes; required to maintain late-Golgi resident enzymes in their proper location by recycling molecules from the prevacuolar compartment; contains a PX domain and sequence similarity to human Snx3p [Source:SGD;Acc:S000005884])

HSP 1 Score: 95.1301 bits (235), Expect = 2.173e-25
Identity = 58/141 (41.13%), Postives = 82/141 (58.16%), Query Frame = 2
Query:  125 DAYSPPANFLEIDVCNSQTH---GI-GKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLR------LELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQN-EKCLHIFLQSDE 514
            + Y+ P NFLEI+V N +TH   G+  K  +TDYE+   TNLP F  + S VRRRYSDFE+ R      + +    K++VP LP K           +  F +E IEERR+GL  ++  VAGHPL Q+  K L  F+++++
Sbjct:   27 EIYAEPENFLEIEVHNPKTHIPNGMDSKGMFTDYEIICRTNLPSFHKRVSKVRRRYSDFEFFRKCLIKEISMLNHPKVMVPHLPGKILL--------SNRFSNEVIEERRQGLNTWMQSVAGHPLLQSGSKVLVRFIEAEK 159          
BLAST of Sorting nexin, putative vs. Ensembl Yeast
Match: VPS5 (Nexin-1 homolog; required for localizing membrane proteins from a prevacuolar/late endosomal compartment back to late Golgi; structural component of retromer membrane coat complex; forms a retromer subcomplex with Vps17p; required for recruiting the retromer complex to the endosome membranes; VPS5 has a paralog, YKR078W, that arose from the whole genome duplication [Source:SGD;Acc:S000005595])

HSP 1 Score: 52.373 bits (124), Expect = 1.332e-8
Identity = 34/115 (29.57%), Postives = 54/115 (46.96%), Query Frame = 2
Query:  188 IGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERD--SKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKE 526
            +G+      E  + +   + +LK + V RRY DF WL  +L+ +   K+I P           P +   G F + FIE RR  +E  + K+   P+ Q +K   +FL SD+   E
Sbjct:  291 VGELTSIHVEYTVISESSLLELKYAQVSRRYRDFRWLYRQLQNNHWGKVIPPP----------PEKQSVGSFKENFIENRRFQMESMLKKICQDPVLQKDKDFLLFLTSDDFSSE 395          
BLAST of Sorting nexin, putative vs. Ensembl Yeast
Match: MVP1 (Protein required for sorting proteins to the vacuole; Mvp1p and Vps1p act in concert to promote membrane traffic to the vacuole; participates in transcription initiation and/or early elongation of specific genes; interacts with "foot domain" of RNA polymerase II; deletion results in abnormal CTD-Ser5 phosphorylation of RNA polymerase II at specific promoter regions; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004606])

HSP 1 Score: 47.7506 bits (112), Expect = 3.677e-7
Identity = 32/81 (39.51%), Postives = 43/81 (53.09%), Query Frame = 2
Query:  263 SVRRRYSDFEWLR-LELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFL 502
            +V RRYSDF WLR + L+R    ++P LP        P R  +   D  F+++RR GL  FIN V  HP   N+  +  FL
Sbjct:  168 TVVRRYSDFLWLREILLKRYPFRMIPELP--------PKRIGSQNADQLFLKKRRIGLSRFINLVMKHPKLSNDDLVLTFL 240          
BLAST of Sorting nexin, putative vs. Ensembl Nematostella
Match: EDO38324 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD93])

HSP 1 Score: 249.595 bits (636), Expect = 1.967e-85
Identity = 114/154 (74.03%), Postives = 134/154 (87.01%), Query Frame = 2
Query:   89 TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVKN 550
            T RL+ K+Q ++DAY+ PANFLEIDV N +THG+GK RYTDYE+R+ TNLPVFK K+SSVRRRYSDFEWLR ELERDSKI+VP LP KA  R LPFRGD+GIF+DEFIE+RR+GLE FIN+VAGHPLAQNEKCLH+FLQ   IDK Y+PGKV++
Sbjct:   14 TKRLEFKKQNLDDAYAAPANFLEIDVVNPETHGVGKKRYTDYELRMRTNLPVFKQKESSVRRRYSDFEWLRSELERDSKIVVPALPGKALKRMLPFRGDDGIFEDEFIEDRRQGLEAFINRVAGHPLAQNEKCLHMFLQEPMIDKNYVPGKVRS 167          
BLAST of Sorting nexin, putative vs. Ensembl Nematostella
Match: EDO34587 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNW9])

HSP 1 Score: 77.7962 bits (190), Expect = 1.760e-18
Identity = 47/122 (38.52%), Postives = 72/122 (59.02%), Query Frame = 2
Query:  149 FLEIDVCNSQTHGIGK-ARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSD 511
            FL + V N +TH  G+  ++TDYE+ + TN   F   KS VRRR+S+FEWLR  LE++  I +   P       LP +   G F+  FI+ER++ L++F+ +V       +E  LH+FLQ++
Sbjct:    9 FLSVVVRNPRTHLRGRWPQFTDYEILIWTNSTCFVSSKSCVRRRFSEFEWLRNILEQNGSISLQPPP-------LPHKRLLGRFNQSFIKERQQELQDFLVRVLAVTSYLSEAALHLFLQTN 123          
BLAST of Sorting nexin, putative vs. Ensembl Nematostella
Match: EDO37393 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFV3])

HSP 1 Score: 80.1073 bits (196), Expect = 5.632e-18
Identity = 48/125 (38.40%), Postives = 71/125 (56.80%), Query Frame = 2
Query:  146 NFLEIDVCNSQTH-GIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIV--PTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSD 511
             +++++V   +TH   GKA YTDYEV + TN P F L  S+ RRRYS+F WLR  L     I++  P+LP K            G F + F+ ER+ GL++F+N+V    +   E  L +FLQ++
Sbjct:   13 TYVDVEVKFPRTHVHEGKALYTDYEVEVKTNHPCFPLFHSNTRRRYSEFAWLRSRLGLHDFILIRTPSLPRKQLI---------GRFKEGFLCERQAGLQKFMNRVVETSIYLQEPVLQLFLQTN 128          
BLAST of Sorting nexin, putative vs. Ensembl Nematostella
Match: EDO48737 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIL9])

HSP 1 Score: 71.2478 bits (173), Expect = 4.278e-15
Identity = 48/141 (34.04%), Postives = 75/141 (53.19%), Query Frame = 2
Query:  158 IDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERD------SKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQS----DEIDKEYIPGKVKN 550
            ++V   Q H    +++ DYE+ + TN   F  K S++RRRYSDF WLR +L  +      S+ +VP LP K            G F+ +F+  R+ GL++F++KV       +   LH+FLQS    D+I+  Y+ G+ K 
Sbjct:   48 VEVNRPQIHICKGSKFVDYEIYIQTNNMAFAKKLSNIRRRYSDFIWLRKQLTTNEVNGFGSERVVPCLPPKRLF---------GRFEPKFVFSRKHGLQDFLDKVLSIRDFLSYSGLHLFLQSKLSVDQIEA-YLDGRYKQ 178          
BLAST of Sorting nexin, putative vs. Ensembl Nematostella
Match: EDO40294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7T4])

HSP 1 Score: 66.6254 bits (161), Expect = 3.388e-13
Identity = 48/136 (35.29%), Postives = 74/136 (54.41%), Query Frame = 2
Query:  194 KARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLEL-ERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVKN*KHRDRFDLKTYLIIS 598
            +A+YTDY++    +  +  L   +VRRRYS+F WLR +L E      +P LP K   R L      G FD EFI+ R++GLE ++  +      +N   L +FLQ+D +D   I    K  +H+DR DL   ++++
Sbjct:   45 RAQYTDYKIETEGSSDIMPLGACTVRRRYSEFTWLRKKLAEEFPNASIPPLPGK---RVL------GRFDTEFIKNRQQGLEHWLRSLLSDTYKENAY-LQLFLQTD-LDTGDIQ---KCLRHKDRQDLYHVILLA 166          
BLAST of Sorting nexin, putative vs. Ensembl Medaka
Match: snx3 (sorting nexin 3 [Source:NCBI gene;Acc:101156214])

HSP 1 Score: 239.965 bits (611), Expect = 2.689e-81
Identity = 109/160 (68.12%), Postives = 134/160 (83.75%), Query Frame = 2
Query:   74 MASSV--TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVK 547
            MA ++  T RL +K Q + DAY PP+NFLEIDV N +T G+G+ R+T YE+RL TNLP+FKLK+SSVRRRYSDFEWLR ELER+SK++VP LP KA  RQLPFRGD+GIFDD FIEERR+GLE+F+NKVAGHPLAQNE+CLH+FLQ + +DK Y P K++
Sbjct:    1 MADAIADTRRLFTKPQNLNDAYGPPSNFLEIDVSNPETVGVGRGRFTTYEIRLKTNLPIFKLKESSVRRRYSDFEWLRAELERESKVVVPPLPGKALFRQLPFRGDDGIFDDSFIEERRQGLEQFLNKVAGHPLAQNERCLHMFLQDESVDKNYTPSKIR 160          
BLAST of Sorting nexin, putative vs. Ensembl Medaka
Match: snx12 (sorting nexin 12 [Source:NCBI gene;Acc:101173568])

HSP 1 Score: 233.417 bits (594), Expect = 1.142e-78
Identity = 107/154 (69.48%), Postives = 129/154 (83.77%), Query Frame = 2
Query:   89 TSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDKEYIPGKVKN 550
            T RL+SK Q + DAY PP+NFLEIDV + Q  G+G+ RYT YEVR+ TNLP+FKLK S VRRRYSDFEWL+ ELERDSKI+VP LP KA  RQLPFRGD G+F++ FIEERR GLE+FIN++AGHPLAQNE+CLH+FLQ + ID+ YIPGKV++
Sbjct:    9 TRRLNSKPQDLTDAYGPPSNFLEIDVYDPQIVGVGRNRYTTYEVRMRTNLPIFKLKDSCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGLFEESFIEERRVGLEQFINRIAGHPLAQNERCLHMFLQEEAIDRNYIPGKVRH 162          
BLAST of Sorting nexin, putative vs. Ensembl Medaka
Match: ENSORLT00000030188.1 (sorting nexin 11 [Source:NCBI gene;Acc:101163529])

HSP 1 Score: 76.2554 bits (186), Expect = 6.475e-16
Identity = 41/103 (39.81%), Postives = 66/103 (64.08%), Query Frame = 2
Query:  203 YTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKII-VPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQS 508
            Y DY++ L TN   F  K S VRRRYS+F WL+ +L+++S ++ VP LP K++     F   N    ++F+E+RR+GL+ F++KV    +  ++  LH+FLQ+
Sbjct:   29 YVDYKIFLHTNSKAFTAKTSCVRRRYSEFVWLKKKLQKNSGLVPVPDLPGKSF-----FSFSN----EDFLEKRRRGLQAFLDKVVHMTVCLSDSQLHLFLQT 122          
BLAST of Sorting nexin, putative vs. Ensembl Medaka
Match: ENSORLT00000038263.1 (sorting nexin 11 [Source:NCBI gene;Acc:101163529])

HSP 1 Score: 76.2554 bits (186), Expect = 6.713e-16
Identity = 41/103 (39.81%), Postives = 66/103 (64.08%), Query Frame = 2
Query:  203 YTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKII-VPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQS 508
            Y DY++ L TN   F  K S VRRRYS+F WL+ +L+++S ++ VP LP K++     F   N    ++F+E+RR+GL+ F++KV    +  ++  LH+FLQ+
Sbjct:   23 YVDYKIFLHTNSKAFTAKTSCVRRRYSEFVWLKKKLQKNSGLVPVPDLPGKSF-----FSFSN----EDFLEKRRRGLQAFLDKVVHMTVCLSDSQLHLFLQT 116          
BLAST of Sorting nexin, putative vs. Ensembl Medaka
Match: ENSORLT00000038972.1 (sorting nexin 11 [Source:NCBI gene;Acc:101163529])

HSP 1 Score: 76.2554 bits (186), Expect = 6.740e-16
Identity = 41/103 (39.81%), Postives = 66/103 (64.08%), Query Frame = 2
Query:  203 YTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKII-VPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQS 508
            Y DY++ L TN   F  K S VRRRYS+F WL+ +L+++S ++ VP LP K++     F   N    ++F+E+RR+GL+ F++KV    +  ++  LH+FLQ+
Sbjct:   29 YVDYKIFLHTNSKAFTAKTSCVRRRYSEFVWLKKKLQKNSGLVPVPDLPGKSF-----FSFSN----EDFLEKRRRGLQAFLDKVVHMTVCLSDSQLHLFLQT 122          
BLAST of Sorting nexin, putative vs. Planmine SMEST
Match: SMESG000016883.1 (SMESG000016883.1)

HSP 1 Score: 176.792 bits (447), Expect = 1.607e-57
Identity = 85/86 (98.84%), Postives = 86/86 (100.00%), Query Frame = 2
Query:   74 MASSVTSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKII 331
            MASSVTSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSK+I
Sbjct:    1 MASSVTSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKVI 86          
BLAST of Sorting nexin, putative vs. Planmine SMEST
Match: SMESG000016192.1 (SMESG000016192.1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.309e-10
Identity = 44/131 (33.59%), Postives = 67/131 (51.15%), Query Frame = 2
Query:  134 SPPANFLEIDVCNSQTHGIGKARYTDYEVRLSTNLPVFKLKKSSVRRRYSDFEWL--RLELERD-SKIIVPTLPSKA--WTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSD 511
            S    F+EI V   +  G G A Y  Y++   TN P F  ++ +VRRR+SDF  L  RL+L+   +  I+P  P K      +L    ++   + EF+E RR  LE ++ ++A HPL   +     FL+ D
Sbjct:   57 SKTGKFIEISVSYPEKLGSGMAAYFIYKINTKTNRPSFLHQEITVRRRFSDFLGLHERLKLKYLFAGCIIPPAPEKNAFGNTKLKLSKEDQT-NSEFLERRRAALERYLQRIARHPLLVIDADFREFLEDD 186          
BLAST of Sorting nexin, putative vs. Planmine SMEST
Match: SMESG000005937.1 (SMESG000005937.1)

HSP 1 Score: 52.373 bits (124), Expect = 5.695e-8
Identity = 30/90 (33.33%), Postives = 47/90 (52.22%), Query Frame = 2
Query:  257 KSSVRRRYSDFEWLRLEL-ERDSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDK 523
            K  + RRY  F+WL  +L E+   I++P LP+K            G ++D FIE RRK L++++  V  HP+    + +  FL   + DK
Sbjct:  125 KDGISRRYKQFDWLHSQLSEKYPCIVIPPLPNKQVV---------GRYEDNFIEGRRKHLQKWLTHVTSHPVLAYSQTMKHFLSVKDKDK 205          
BLAST of Sorting nexin, putative vs. Planmine SMEST
Match: SMESG000016684.1 (SMESG000016684.1)

HSP 1 Score: 51.2174 bits (121), Expect = 1.603e-7
Identity = 34/92 (36.96%), Postives = 51/92 (55.43%), Query Frame = 2
Query:  236 LPVFKLKKSSVRRRYSDFEWLRLELER-DSKIIVPTLPSKAWTRQLPFRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQS 508
            L   K K  SV RRYS+F+ LR  L +     ++P LPSK  +   P+   +   D +FI+ RR+ LE F+N++  HP  + E  +  FLQ+
Sbjct:   73 LDKLKEKNWSVLRRYSEFDSLRASLTKLYPACVIPPLPSKINSLN-PWNVAHQKRDSDFIDSRRQRLEMFLNRILSHPKLKTEILIFNFLQN 163          
The following BLAST results are available for this feature:
BLAST of Sorting nexin, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNX126.922e-8270.06sorting nexin 12 [Source:HGNC Symbol;Acc:HGNC:1497... [more]
SNX126.922e-8270.06sorting nexin 12 [Source:HGNC Symbol;Acc:HGNC:1497... [more]
SNX31.958e-8168.32sorting nexin 3 [Source:HGNC Symbol;Acc:HGNC:11174... [more]
SNX122.287e-8070.32sorting nexin 12 [Source:HGNC Symbol;Acc:HGNC:1497... [more]
SNX126.636e-7868.79sorting nexin 12 [Source:HGNC Symbol;Acc:HGNC:1497... [more]
back to top
BLAST of Sorting nexin, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx-31.293e-8470.89Sorting NeXin [Source:UniProtKB/TrEMBL;Acc:Q9XW41... [more]
lst-42.343e-631.87Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;... [more]
lst-42.343e-631.87Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;... [more]
lst-42.343e-631.87Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;... [more]
lst-42.416e-632.56Sorting nexin lst-4 [Source:UniProtKB/Swiss-Prot;... [more]
back to top
BLAST of Sorting nexin, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Snx34.888e-8572.33gene:FBgn0038065 transcript:FBtr0082641[more]
Snx34.888e-8572.33gene:FBgn0038065 transcript:FBtr0082642[more]
Snx19.686e-1031.39gene:FBgn0031534 transcript:FBtr0343238[more]
Snx19.887e-1031.39gene:FBgn0031534 transcript:FBtr0077517[more]
SH3PX17.059e-633.75gene:FBgn0040475 transcript:FBtr0076413[more]
back to top
BLAST of Sorting nexin, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx127.143e-8070.59sorting nexin 12 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
snx121.769e-7971.05sorting nexin 12 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
snx32.433e-7966.88sorting nexin 3 [Source:ZFIN;Acc:ZDB-GENE-030131-9... [more]
snx121.129e-7771.05sorting nexin 12 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
snx121.686e-7771.05sorting nexin 12 [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
back to top
BLAST of Sorting nexin, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx31.104e-8068.94sorting nexin 3 [Source:NCBI gene;Acc:394626][more]
snx121.164e-7971.05sorting nexin 12 [Source:NCBI gene;Acc:548507][more]
snx122.340e-7970.59sorting nexin 12 [Source:NCBI gene;Acc:548507][more]
snx113.276e-2040.16sorting nexin 11 [Source:NCBI gene;Acc:100145709][more]
sars26.076e-1437.84seryl-tRNA synthetase 2, mitochondrial [Source:Xen... [more]
back to top
BLAST of Sorting nexin, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Snx124.752e-8270.06sorting nexin 12 [Source:MGI Symbol;Acc:MGI:191933... [more]
Snx31.344e-8168.32sorting nexin 3 [Source:MGI Symbol;Acc:MGI:1860188... [more]
Snx121.734e-8170.51sorting nexin 12 [Source:MGI Symbol;Acc:MGI:191933... [more]
Snx122.236e-8170.51sorting nexin 12 [Source:MGI Symbol;Acc:MGI:191933... [more]
Snx33.475e-6661.49sorting nexin 3 [Source:MGI Symbol;Acc:MGI:1860188... [more]
back to top
BLAST of Sorting nexin, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UMY4|SNX12_HUMAN3.324e-8170.06Sorting nexin-12 OS=Homo sapiens OX=9606 GN=SNX12 ... [more]
sp|Q5U211|SNX3_RAT9.402e-8168.32Sorting nexin-3 OS=Rattus norvegicus OX=10116 GN=S... [more]
sp|Q5R5V1|SNX3_PONAB9.402e-8168.32Sorting nexin-3 OS=Pongo abelii OX=9601 GN=SNX3 PE... [more]
sp|O60493|SNX3_HUMAN9.402e-8168.32Sorting nexin-3 OS=Homo sapiens OX=9606 GN=SNX3 PE... [more]
sp|Q1RMH8|SNX3_BOVIN9.402e-8168.32Sorting nexin-3 OS=Bos taurus OX=9913 GN=SNX3 PE=2... [more]
back to top
BLAST of Sorting nexin, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A210PRS61.061e-8873.75Sorting nexin-12 OS=Mizuhopecten yessoensis OX=657... [more]
A0A1S3JL778.788e-8875.00sorting nexin-12 isoform X2 OS=Lingula unguis OX=7... [more]
A0A2C9K4J59.805e-8875.63PX domain-containing protein OS=Biomphalaria glabr... [more]
A0A267FN581.654e-8780.00PX domain-containing protein OS=Macrostomum lignan... [more]
A0A433TSQ32.657e-8774.38PX domain-containing protein OS=Elysia chlorotica ... [more]
back to top
BLAST of Sorting nexin, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx38.261e-8168.75sorting nexin 3 [Source:NCBI gene;Acc:103023214][more]
snx127.100e-7969.93sorting nexin 12 [Source:NCBI gene;Acc:103033647][more]
snx124.093e-7869.74sorting nexin 12 [Source:NCBI gene;Acc:103033647][more]
snx111.934e-1639.81sorting nexin 11 [Source:ZFIN;Acc:ZDB-GENE-041111-... [more]
snx10a2.943e-1439.81sorting nexin-10A-like [Source:NCBI gene;Acc:10304... [more]
back to top
BLAST of Sorting nexin, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx33.995e-5976.42sorting nexin 3 [Source:ZFIN;Acc:ZDB-GENE-030131-9... [more]
SNX102.820e-1646.15sorting nexin 10 [Source:HGNC Symbol;Acc:HGNC:1497... [more]
snx1a1.013e-1331.37sorting nexin 1a [Source:ZFIN;Acc:ZDB-GENE-060302-... [more]
snx303.967e-1329.37sorting nexin family member 30 [Source:NCBI gene;A... [more]
SNX101.667e-1131.20sorting nexin 10 [Source:HGNC Symbol;Acc:HGNC:1497... [more]
back to top
BLAST of Sorting nexin, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
SNX32.173e-2541.13Sorting nexin for late-Golgi enzymes; required to ... [more]
VPS51.332e-829.57Nexin-1 homolog; required for localizing membrane ... [more]
MVP13.677e-739.51Protein required for sorting proteins to the vacuo... [more]
back to top
BLAST of Sorting nexin, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO383241.967e-8574.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345871.760e-1838.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373935.632e-1838.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487374.278e-1534.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO402943.388e-1335.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sorting nexin, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snx32.689e-8168.13sorting nexin 3 [Source:NCBI gene;Acc:101156214][more]
snx121.142e-7869.48sorting nexin 12 [Source:NCBI gene;Acc:101173568][more]
ENSORLT00000030188.16.475e-1639.81sorting nexin 11 [Source:NCBI gene;Acc:101163529][more]
ENSORLT00000038263.16.713e-1639.81sorting nexin 11 [Source:NCBI gene;Acc:101163529][more]
ENSORLT00000038972.16.740e-1639.81sorting nexin 11 [Source:NCBI gene;Acc:101163529][more]
back to top
BLAST of Sorting nexin, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000016883.11.607e-5798.84SMESG000016883.1[more]
SMESG000016192.11.309e-1033.59SMESG000016192.1[more]
SMESG000005937.15.695e-833.33SMESG000005937.1[more]
SMESG000016684.11.603e-736.96SMESG000016684.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30021252 ID=SMED30021252|Name=Sorting nexin, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=641bp
AAGTTGTTTATCTAGTTTAAGTAAATGATTAAATTTTAATTAATTCGATA
AATTAAATCGGAATTTTTATATAATGGCATCTAGTGTAACTAGTCGGTTA
GACTCAAAACGTCAAACAATTGAAGATGCTTATTCACCACCAGCTAATTT
TTTAGAGATTGATGTATGTAACTCACAAACTCACGGAATAGGCAAAGCAC
GATATACAGATTATGAAGTTCGATTATCGACTAATCTTCCTGTTTTCAAA
TTAAAAAAATCATCTGTTAGAAGACGTTACAGTGACTTTGAATGGTTACG
ATTAGAATTGGAAAGAGATAGCAAAATAATCGTTCCTACTTTACCGAGTA
AAGCGTGGACTCGCCAGCTTCCTTTCCGAGGAGATAATGGAATTTTCGAT
GATGAATTTATTGAAGAACGGAGAAAAGGTCTCGAAGAATTTATAAATAA
AGTCGCCGGGCATCCTTTAGCCCAAAACGAGAAATGTTTGCATATATTTC
TACAAAGTGATGAGATAGACAAAGAATATATTCCAGGGAAAGTGAAAAAT
TAAAAGCACCGTGATAGATTTGATTTGAAAACTTATTTGATTATTTCATG
TCAGTTAATTTATTGTACAAAATAAATCTTGAAAATTAAAA
back to top

protein sequence of SMED30021252-orf-1

>SMED30021252-orf-1 ID=SMED30021252-orf-1|Name=SMED30021252-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=160bp
MASSVTSRLDSKRQTIEDAYSPPANFLEIDVCNSQTHGIGKARYTDYEVR
LSTNLPVFKLKKSSVRRRYSDFEWLRLELERDSKIIVPTLPSKAWTRQLP
FRGDNGIFDDEFIEERRKGLEEFINKVAGHPLAQNEKCLHIFLQSDEIDK
EYIPGKVKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036871PX_dom_sf
IPR001683Phox
Vocabulary: molecular function
TermDefinition
GO:0035091phosphatidylinositol binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001683Phox homologous domainSMARTSM00312PX_2coord: 24..146
e-value: 9.1E-31
score: 118.2
IPR001683Phox homologous domainPFAMPF00787PXcoord: 25..146
e-value: 1.2E-27
score: 96.2
IPR001683Phox homologous domainPROSITEPS50195PXcoord: 25..149
score: 18.358
IPR036871PX domain superfamilyGENE3DG3DSA:3.30.1520.10coord: 19..158
e-value: 4.4E-42
score: 145.1
IPR036871PX domain superfamilySUPERFAMILYSSF64268PX domaincoord: 22..148
NoneNo IPR availablePANTHERPTHR45963FAMILY NOT NAMEDcoord: 4..158
NoneNo IPR availablePANTHERPTHR45963:SF3SORTING NEXIN-12coord: 4..158
NoneNo IPR availableCDDcd06894PX_SNX3_likecoord: 26..148
e-value: 6.90195E-81
score: 232.734